3ONGA

Crystal structure of uba2ufd-ubc9: insights into e1-e2 interactions in sumo pathways
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
SKVCRGVIKLSSDCLNKMKLSDFVVLIREKYSYPQDISLLDASNQRLLFDYDFEDLNDRTLSEINLGNGSIILFSDEEGDTMIRKAIELFLDVDDELPCNTCSLPDVEVPLIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-activating enzyme E1-like
publication title Crystal structure of UBA2(ufd)-Ubc9: insights into E1-E2 interactions in Sumo pathways.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 28
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3ongA01
3ONHA 1Y8XB 1Y8RB 3KYDB 3FN1A 5FQ2B 3ONGA 2LQ7A 2NVUB 3KYCB 1Y8QB 4W5VB
chains in the Genus database with same CATH superfamily
1N34D 2UXCD 4LFAD 4DR2D 4DV1D 4DR6D 1P9KA 1Y8QB 2UXDD 4LF8D 4LGTA 3OTOD 3T1HD 4B3TD 1Y8RB 1IBKD 4LF7D 4K0KD 4LFBD 1XNQD 4LF6D 4DUYD 4DR7D 1C06A 2ISTA 4JI6D 4JI2D 5A2QE 5IWAD 4II2A 4LFCD 2UUAD 2JANA 4LF9D 2NVUB 4DV5D 4DR4D 1H3EA 3KBGA 3JAME 4JI5D 4NXMD 3KYDB 1KSKA 3T1YD 4JI7D 4DV3D 5FLXE 4II3A 2E5LD 1HR0D 2ZTBA 2I1SA 3CMMA 4JV5D 5KNLA 4JI8D 4DUZD 4OUDA 2LQ7A 4B3RD 4DV2D 1Y8XB 2ZM6D 4LF5D 5LL6S 4W5VB 4DV0D 1DM9A 4JI4D 4JI3D 1KSVA 5FQ2B 4NNJA 3J80E 4JYAD 1FJGD 4X66D 5BR8D 1KSLA 2VQFD 1J5ED 4YY3D 3ONGA 4LF4D 2KTLA 4DR5D 4NXND 1HNXD 4DR1D 4JI1D 1XNRD 3J81E 4OX9D 3KYCB 2F4VD 5LMND 1N33D 4DV4D 4DV6D 4DV7D 1XMQD 2UXBD 1XMOD 4KHPD 1N32D 2UU9D 2UUCD 4JI0D 5IT9E 4X65D 3FN1A 3DH3A 1FKAD 1I94D 4GKKD 5LMUD 1IBMD 1C05A 2K6PA 4B3MD 4X64D 4AQYD 4YHHD 3J7AF 2UUBD 4DR3D 4GKJD 1HNWD 4X62D 1VIOA 3HP7A 1JH3A 4B3SD 3ONHA 1N36D 1IBLD 1HNZD 2HHHD 1H3FA 2VQED
chains in the Genus database with same CATH topology
3ONHA 1Y8XB 1Y8RB 3KYDB 3FN1A 5FQ2B 3ONGA 2LQ7A 2NVUB 3KYCB 1Y8QB 4W5VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONH A;  1Y8X B;  1Y8R B;  3KYD B;  3FN1 A;  5FQ2 B;  3ONG A;  2LQ7 A;  2NVU B;  3KYC B;  1Y8Q B;  4W5V B; 
#chains in the Genus database with same CATH topology
 1N34 D;  2UXC D;  4LFA D;  4DR2 D;  4DV1 D;  4DR6 D;  1P9K A;  1Y8Q B;  2UXD D;  4LF8 D;  4LGT A;  3OTO D;  3T1H D;  4B3T D;  1Y8R B;  1IBK D;  4LF7 D;  4K0K D;  4LFB D;  1XNQ D;  4LF6 D;  4DUY D;  4DR7 D;  1C06 A;  2IST A;  4JI6 D;  4JI2 D;  5A2Q E;  5IWA D;  4II2 A;  4LFC D;  2UUA D;  2JAN A;  4LF9 D;  2NVU B;  4DV5 D;  4DR4 D;  1H3E A;  3KBG A;  3JAM E;  4JI5 D;  4NXM D;  3KYD B;  1KSK A;  3T1Y D;  4JI7 D;  4DV3 D;  5FLX E;  4II3 A;  2E5L D;  1HR0 D;  2ZTB A;  2I1S A;  3CMM A;  4JV5 D;  5KNL A;  4JI8 D;  4DUZ D;  4OUD A;  2LQ7 A;  4B3R D;  4DV2 D;  1Y8X B;  2ZM6 D;  4LF5 D;  5LL6 S;  4W5V B;  4DV0 D;  1DM9 A;  4JI4 D;  4JI3 D;  1KSV A;  5FQ2 B;  4NNJ A;  3J80 E;  4JYA D;  1FJG D;  4X66 D;  5BR8 D;  1KSL A;  2VQF D;  1J5E D;  4YY3 D;  3ONG A;  4LF4 D;  2KTL A;  4DR5 D;  4NXN D;  1HNX D;  4DR1 D;  4JI1 D;  1XNR D;  3J81 E;  4OX9 D;  3KYC B;  2F4V D;  5LMN D;  1N33 D;  4DV4 D;  4DV6 D;  4DV7 D;  1XMQ D;  2UXB D;  1XMO D;  4KHP D;  1N32 D;  2UU9 D;  2UUC D;  4JI0 D;  5IT9 E;  4X65 D;  3FN1 A;  3DH3 A;  1FKA D;  1I94 D;  4GKK D;  5LMU D;  1IBM D;  1C05 A;  2K6P A;  4B3M D;  4X64 D;  4AQY D;  4YHH D;  3J7A F;  2UUB D;  4DR3 D;  4GKJ D;  1HNW D;  4X62 D;  1VIO A;  3HP7 A;  1JH3 A;  4B3S D;  3ONH A;  1N36 D;  1IBL D;  1HNZ D;  2HHH D;  1H3F A;  2VQE D; 
#chains in the Genus database with same CATH homology
 3ONH A;  1Y8X B;  1Y8R B;  3KYD B;  3FN1 A;  5FQ2 B;  3ONG A;  2LQ7 A;  2NVU B;  3KYC B;  1Y8Q B;  4W5V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...