1KSLA

Structure of rsua
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
234
structure length
234
Chain Sequence
GSHMRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPDHPTVLYFLDEPVAWKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPTQVRLTISEGRYHQVKRMFAAVGNHVVELHRERIGGITLDADLAPGEYRPLTEEEIASVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
publication title Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP.
pubmed rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 53
structure length 234
sequence length 234
ec nomenclature ec 5.4.99.19: 16S rRNA pseudouridine(516) synthase.
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00849 PseudoU_synth_2 RNA pseudouridylate synthase
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 1kslA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 1kslA02
3LWVA 3HJWA 1C05A 3MQKA 1DM9A 2UXDD 4AQYD 4DR3D 4LF8D 4LABA 2RFKA 4DV1D 2UUCD 2UU9D 1ZL3A 4JI7D 3KBGA 4NXMD 1C06A 1V9FA 2K6PA 4DR7D 4B3SD 1XNRD 4NXND 4DV2D 2UUAD 4DV4D 4DR2D 2AUSA 4DUZD 2HHHD 3DH3A 2UXCD 4LF6D 1R3FA 2F4VD 1QYUA 4LFAD 4LF7D 1K8WA 3HJYA 1ZE2A 2ZM6D 4LF5D 4LGTA 4DR4D 1HNZD 5LMUD 1N33D 1J5ED 4YY3D 4DV0D 4X64D 1XMQD 1IBMD 4JI4D 4JI8D 2UUBD 1HR0D 4DR5D 4OX9D 3OTOD 1P9KA 5BR8D 4B3MD 1R3EA 4JI6D 1VIOA 1N32D 3LWRA 3UAIA 4DR6D 4DR1D 1KSVA 2KTLA 2AB4A 1I94D 1ZE1A 4LFCD 1XNQD 3HP7A 1XPIA 4YHHD 3LWOA 1HNWD 1FJGD 3HAXA 4X62D 4JV5D 4K0KD 1PRZA 1IBKD 4DUYD 4LF9D 4B3TD 4LFBD 3U28A 4GKKD 4JI0D 1V9KA 2EY4A 3T1HD 4LF4D 4X65D 3T1YD 1N36D 4DV3D 4JI2D 2E5LD 4JI1D 2HVYA 1IBLD 4JI3D 4DV6D 4OUDA 4DV7D 1SGVA 3LWQA 2ISTA 4KHPD 4X66D 4JYAD 2JANA 1XMOD 1H3FA 5LMND 2VQED 1H3EA 1HNXD 4GKJD 2UXBD 2VQFD 5IWAD 4JI5D 1N34D 3LWPA 4DV5D 2APOA 2I82A 1KSKA 1KSLA 4B3RD 1FKAD 1JH3A
chains in the Genus database with same CATH superfamily
3LWVA 3HJWA 1C05A 3MQKA 1DM9A 2UXDD 4AQYD 4DR3D 4LF8D 4LABA 2RFKA 4DV1D 2UUCD 2UU9D 1ZL3A 3KYDB 4JI7D 3KBGA 4NXMD 1C06A 4II3A 1V9FA 2K6PA 5FQ2B 4DR7D 1SZWA 4B3SD 1XNRD 4NXND 3J80E 4DV2D 2UUAD 4DV4D 4DR2D 2AUSA 4DUZD 2HHHD 2I1SA 5IT9E 3DH3A 2UXCD 4LF6D 1R3FA 2F4VD 1QYUA 4LFAD 4LF7D 1K8WA 3HJYA 1ZE2A 2ZM6D 4LF5D 4LGTA 4DR4D 1HNZD 5LMUD 1N33D 1J5ED 4YY3D 5FLXE 4DV0D 4X64D 1XMQD 1IBMD 4JI4D 4JI8D 2UUBD 4W5VB 1HR0D 4DR5D 4OX9D 3ONHA 3OTOD 3J81E 4NNJA 1P9KA 5BR8D 4B3MD 1R3EA 4JI6D 1VIOA 1N32D 3LWRA 3UAIA 4DR6D 4DR1D 1KSVA 2NVUB 2KTLA 2AB4A 1I94D 5LL6S 1ZE1A 2ZTBA 4LFCD 1XNQD 3KYCB 3ONGA 3JAME 3HP7A 1XPIA 4YHHD 3LWOA 1HNWD 1FJGD 3HAXA 4X62D 1Y8XB 4JV5D 4K0KD 1IBKD 1PRZA 4DUYD 4LF9D 4B3TD 4LFBD 3U28A 4GKKD 4JI0D 1V9KA 2EY4A 3T1HD 4LF4D 3J7AF 4X65D 3T1YD 1N36D 4DV3D 4JI2D 1SI7A 2E5LD 4JI1D 2HVYA 1IBLD 4JI3D 5A2QE 4DV6D 1SB7A 4OUDA 4DV7D 1SGVA 3LWQA 2ISTA 4KHPD 4X66D 4JYAD 1Z2ZA 2JANA 2LQ7A 4II2A 1XMOD 1H3FA 5LMND 2VQED 1H3EA 1HNXD 4GKJD 3FN1A 2UXBD 2VQFD 5IWAD 1Y8RB 4JI5D 1N34D 5KNLA 3CMMA 3LWPA 4DV5D 1Y8QB 2APOA 2I82A 1KSKA 1KSLA 4B3RD 1FKAD 1JH3A
chains in the Genus database with same CATH topology
3LWVA 3HJWA 1C05A 3MQKA 1DM9A 2UXDD 4AQYD 4DR3D 4LF8D 4LABA 2RFKA 4DV1D 2UUCD 2UU9D 1ZL3A 4JI7D 3KBGA 4NXMD 1C06A 1V9FA 2K6PA 4DR7D 1SZWA 4B3SD 1XNRD 4NXND 4DV2D 2UUAD 4DV4D 4DR2D 2AUSA 4DUZD 2HHHD 3DH3A 2UXCD 4LF6D 1R3FA 2F4VD 1QYUA 4LFAD 4LF7D 1K8WA 3HJYA 1ZE2A 2ZM6D 4LF5D 4LGTA 4DR4D 1HNZD 5LMUD 1N33D 1J5ED 4YY3D 4DV0D 4X64D 1XMQD 1IBMD 4JI4D 4JI8D 2UUBD 1HR0D 4DR5D 4OX9D 3OTOD 1P9KA 5BR8D 4B3MD 1R3EA 4JI6D 1VIOA 1N32D 3LWRA 3UAIA 4DR6D 4DR1D 1KSVA 2KTLA 2AB4A 1I94D 1ZE1A 4LFCD 1XNQD 3HP7A 1XPIA 4YHHD 3LWOA 1HNWD 1FJGD 3HAXA 4X62D 4JV5D 4K0KD 1PRZA 1IBKD 4DUYD 4LF9D 4B3TD 4LFBD 3U28A 4GKKD 4JI0D 1V9KA 2EY4A 3T1HD 4LF4D 4X65D 3T1YD 1N36D 4DV3D 4JI2D 1SI7A 2E5LD 4JI1D 2HVYA 1IBLD 4JI3D 4DV6D 1SB7A 4OUDA 4DV7D 1SGVA 3LWQA 2ISTA 4KHPD 4X66D 4JYAD 1Z2ZA 2JANA 1XMOD 1H3FA 5LMND 2VQED 1H3EA 1HNXD 4GKJD 2UXBD 2VQFD 5IWAD 4JI5D 1N34D 3LWPA 4DV5D 2APOA 2I82A 1KSKA 1KSLA 4B3RD 1FKAD 1JH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWV A;  3HJW A;  1C05 A;  3MQK A;  1DM9 A;  2UXD D;  4AQY D;  4DR3 D;  4LF8 D;  4LAB A;  2RFK A;  4DV1 D;  2UUC D;  2UU9 D;  1ZL3 A;  4JI7 D;  3KBG A;  4NXM D;  1C06 A;  1V9F A;  2K6P A;  4DR7 D;  4B3S D;  1XNR D;  4NXN D;  4DV2 D;  2UUA D;  4DV4 D;  4DR2 D;  2AUS A;  4DUZ D;  2HHH D;  3DH3 A;  2UXC D;  4LF6 D;  1R3F A;  2F4V D;  1QYU A;  4LFA D;  4LF7 D;  1K8W A;  3HJY A;  1ZE2 A;  2ZM6 D;  4LF5 D;  4LGT A;  4DR4 D;  1HNZ D;  5LMU D;  1N33 D;  1J5E D;  4YY3 D;  4DV0 D;  4X64 D;  1XMQ D;  1IBM D;  4JI4 D;  4JI8 D;  2UUB D;  1HR0 D;  4DR5 D;  4OX9 D;  3OTO D;  1P9K A;  5BR8 D;  4B3M D;  1R3E A;  4JI6 D;  1VIO A;  1N32 D;  3LWR A;  3UAI A;  4DR6 D;  4DR1 D;  1KSV A;  2KTL A;  2AB4 A;  1I94 D;  1ZE1 A;  4LFC D;  1XNQ D;  3HP7 A;  1XPI A;  4YHH D;  3LWO A;  1HNW D;  1FJG D;  3HAX A;  4X62 D;  4JV5 D;  4K0K D;  1PRZ A;  1IBK D;  4DUY D;  4LF9 D;  4B3T D;  4LFB D;  3U28 A;  4GKK D;  4JI0 D;  1V9K A;  2EY4 A;  3T1H D;  4LF4 D;  4X65 D;  3T1Y D;  1N36 D;  4DV3 D;  4JI2 D;  2E5L D;  4JI1 D;  2HVY A;  1IBL D;  4JI3 D;  4DV6 D;  4OUD A;  4DV7 D;  1SGV A;  3LWQ A;  2IST A;  4KHP D;  4X66 D;  4JYA D;  2JAN A;  1XMO D;  1H3F A;  5LMN D;  2VQE D;  1H3E A;  1HNX D;  4GKJ D;  2UXB D;  2VQF D;  5IWA D;  4JI5 D;  1N34 D;  3LWP A;  4DV5 D;  2APO A;  2I82 A;  1KSK A;  1KSL A;  4B3R D;  1FKA D;  1JH3 A; 
#chains in the Genus database with same CATH topology
 3LWV A;  3HJW A;  1C05 A;  3MQK A;  1DM9 A;  2UXD D;  4AQY D;  4DR3 D;  4LF8 D;  4LAB A;  2RFK A;  4DV1 D;  2UUC D;  2UU9 D;  1ZL3 A;  3KYD B;  4JI7 D;  3KBG A;  4NXM D;  1C06 A;  4II3 A;  1V9F A;  2K6P A;  5FQ2 B;  4DR7 D;  1SZW A;  4B3S D;  1XNR D;  4NXN D;  3J80 E;  4DV2 D;  2UUA D;  4DV4 D;  4DR2 D;  2AUS A;  4DUZ D;  2HHH D;  2I1S A;  5IT9 E;  3DH3 A;  2UXC D;  4LF6 D;  1R3F A;  2F4V D;  1QYU A;  4LFA D;  4LF7 D;  1K8W A;  3HJY A;  1ZE2 A;  2ZM6 D;  4LF5 D;  4LGT A;  4DR4 D;  1HNZ D;  5LMU D;  1N33 D;  1J5E D;  4YY3 D;  5FLX E;  4DV0 D;  4X64 D;  1XMQ D;  1IBM D;  4JI4 D;  4JI8 D;  2UUB D;  4W5V B;  1HR0 D;  4DR5 D;  4OX9 D;  3ONH A;  3OTO D;  3J81 E;  4NNJ A;  1P9K A;  5BR8 D;  4B3M D;  1R3E A;  4JI6 D;  1VIO A;  1N32 D;  3LWR A;  3UAI A;  4DR6 D;  4DR1 D;  1KSV A;  2NVU B;  2KTL A;  2AB4 A;  1I94 D;  5LL6 S;  1ZE1 A;  2ZTB A;  4LFC D;  1XNQ D;  3KYC B;  3ONG A;  3JAM E;  3HP7 A;  1XPI A;  4YHH D;  3LWO A;  1HNW D;  1FJG D;  3HAX A;  4X62 D;  1Y8X B;  4JV5 D;  4K0K D;  1IBK D;  1PRZ A;  4DUY D;  4LF9 D;  4B3T D;  4LFB D;  3U28 A;  4GKK D;  4JI0 D;  1V9K A;  2EY4 A;  3T1H D;  4LF4 D;  3J7A F;  4X65 D;  3T1Y D;  1N36 D;  4DV3 D;  4JI2 D;  1SI7 A;  2E5L D;  4JI1 D;  2HVY A;  1IBL D;  4JI3 D;  5A2Q E;  4DV6 D;  1SB7 A;  4OUD A;  4DV7 D;  1SGV A;  3LWQ A;  2IST A;  4KHP D;  4X66 D;  4JYA D;  1Z2Z A;  2JAN A;  2LQ7 A;  4II2 A;  1XMO D;  1H3F A;  5LMN D;  2VQE D;  1H3E A;  1HNX D;  4GKJ D;  3FN1 A;  2UXB D;  2VQF D;  5IWA D;  1Y8R B;  4JI5 D;  1N34 D;  5KNL A;  3CMM A;  3LWP A;  4DV5 D;  1Y8Q B;  2APO A;  2I82 A;  1KSK A;  1KSL A;  4B3R D;  1FKA D;  1JH3 A; 
#chains in the Genus database with same CATH homology
 3LWV A;  3HJW A;  1C05 A;  3MQK A;  1DM9 A;  2UXD D;  4AQY D;  4DR3 D;  4LF8 D;  4LAB A;  2RFK A;  4DV1 D;  2UUC D;  2UU9 D;  1ZL3 A;  4JI7 D;  3KBG A;  4NXM D;  1C06 A;  1V9F A;  2K6P A;  4DR7 D;  1SZW A;  4B3S D;  1XNR D;  4NXN D;  4DV2 D;  2UUA D;  4DV4 D;  4DR2 D;  2AUS A;  4DUZ D;  2HHH D;  3DH3 A;  2UXC D;  4LF6 D;  1R3F A;  2F4V D;  1QYU A;  4LFA D;  4LF7 D;  1K8W A;  3HJY A;  1ZE2 A;  2ZM6 D;  4LF5 D;  4LGT A;  4DR4 D;  1HNZ D;  5LMU D;  1N33 D;  1J5E D;  4YY3 D;  4DV0 D;  4X64 D;  1XMQ D;  1IBM D;  4JI4 D;  4JI8 D;  2UUB D;  1HR0 D;  4DR5 D;  4OX9 D;  3OTO D;  1P9K A;  5BR8 D;  4B3M D;  1R3E A;  4JI6 D;  1VIO A;  1N32 D;  3LWR A;  3UAI A;  4DR6 D;  4DR1 D;  1KSV A;  2KTL A;  2AB4 A;  1I94 D;  1ZE1 A;  4LFC D;  1XNQ D;  3HP7 A;  1XPI A;  4YHH D;  3LWO A;  1HNW D;  1FJG D;  3HAX A;  4X62 D;  4JV5 D;  4K0K D;  1PRZ A;  1IBK D;  4DUY D;  4LF9 D;  4B3T D;  4LFB D;  3U28 A;  4GKK D;  4JI0 D;  1V9K A;  2EY4 A;  3T1H D;  4LF4 D;  4X65 D;  3T1Y D;  1N36 D;  4DV3 D;  4JI2 D;  1SI7 A;  2E5L D;  4JI1 D;  2HVY A;  1IBL D;  4JI3 D;  4DV6 D;  1SB7 A;  4OUD A;  4DV7 D;  1SGV A;  3LWQ A;  2IST A;  4KHP D;  4X66 D;  4JYA D;  1Z2Z A;  2JAN A;  1XMO D;  1H3F A;  5LMN D;  2VQE D;  1H3E A;  1HNX D;  4GKJ D;  2UXB D;  2VQF D;  5IWA D;  4JI5 D;  1N34 D;  3LWP A;  4DV5 D;  2APO A;  2I82 A;  1KSK A;  1KSL A;  4B3R D;  1FKA D;  1JH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...