The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
81
|
structure length |
80
|
Chain Sequence |
b'MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFEKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of the Hypothetical protein YtmB from Bacillus subtilis subsp. (subtilis str. 168), Northeast Structural Genomics target SR466
rcsb |
molecule keywords |
Hypothetical protein ytmB
|
source organism |
Bacillus subtilis
|
molecule tags |
Structural genomics, unknown function
|
total genus |
10
|
structure length |
80
|
sequence length |
81
|
chains with identical sequence |
B, C, D, E, F, G, H
|
ec nomenclature | |
pdb deposition date | 2006-11-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10763 | DUF2584 | Protein of unknown function (DUF2584) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Ribosomal Protein L25; Chain P | Hypothetical PUA domain-like; domain 1 |
#chains in the Genus database with same CATH superfamily 4L69 A; 1VHY A; 2NWA A; 1Z85 A; 3KW2 A; 1V6Z A; 4E8B A; 1VHK A; 2EGW A; 2Z0Y A; 4J3C A; 2EGV A; 1NXZ A; 2CX8 A; #chains in the Genus database with same CATH topology 4H3S A; 1NXZ A; 2EGW A; 1VHY A; 2ZJQ S; 2Z0Y A; 4J3C A; 1FEU A; 4JXZ A; 1VHK A; 1EXD A; 5GAG W; 2ZJR S; 3AII A; 1ZJW A; 4IO9 S; 1QTQ A; 2GAE A; 1GTS A; 4WFA S; 4JXX A; 2NWA A; 3CF5 S; 4WF9 S; 1O0C A; 4WFB S; 4WCE S; 3DLL S; 5IZN A; 1GTR A; 5BNZ A; 5GAD W; 2RE8 A; 2G5D A; 2G6G A; 4IOC S; 3W2V B; 1QRT A; 4L69 A; 4JYZ A; 3W2W B; 2ZJP S; 4IOA S; 5HL7 S; 3X1L B; 1Z85 A; 3PIP S; 1V6Z A; 2RD2 A; 1NYL A; 5DM7 S; 1QRU A; 1O0B A; 1DFU P; 2HZ7 A; 5DM6 S; 1QRS A; 3CZB A; 2EGV A; 1B75 A; 5JVH S; 4E8B A; 2PNW A; 1EUY A; 4V19 4; 5JVG S; 3KW2 A; 3J7Z V; 2AE0 X; 1UDX A; 3PIO S; 2PJJ A; 4WFN S; 4U67 S; 1EUQ A; 4P2B A; 2PI8 A; 4H4K A; 5GAH W; 1D6K A; 4UY8 8; 2PIC A; 5GAE W; 2CX8 A; #chains in the Genus database with same CATH homology 4L69 A; 1VHY A; 2NWA A; 1Z85 A; 3KW2 A; 1V6Z A; 4E8B A; 1VHK A; 2EGW A; 2Z0Y A; 4J3C A; 2EGV A; 1NXZ A; 2CX8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...