2NWAA

X-ray crystal structure of protein ytmb from bacillus subtilis. northeast structural genomics consortium target sr466
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
80
Chain Sequence
MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFEKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ytmB
publication title Crystal Structure of the Hypothetical protein YtmB from Bacillus subtilis subsp. (subtilis str. 168), Northeast Structural Genomics target SR466
rcsb
source organism Bacillus subtilis
total genus 10
structure length 80
sequence length 81
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10763 DUF2584 Protein of unknown function (DUF2584)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 2nwaA01
4J3CA 2EGVA 4L69A 3KW2A 2CX8A 4E8BA 1V6ZA 2NWAA 1VHKA 2Z0YA 1VHYA 1Z85A 2EGWA 1NXZA
chains in the Genus database with same CATH superfamily
2ZJRS 5GAEW 5BNZA 4V194 1O0CA 4JXZA 2Z0YA 1VHKA 1B75A 2AE0X 1Z85A 3W2VB 5GADW 4UY88 5GAHW 3AIIA 3X1LB 2ZJQS 1V6ZA 2RE8A 2HZ7A 1EXDA 1VHYA 3PIPS 4WFAS 1O0BA 1UDXA 1D6KA 1NYLA 3J7ZV 4L69A 3W2WB 5JVGS 4IOAS 2ZJPS 2PNWA 4J3CA 1EUYA 2CX8A 4H4KA 2NWAA 4WCES 5DM7S 5GAGW 4IO9S 1FEUA 2RD2A 1QRSA 4IOCS 4WFBS 1QTQA 5IZNA 4JYZA 2G6GA 5JVHS 2EGVA 2PI8A 1QRTA 1ZJWA 3CZBA 4P2BA 1EUQA 4WFNS 3DLLS 1GTRA 4H3SA 1GTSA 3CF5S 1DFUP 1NXZA 3KW2A 4E8BA 5HL7S 3PIOS 2G5DA 5DM6S 2PICA 4WF9S 2PJJA 2GAEA 4U67S 1QRUA 4JXXA 2EGWA
chains in the Genus database with same CATH topology
4J3CA 2EGVA 4L69A 3KW2A 2CX8A 4E8BA 1V6ZA 2NWAA 1VHKA 2Z0YA 1VHYA 1Z85A 2EGWA 1NXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J3C A;  2EGV A;  4L69 A;  3KW2 A;  2CX8 A;  4E8B A;  1V6Z A;  2NWA A;  1VHK A;  2Z0Y A;  1VHY A;  1Z85 A;  2EGW A;  1NXZ A; 
#chains in the Genus database with same CATH topology
 2ZJR S;  5GAE W;  5BNZ A;  4V19 4;  1O0C A;  4JXZ A;  2Z0Y A;  1VHK A;  1B75 A;  2AE0 X;  1Z85 A;  3W2V B;  5GAD W;  4UY8 8;  5GAH W;  3AII A;  3X1L B;  2ZJQ S;  1V6Z A;  2RE8 A;  2HZ7 A;  1EXD A;  1VHY A;  3PIP S;  4WFA S;  1O0B A;  1UDX A;  1D6K A;  1NYL A;  3J7Z V;  4L69 A;  3W2W B;  5JVG S;  4IOA S;  2ZJP S;  2PNW A;  4J3C A;  1EUY A;  2CX8 A;  4H4K A;  2NWA A;  4WCE S;  5DM7 S;  5GAG W;  4IO9 S;  1FEU A;  2RD2 A;  1QRS A;  4IOC S;  4WFB S;  1QTQ A;  5IZN A;  4JYZ A;  2G6G A;  5JVH S;  2EGV A;  2PI8 A;  1QRT A;  1ZJW A;  3CZB A;  4P2B A;  1EUQ A;  4WFN S;  3DLL S;  1GTR A;  4H3S A;  1GTS A;  3CF5 S;  1DFU P;  1NXZ A;  3KW2 A;  4E8B A;  5HL7 S;  3PIO S;  2G5D A;  5DM6 S;  2PIC A;  4WF9 S;  2PJJ A;  2GAE A;  4U67 S;  1QRU A;  4JXX A;  2EGW A; 
#chains in the Genus database with same CATH homology
 4J3C A;  2EGV A;  4L69 A;  3KW2 A;  2CX8 A;  4E8B A;  1V6Z A;  2NWA A;  1VHK A;  2Z0Y A;  1VHY A;  1Z85 A;  2EGW A;  1NXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...