2NWAA

X-ray crystal structure of protein ytmb from bacillus subtilis. northeast structural genomics consortium target sr466
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
80
Chain Sequence
b'MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFEKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ytmB
publication title Crystal Structure of the Hypothetical protein YtmB from Bacillus subtilis subsp. (subtilis str. 168), Northeast Structural Genomics target SR466
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 10
structure length 80
sequence length 81
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10763 DUF2584 Protein of unknown function (DUF2584)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 2nwaA01
1V6ZA 2NWAA 4L69A 1NXZA 4E8BA 3KW2A 2Z0YA 4J3CA 1VHYA 2EGVA 1VHKA 2CX8A 2EGWA 1Z85A
chains in the Genus database with same CATH superfamily
5DM7S 5BNZA 3KW2A 1UDXA 5JVHS 4J3CA 2RD2A 2RE8A 2PJJA 1QRUA 2CX8A 4WCES 1D6KA 1V6ZA 5GAHW 4L69A 4WFAS 1VHKA 1QTQA 4H3SA 1GTSA 2NWAA 4IOCS 2G5DA 2Z0YA 5IZNA 2ZJQS 3CF5S 4E8BA 4U67S 4V194 3W2WB 3PIOS 2EGWA 5JVGS 1QRSA 2GAEA 4WFNS 2PI8A 2EGVA 2G6GA 3AIIA 1NXZA 3W2VB 4H4KA 4IOAS 1EXDA 3DLLS 1VHYA 3J7ZV 2PNWA 1EUYA 1FEUA 1DFUP 5GADW 1EUQA 4JYZA 4WF9S 3CZBA 3PIPS 1O0BA 5HL7S 4P2BA 3X1LB 2ZJRS 1GTRA 1QRTA 1B75A 2ZJPS 4UY88 4JXXA 1O0CA 2PICA 4IO9S 5GAEW 5GAGW 2HZ7A 1NYLA 2AE0X 5DM6S 4JXZA 1ZJWA 4WFBS 1Z85A
chains in the Genus database with same CATH topology
1V6ZA 2NWAA 4L69A 1NXZA 4E8BA 3KW2A 2Z0YA 4J3CA 1VHYA 2EGVA 1VHKA 2CX8A 2EGWA 1Z85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6Z A;  2NWA A;  4L69 A;  1NXZ A;  4E8B A;  3KW2 A;  2Z0Y A;  4J3C A;  1VHY A;  2EGV A;  1VHK A;  2CX8 A;  2EGW A;  1Z85 A; 
#chains in the Genus database with same CATH topology
 5DM7 S;  5BNZ A;  3KW2 A;  1UDX A;  5JVH S;  4J3C A;  2RD2 A;  2RE8 A;  2PJJ A;  1QRU A;  2CX8 A;  4WCE S;  1D6K A;  1V6Z A;  5GAH W;  4L69 A;  4WFA S;  1VHK A;  1QTQ A;  4H3S A;  1GTS A;  2NWA A;  4IOC S;  2G5D A;  2Z0Y A;  5IZN A;  2ZJQ S;  3CF5 S;  4E8B A;  4U67 S;  4V19 4;  3W2W B;  3PIO S;  2EGW A;  5JVG S;  1QRS A;  2GAE A;  4WFN S;  2PI8 A;  2EGV A;  2G6G A;  3AII A;  1NXZ A;  3W2V B;  4H4K A;  4IOA S;  1EXD A;  3DLL S;  1VHY A;  3J7Z V;  2PNW A;  1EUY A;  1FEU A;  1DFU P;  5GAD W;  1EUQ A;  4JYZ A;  4WF9 S;  3CZB A;  3PIP S;  1O0B A;  5HL7 S;  4P2B A;  3X1L B;  2ZJR S;  1GTR A;  1QRT A;  1B75 A;  2ZJP S;  4UY8 8;  4JXX A;  1O0C A;  2PIC A;  4IO9 S;  5GAE W;  5GAG W;  2HZ7 A;  1NYL A;  2AE0 X;  5DM6 S;  4JXZ A;  1ZJW A;  4WFB S;  1Z85 A; 
#chains in the Genus database with same CATH homology
 1V6Z A;  2NWA A;  4L69 A;  1NXZ A;  4E8B A;  3KW2 A;  2Z0Y A;  4J3C A;  1VHY A;  2EGV A;  1VHK A;  2CX8 A;  2EGW A;  1Z85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...