2NWAA

X-ray crystal structure of protein ytmb from bacillus subtilis. northeast structural genomics consortium target sr466
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
80
Chain Sequence
MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFEKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Hypothetical protein YtmB from Bacillus subtilis subsp. (subtilis str. 168), Northeast Structural Genomics target SR466
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ytmB
total genus 10
structure length 80
sequence length 81
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10763 DUF2584 Protein of unknown function (DUF2584)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 2nwaA01
2Z0YA 1NXZA 2NWAA 2EGVA 2EGWA 4L69A 1VHYA 3KW2A 4J3CA 4E8BA 1V6ZA 1Z85A 1VHKA 2CX8A
chains in the Genus database with same CATH superfamily
2Z0YA 1NYLA 1NXZA 2PICA 5GAHW 2EGVA 2PI8A 1UDXA 2EGWA 3AIIA 3CF5S 1QTQA 4WFBS 1DFUP 2PNWA 1V6ZA 3W2WB 2PJJA 1O0BA 2AE0X 1QRSA 3PIOS 1QRTA 5JVGS 4UY88 5BNZA 4L69A 1VHYA 4IOAS 5IZNA 3CZBA 2ZJQS 4E8BA 4IOCS 2RE8A 1Z85A 1GTSA 4U67S 4IO9S 5GADW 4WFNS 4JXZA 5DM7S 1B75A 4H3SA 2RD2A 1O0CA 1FEUA 3PIPS 4JXXA 4V194 2ZJRS 2G5DA 1EXDA 4WFAS 1EUQA 5HL7S 3DLLS 5GAEW 2CX8A 2HZ7A 4H4KA 1GTRA 1QRUA 3X1LB 5DM6S 2GAEA 2NWAA 2ZJPS 1ZJWA 1D6KA 2G6GA 4WF9S 3J7ZV 4WCES 4P2BA 3KW2A 4J3CA 1EUYA 5GAGW 3W2VB 1VHKA 5JVHS 4JYZA
chains in the Genus database with same CATH topology
2Z0YA 1NXZA 2NWAA 2EGVA 2EGWA 4L69A 1VHYA 3KW2A 4J3CA 4E8BA 1V6ZA 1Z85A 1VHKA 2CX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0Y A;  1NXZ A;  2NWA A;  2EGV A;  2EGW A;  4L69 A;  1VHY A;  3KW2 A;  4J3C A;  4E8B A;  1V6Z A;  1Z85 A;  1VHK A;  2CX8 A; 
#chains in the Genus database with same CATH topology
 2Z0Y A;  1NYL A;  1NXZ A;  2PIC A;  5GAH W;  2EGV A;  2PI8 A;  1UDX A;  2EGW A;  3AII A;  3CF5 S;  1QTQ A;  4WFB S;  1DFU P;  2PNW A;  1V6Z A;  3W2W B;  2PJJ A;  1O0B A;  2AE0 X;  1QRS A;  3PIO S;  1QRT A;  5JVG S;  4UY8 8;  5BNZ A;  4L69 A;  1VHY A;  4IOA S;  5IZN A;  3CZB A;  2ZJQ S;  4E8B A;  4IOC S;  2RE8 A;  1Z85 A;  1GTS A;  4U67 S;  4IO9 S;  5GAD W;  4WFN S;  4JXZ A;  5DM7 S;  1B75 A;  4H3S A;  2RD2 A;  1O0C A;  1FEU A;  3PIP S;  4JXX A;  4V19 4;  2ZJR S;  2G5D A;  1EXD A;  4WFA S;  1EUQ A;  5HL7 S;  3DLL S;  5GAE W;  2CX8 A;  2HZ7 A;  4H4K A;  1GTR A;  1QRU A;  3X1L B;  5DM6 S;  2GAE A;  2NWA A;  2ZJP S;  1ZJW A;  1D6K A;  2G6G A;  4WF9 S;  3J7Z V;  4WCE S;  4P2B A;  3KW2 A;  4J3C A;  1EUY A;  5GAG W;  3W2V B;  1VHK A;  5JVH S;  4JYZ A; 
#chains in the Genus database with same CATH homology
 2Z0Y A;  1NXZ A;  2NWA A;  2EGV A;  2EGW A;  4L69 A;  1VHY A;  3KW2 A;  4J3C A;  4E8B A;  1V6Z A;  1Z85 A;  1VHK A;  2CX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...