2NWAA

X-ray crystal structure of protein ytmb from bacillus subtilis. northeast structural genomics consortium target sr466
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
80
Chain Sequence
MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFEKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ytmB
publication title Crystal Structure of the Hypothetical protein YtmB from Bacillus subtilis subsp. (subtilis str. 168), Northeast Structural Genomics target SR466
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 10
structure length 80
sequence length 81
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10763 DUF2584 Protein of unknown function (DUF2584)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 2nwaA01
1VHYA 4L69A 1V6ZA 3KW2A 4E8BA 2Z0YA 2EGWA 1VHKA 2CX8A 2NWAA 2EGVA 4J3CA 1NXZA 1Z85A
chains in the Genus database with same CATH superfamily
1FEUA 4E8BA 5GAEW 2EGVA 5HL7S 3PIPS 4UY88 2PNWA 2CX8A 3W2VB 3X1LB 2RD2A 2AE0X 4U67S 1V6ZA 2ZJQS 5JVGS 1NYLA 1QTQA 4JXZA 4WFBS 1EUYA 1GTSA 2EGWA 2PICA 1B75A 1O0CA 3PIOS 1D6KA 3W2WB 1EXDA 2G5DA 4JXXA 1GTRA 4WFAS 2ZJRS 3AIIA 1NXZA 2NWAA 4WF9S 2G6GA 5GADW 4WCES 1ZJWA 4JYZA 5BNZA 1DFUP 2HZ7A 5GAHW 1VHYA 4H3SA 3CF5S 1QRTA 2PJJA 1QRUA 5DM7S 1UDXA 2ZJPS 4V194 1VHKA 2PI8A 4IO9S 1O0BA 4IOAS 1QRSA 5GAGW 3CZBA 3KW2A 5JVHS 4L69A 5IZNA 4J3CA 1EUQA 4H4KA 1Z85A 3J7ZV 2GAEA 2RE8A 2Z0YA 3DLLS 5DM6S 4IOCS 4WFNS 4P2BA
chains in the Genus database with same CATH topology
1VHYA 4L69A 1V6ZA 3KW2A 4E8BA 2Z0YA 2EGWA 1VHKA 2CX8A 2NWAA 2EGVA 4J3CA 1NXZA 1Z85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHY A;  4L69 A;  1V6Z A;  3KW2 A;  4E8B A;  2Z0Y A;  2EGW A;  1VHK A;  2CX8 A;  2NWA A;  2EGV A;  4J3C A;  1NXZ A;  1Z85 A; 
#chains in the Genus database with same CATH topology
 1FEU A;  4E8B A;  5GAE W;  2EGV A;  5HL7 S;  3PIP S;  4UY8 8;  2PNW A;  2CX8 A;  3W2V B;  3X1L B;  2RD2 A;  2AE0 X;  4U67 S;  1V6Z A;  2ZJQ S;  5JVG S;  1NYL A;  1QTQ A;  4JXZ A;  4WFB S;  1EUY A;  1GTS A;  2EGW A;  2PIC A;  1B75 A;  1O0C A;  3PIO S;  1D6K A;  3W2W B;  1EXD A;  2G5D A;  4JXX A;  1GTR A;  4WFA S;  2ZJR S;  3AII A;  1NXZ A;  2NWA A;  4WF9 S;  2G6G A;  5GAD W;  4WCE S;  1ZJW A;  4JYZ A;  5BNZ A;  1DFU P;  2HZ7 A;  5GAH W;  1VHY A;  4H3S A;  3CF5 S;  1QRT A;  2PJJ A;  1QRU A;  5DM7 S;  1UDX A;  2ZJP S;  4V19 4;  1VHK A;  2PI8 A;  4IO9 S;  1O0B A;  4IOA S;  1QRS A;  5GAG W;  3CZB A;  3KW2 A;  5JVH S;  4L69 A;  5IZN A;  4J3C A;  1EUQ A;  4H4K A;  1Z85 A;  3J7Z V;  2GAE A;  2RE8 A;  2Z0Y A;  3DLL S;  5DM6 S;  4IOC S;  4WFN S;  4P2B A; 
#chains in the Genus database with same CATH homology
 1VHY A;  4L69 A;  1V6Z A;  3KW2 A;  4E8B A;  2Z0Y A;  2EGW A;  1VHK A;  2CX8 A;  2NWA A;  2EGV A;  4J3C A;  1NXZ A;  1Z85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...