2NWAA

X-ray crystal structure of protein ytmb from bacillus subtilis. northeast structural genomics consortium target sr466
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
80
Chain Sequence
MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFEKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Hypothetical protein YtmB from Bacillus subtilis subsp. (subtilis str. 168), Northeast Structural Genomics target SR466
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ytmB
total genus 10
structure length 80
sequence length 81
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10763 DUF2584 Protein of unknown function (DUF2584)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 2nwaA01
4E8BA 2EGWA 1VHKA 1VHYA 3KW2A 1Z85A 1V6ZA 2EGVA 2NWAA 2CX8A 4J3CA 1NXZA 2Z0YA 4L69A
chains in the Genus database with same CATH superfamily
1QRTA 1GTSA 4V194 2EGWA 1QRUA 3X1LB 2RD2A 2AE0X 4U67S 1O0CA 1Z85A 4JYZA 4JXZA 5JVHS 5BNZA 3PIOS 4H3SA 5GAHW 2ZJPS 1B75A 4IO9S 5DM6S 2Z0YA 5GAGW 1ZJWA 5GADW 5IZNA 4JXXA 1FEUA 4WFNS 2NWAA 2GAEA 1O0BA 2CX8A 4IOCS 1NYLA 1D6KA 1DFUP 2PNWA 3W2WB 5JVGS 2PICA 3AIIA 1NXZA 3KW2A 5HL7S 2ZJQS 1UDXA 1EXDA 1EUYA 2G5DA 2G6GA 2HZ7A 1V6ZA 2EGVA 4WCES 4WFAS 3CF5S 3PIPS 4H4KA 4WFBS 4E8BA 1GTRA 1QRSA 1QTQA 3W2VB 1EUQA 4WF9S 1VHKA 1VHYA 4P2BA 5GAEW 3DLLS 2PJJA 2ZJRS 2RE8A 4UY88 2PI8A 4J3CA 3CZBA 4IOAS 5DM7S 3J7ZV 4L69A
chains in the Genus database with same CATH topology
4E8BA 2EGWA 1VHKA 1VHYA 3KW2A 1Z85A 1V6ZA 2EGVA 2NWAA 2CX8A 4J3CA 1NXZA 2Z0YA 4L69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E8B A;  2EGW A;  1VHK A;  1VHY A;  3KW2 A;  1Z85 A;  1V6Z A;  2EGV A;  2NWA A;  2CX8 A;  4J3C A;  1NXZ A;  2Z0Y A;  4L69 A; 
#chains in the Genus database with same CATH topology
 1QRT A;  1GTS A;  4V19 4;  2EGW A;  1QRU A;  3X1L B;  2RD2 A;  2AE0 X;  4U67 S;  1O0C A;  1Z85 A;  4JYZ A;  4JXZ A;  5JVH S;  5BNZ A;  3PIO S;  4H3S A;  5GAH W;  2ZJP S;  1B75 A;  4IO9 S;  5DM6 S;  2Z0Y A;  5GAG W;  1ZJW A;  5GAD W;  5IZN A;  4JXX A;  1FEU A;  4WFN S;  2NWA A;  2GAE A;  1O0B A;  2CX8 A;  4IOC S;  1NYL A;  1D6K A;  1DFU P;  2PNW A;  3W2W B;  5JVG S;  2PIC A;  3AII A;  1NXZ A;  3KW2 A;  5HL7 S;  2ZJQ S;  1UDX A;  1EXD A;  1EUY A;  2G5D A;  2G6G A;  2HZ7 A;  1V6Z A;  2EGV A;  4WCE S;  4WFA S;  3CF5 S;  3PIP S;  4H4K A;  4WFB S;  4E8B A;  1GTR A;  1QRS A;  1QTQ A;  3W2V B;  1EUQ A;  4WF9 S;  1VHK A;  1VHY A;  4P2B A;  5GAE W;  3DLL S;  2PJJ A;  2ZJR S;  2RE8 A;  4UY8 8;  2PI8 A;  4J3C A;  3CZB A;  4IOA S;  5DM7 S;  3J7Z V;  4L69 A; 
#chains in the Genus database with same CATH homology
 4E8B A;  2EGW A;  1VHK A;  1VHY A;  3KW2 A;  1Z85 A;  1V6Z A;  2EGV A;  2NWA A;  2CX8 A;  4J3C A;  1NXZ A;  2Z0Y A;  4L69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...