4U67S

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4u67S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4u67S02
1D6KA 1B75A 4P2BA 4UY88 1QRUA 1QRTA 5DM7S 4IO9S 1QTQA 4WFNS 2RE8A 2ZJPS 3CF5S 1EXDA 5GAEW 4H3SA 4WF9S 1GTSA 1GTRA 4JXZA 4IOCS 2ZJRS 1ZJWA 3AIIA 1EUQA 5GAGW 5JVHS 4WCES 4WFBS 1O0BA 1FEUA 5BNZA 3J7ZV 5GADW 4JXXA 1O0CA 2RD2A 4WFAS 1QRSA 5HL7S 1EUYA 5IZNA 3PIOS 4JYZA 1DFUP 2HZ7A 2ZJQS 4IOAS 5GAHW 5DM6S 3PIPS 3DLLS 4U67S 5JVGS 1NYLA
chains in the Genus database with same CATH superfamily
2NWAA 1QRUA 1QRTA 3I4MC 3M4OC 4YFKA 4BXXC 5TMCA 5IP9C 1QTQA 3GTKC 5TMFA 4KMUA 3GTMC 3GTGC 5C3EC 4WFNS 2RE8A 3S1RC 3PO2C 4OINA 4L69A 1EXDA 1I3QC 4BBRC 4H3SA 4OIOA 5C4JC 1VHKA 4J3CA 1GTRA 1TWFC 4YFXA 4IOCS 5GAGW 4OIRA 3PO3C 3RZOC 5IYCC 2JA7C 1FEUA 4LK1A 3HOXC 4XSXA 3GTOC 5BNZA 2RD2A 3GTJC 4A3MC 5HL7S 2PPBA 3PIOS 4H4KA 1WCMC 2A68A 3EQLA 1NXZA 2E2HC 2PA8D 3S2HC 3X1LB 1SFOC 4JXZA 3CZBA 3HKZD 3W2VB 2NVQC 1D6KA 2PICA 2O5IA 4AYBD 1BDFA 4JK1A 2EGWA 4V194 2JA8C 4QIWD 3CQZC 5IP7C 3CF5S 2WAQD 4YFNA 2YU9C 4MEXA 4OIQA 3HOVC 4LJZA 2KXYA 2JA5C 1ZYRA 3LYWA 3GTPC 3S16C 3S1NC 4MEYA 4A3LC 1Y1WC 2NVYC 1ZJWA 1TWCC 3HOYC 2A6HA 2Y0SD 4A3DC 1O0BA 3M3YC 3S1MC 4A3GC 4JXXA 1O0CA 2KQ1A 4OIPA 2EGVA 4WFAS 1QRSA 1EUYA 4C3HC 2PI8A 2HZ7A 2Z0YA 5IYDC 2PJJA 4C3IC 2ZJQS 1UDXA 4IOAS 4BBSC 2PMZD 5DM6S 3DLLS 1YNJA 4U67S 2B63C 5JVGS 3S14C 4G7HA 4A3JC 4G7OA 3S15C 3H0GC 4P2BA 2PNWA 4UY88 1Y1VC 3H3VD 1Z85A 1HQMA 4E8BA 4MQ9A 5HQHA 3K7AC 3S17C 2CX8A 2CW0A 3HOWC 5GAEW 1SMYA 4Q5SA 1I6HC 4A3IC 4Y7NC 2NVTC 4WF9S 1GTSA 2E2JC 4A3BC 1YNNA 4KN4A 2ZJRS 4XLNA 3AIIA 4XLPA 2O5JA 5C4XC 4GZYA 1TWHC 4WCES 2BE5A 4WFBS 3RZDC 2VUMC 4Q4ZA 4A3CC 2AE0X 3I4NC 4C3JC 4A93C 3W2WB 2R93C 1DFUP 1TWAC 2A69A 2KPUA 4XSZA 5GAHW 3PIPS 5IYBC 1K83C 4BY1C 3S2DC 5FLMC 1B75A 3HOZC 1TWGC 2L5NA 5DM7S 4KN7A 4IO9S 4ZH4A 1V6ZA 2JA6C 4Y52C 1IW7A 2GAEA 4A3KC 4LLGA 4QJVA 2ZJPS 4YG2A 4A3EC 4NOIA 4A3FC 2L3UA 3GTQC 2G5DA 2R92C 1VHYA 5C44C 1R9TC 2A6EA 4G7ZA 1EUQA 5JVHS 1I6VA 2R7ZC 3HOUC 3S1QC 3J7ZV 5GADW 4LK0A 2G6GA 4BY7C 3DXJA 2NVXC 4X6AC 5D4DA 5IZNA 4JYZA 3WODA 1I50C 3GTLC 3KW2A 2WB1D 3FKIC 2E2IC 1NYLA 4C2MC
chains in the Genus database with same CATH topology
1D6KA 1B75A 4P2BA 4UY88 1QRUA 1QRTA 5DM7S 4IO9S 1QTQA 4V194 4WFNS 2RE8A 2ZJPS 3CF5S 1EXDA 5GAEW 4H3SA 4WF9S 1GTSA 1GTRA 4JXZA 4IOCS 2ZJRS 1ZJWA 3AIIA 1EUQA 5GAGW 5JVHS 4WCES 4WFBS 1O0BA 1FEUA 5BNZA 3J7ZV 5GADW 4JXXA 1O0CA 2RD2A 4WFAS 1QRSA 5HL7S 1EUYA 5IZNA 3PIOS 4H4KA 3W2WB 4JYZA 2HZ7A 1DFUP 3X1LB 2ZJQS 1UDXA 4IOAS 5GAHW 5DM6S 3PIPS 3DLLS 4U67S 3W2VB 5JVGS 1NYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6K A;  1B75 A;  4P2B A;  4UY8 8;  1QRU A;  1QRT A;  5DM7 S;  4IO9 S;  1QTQ A;  4WFN S;  2RE8 A;  2ZJP S;  3CF5 S;  1EXD A;  5GAE W;  4H3S A;  4WF9 S;  1GTS A;  1GTR A;  4JXZ A;  4IOC S;  2ZJR S;  1ZJW A;  3AII A;  1EUQ A;  5GAG W;  5JVH S;  4WCE S;  4WFB S;  1O0B A;  1FEU A;  5BNZ A;  3J7Z V;  5GAD W;  4JXX A;  1O0C A;  2RD2 A;  4WFA S;  1QRS A;  5HL7 S;  1EUY A;  5IZN A;  3PIO S;  4JYZ A;  1DFU P;  2HZ7 A;  2ZJQ S;  4IOA S;  5GAH W;  5DM6 S;  3PIP S;  3DLL S;  4U67 S;  5JVG S;  1NYL A; 
#chains in the Genus database with same CATH topology
 2NWA A;  1QRU A;  1QRT A;  3I4M C;  3M4O C;  4YFK A;  4BXX C;  5TMC A;  5IP9 C;  1QTQ A;  3GTK C;  5TMF A;  4KMU A;  3GTM C;  3GTG C;  5C3E C;  4WFN S;  2RE8 A;  3S1R C;  3PO2 C;  4OIN A;  4L69 A;  1EXD A;  1I3Q C;  4BBR C;  4H3S A;  4OIO A;  5C4J C;  1VHK A;  4J3C A;  1GTR A;  1TWF C;  4YFX A;  4IOC S;  5GAG W;  4OIR A;  3PO3 C;  3RZO C;  5IYC C;  2JA7 C;  1FEU A;  4LK1 A;  3HOX C;  4XSX A;  3GTO C;  5BNZ A;  2RD2 A;  3GTJ C;  4A3M C;  5HL7 S;  2PPB A;  3PIO S;  4H4K A;  1WCM C;  2A68 A;  3EQL A;  1NXZ A;  2E2H C;  2PA8 D;  3S2H C;  3X1L B;  1SFO C;  4JXZ A;  3CZB A;  3HKZ D;  3W2V B;  2NVQ C;  1D6K A;  2PIC A;  2O5I A;  4AYB D;  1BDF A;  4JK1 A;  2EGW A;  4V19 4;  2JA8 C;  4QIW D;  3CQZ C;  5IP7 C;  3CF5 S;  2WAQ D;  4YFN A;  2YU9 C;  4MEX A;  4OIQ A;  3HOV C;  4LJZ A;  2KXY A;  2JA5 C;  1ZYR A;  3LYW A;  3GTP C;  3S16 C;  3S1N C;  4MEY A;  4A3L C;  1Y1W C;  2NVY C;  1ZJW A;  1TWC C;  3HOY C;  2A6H A;  2Y0S D;  4A3D C;  1O0B A;  3M3Y C;  3S1M C;  4A3G C;  4JXX A;  1O0C A;  2KQ1 A;  4OIP A;  2EGV A;  4WFA S;  1QRS A;  1EUY A;  4C3H C;  2PI8 A;  2HZ7 A;  2Z0Y A;  5IYD C;  2PJJ A;  4C3I C;  2ZJQ S;  1UDX A;  4IOA S;  4BBS C;  2PMZ D;  5DM6 S;  3DLL S;  1YNJ A;  4U67 S;  2B63 C;  5JVG S;  3S14 C;  4G7H A;  4A3J C;  4G7O A;  3S15 C;  3H0G C;  4P2B A;  2PNW A;  4UY8 8;  1Y1V C;  3H3V D;  1Z85 A;  1HQM A;  4E8B A;  4MQ9 A;  5HQH A;  3K7A C;  3S17 C;  2CX8 A;  2CW0 A;  3HOW C;  5GAE W;  1SMY A;  4Q5S A;  1I6H C;  4A3I C;  4Y7N C;  2NVT C;  4WF9 S;  1GTS A;  2E2J C;  4A3B C;  1YNN A;  4KN4 A;  2ZJR S;  4XLN A;  3AII A;  4XLP A;  2O5J A;  5C4X C;  4GZY A;  1TWH C;  4WCE S;  2BE5 A;  4WFB S;  3RZD C;  2VUM C;  4Q4Z A;  4A3C C;  2AE0 X;  3I4N C;  4C3J C;  4A93 C;  3W2W B;  2R93 C;  1DFU P;  1TWA C;  2A69 A;  2KPU A;  4XSZ A;  5GAH W;  3PIP S;  5IYB C;  1K83 C;  4BY1 C;  3S2D C;  5FLM C;  1B75 A;  3HOZ C;  1TWG C;  2L5N A;  5DM7 S;  4KN7 A;  4IO9 S;  4ZH4 A;  1V6Z A;  2JA6 C;  4Y52 C;  1IW7 A;  2GAE A;  4A3K C;  4LLG A;  4QJV A;  2ZJP S;  4YG2 A;  4A3E C;  4NOI A;  4A3F C;  2L3U A;  3GTQ C;  2G5D A;  2R92 C;  1VHY A;  5C44 C;  1R9T C;  2A6E A;  4G7Z A;  1EUQ A;  5JVH S;  1I6V A;  2R7Z C;  3HOU C;  3S1Q C;  3J7Z V;  5GAD W;  4LK0 A;  2G6G A;  4BY7 C;  3DXJ A;  2NVX C;  4X6A C;  5D4D A;  5IZN A;  4JYZ A;  3WOD A;  1I50 C;  3GTL C;  3KW2 A;  2WB1 D;  3FKI C;  2E2I C;  1NYL A;  4C2M C; 
#chains in the Genus database with same CATH homology
 1D6K A;  1B75 A;  4P2B A;  4UY8 8;  1QRU A;  1QRT A;  5DM7 S;  4IO9 S;  1QTQ A;  4V19 4;  4WFN S;  2RE8 A;  2ZJP S;  3CF5 S;  1EXD A;  5GAE W;  4H3S A;  4WF9 S;  1GTS A;  1GTR A;  4JXZ A;  4IOC S;  2ZJR S;  1ZJW A;  3AII A;  1EUQ A;  5GAG W;  5JVH S;  4WCE S;  4WFB S;  1O0B A;  1FEU A;  5BNZ A;  3J7Z V;  5GAD W;  4JXX A;  1O0C A;  2RD2 A;  4WFA S;  1QRS A;  5HL7 S;  1EUY A;  5IZN A;  3PIO S;  4H4K A;  3W2W B;  4JYZ A;  2HZ7 A;  1DFU P;  3X1L B;  2ZJQ S;  1UDX A;  4IOA S;  5GAH W;  5DM6 S;  3PIP S;  3DLL S;  4U67 S;  3W2V B;  5JVG S;  1NYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...