4U67S

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4u67S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4u67S02
3DLLS 4IOCS 1GTRA 4WFNS 1O0CA 4IO9S 1EUQA 1QRUA 3PIPS 5GADW 4U67S 5JVGS 5GAEW 2HZ7A 2ZJQS 2RD2A 4JXXA 1O0BA 1EUYA 1QRTA 4UY88 4WF9S 5JVHS 2ZJPS 2ZJRS 1GTSA 3PIOS 1ZJWA 5IZNA 1QRSA 4WFBS 5GAHW 1FEUA 1DFUP 3AIIA 5DM6S 4JYZA 3CF5S 1EXDA 5GAGW 1QTQA 1NYLA 2RE8A 5HL7S 4IOAS 4JXZA 4WCES 4P2BA 5BNZA 4H3SA 1D6KA 5DM7S 4WFAS 1B75A 3J7ZV
chains in the Genus database with same CATH superfamily
4JK1A 3GTPC 3S2DC 3HOVC 4A3GC 3GTLC 4IOCS 2CW0A 3S16C 1GTRA 3GTKC 4LK0A 1YNJA 2VUMC 3RZOC 2KQ1A 3RZDC 3X1LB 4UY88 2HZ7A 2PICA 1QRTA 2WB1D 4XSZA 4YG2A 4LK1A 3FKIC 4WF9S 1BDFA 4OIOA 3HOXC 2ZJRS 3PIOS 2Y0SD 2G6GA 2NVQC 4YFNA 1UDXA 3AIIA 1DFUP 4G7HA 2NVTC 3CF5S 1EXDA 4BBSC 4A3KC 3I4NC 4C3IC 2Z0YA 2A6EA 3S15C 4WCES 2L5NA 4C3JC 4G7OA 3HOZC 4A3FC 1Y1WC 1D6KA 4GZYA 3CQZC 2O5JA 1HQMA 5HQHA 4BY1C 3K7AC 3HOYC 3S14C 3PO2C 4A3BC 4A3EC 3M3YC 4Q5SA 2A6HA 1I3QC 5TMFA 3LYWA 3GTGC 5C4XC 4IO9S 3KW2A 1EUQA 1QRUA 3PO3C 5C4JC 4X6AC 3W2WB 2JA8C 4H4KA 1SMYA 3S1QC 5GADW 4U67S 4MEXA 2R7ZC 2KPUA 4A3LC 5JVGS 5GAEW 2ZJQS 4JXXA 1O0BA 1EUYA 1TWCC 4J3CA 2YU9C 3S17C 1ZYRA 2A69A 2PMZD 3GTJC 2PPBA 2PNWA 1ZJWA 1K83C 3GTMC 4MEYA 1QTQA 1NYLA 2RE8A 5HL7S 3DXJA 5D4DA 1TWHC 3S1MC 5BNZA 1YNNA 4H3SA 4C2MC 4QJVA 5IYCC 4A3CC 4XLPA 2EGWA 1I50C 4MQ9A 4L69A 3W2VB 1R9TC 4BXXC 4BBRC 3S1NC 2BE5A 4OINA 1O0CA 2EGVA 3HOWC 1TWFC 3WODA 2E2HC 3I4MC 4YFKA 4BY7C 2L3UA 1SFOC 2O5IA 4KN4A 4YFXA 2B63C 2G5DA 1TWGC 4E8BA 2PI8A 2A68A 5IYBC 2ZJPS 3EQLA 4ZH4A 4XLNA 1GTSA 3M4OC 4LJZA 4XSXA 5C44C 5IZNA 1QRSA 1FEUA 2NVXC 4Y52C 3S1RC 4KMUA 2JA5C 5DM6S 3CZBA 4JYZA 3H3VD 5GAGW 4Q4ZA 2JA6C 4IOAS 2PJJA 1I6VA 2CX8A 4A93C 2NWAA 4OIRA 1IW7A 1VHYA 5C3EC 4G7ZA 4A3IC 2E2JC 4OIQA 5IP9C 5DM7S 4QIWD 4WFAS 1B75A 1Y1VC 4OIPA 4A3DC 1Z85A 3DLLS 4WFNS 2KXYA 2R92C 4KN7A 1WCMC 4Y7NC 3S2HC 3PIPS 2GAEA 4NOIA 4C3HC 4V194 2RD2A 3GTOC 4LLGA 5JVHS 3H0GC 5IYDC 4WFBS 5GAHW 1I6HC 5TMCA 4A3MC 2WAQD 3GTQC 5IP7C 2E2IC 5FLMC 3HOUC 3HKZD 1VHKA 4JXZA 2PA8D 1TWAC 1NXZA 1V6ZA 4P2BA 2NVYC 4AYBD 2JA7C 2R93C 4A3JC 2AE0X 3J7ZV
chains in the Genus database with same CATH topology
3W2VB 3DLLS 4IOCS 1GTRA 4WFNS 1O0CA 4IO9S 1EUQA 1QRUA 3W2WB 4H4KA 3PIPS 5GADW 4U67S 5JVGS 5GAEW 2HZ7A 2ZJQS 2RD2A 4JXXA 1O0BA 1EUYA 1QRTA 4UY88 4V194 3X1LB 4WF9S 5JVHS 2ZJPS 2ZJRS 1GTSA 3PIOS 1ZJWA 5IZNA 1QRSA 4WFBS 5GAHW 1FEUA 1UDXA 3AIIA 1DFUP 5DM6S 4JYZA 3CF5S 1EXDA 5GAGW 1QTQA 1NYLA 2RE8A 5HL7S 4IOAS 4JXZA 4WCES 4P2BA 5BNZA 4H3SA 1D6KA 5DM7S 4WFAS 1B75A 3J7ZV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL S;  4IOC S;  1GTR A;  4WFN S;  1O0C A;  4IO9 S;  1EUQ A;  1QRU A;  3PIP S;  5GAD W;  4U67 S;  5JVG S;  5GAE W;  2HZ7 A;  2ZJQ S;  2RD2 A;  4JXX A;  1O0B A;  1EUY A;  1QRT A;  4UY8 8;  4WF9 S;  5JVH S;  2ZJP S;  2ZJR S;  1GTS A;  3PIO S;  1ZJW A;  5IZN A;  1QRS A;  4WFB S;  5GAH W;  1FEU A;  1DFU P;  3AII A;  5DM6 S;  4JYZ A;  3CF5 S;  1EXD A;  5GAG W;  1QTQ A;  1NYL A;  2RE8 A;  5HL7 S;  4IOA S;  4JXZ A;  4WCE S;  4P2B A;  5BNZ A;  4H3S A;  1D6K A;  5DM7 S;  4WFA S;  1B75 A;  3J7Z V; 
#chains in the Genus database with same CATH topology
 4JK1 A;  3GTP C;  3S2D C;  3HOV C;  4A3G C;  3GTL C;  4IOC S;  2CW0 A;  3S16 C;  1GTR A;  3GTK C;  4LK0 A;  1YNJ A;  2VUM C;  3RZO C;  2KQ1 A;  3RZD C;  3X1L B;  4UY8 8;  2HZ7 A;  2PIC A;  1QRT A;  2WB1 D;  4XSZ A;  4YG2 A;  4LK1 A;  3FKI C;  4WF9 S;  1BDF A;  4OIO A;  3HOX C;  2ZJR S;  3PIO S;  2Y0S D;  2G6G A;  2NVQ C;  4YFN A;  1UDX A;  3AII A;  1DFU P;  4G7H A;  2NVT C;  3CF5 S;  1EXD A;  4BBS C;  4A3K C;  3I4N C;  4C3I C;  2Z0Y A;  2A6E A;  3S15 C;  4WCE S;  2L5N A;  4C3J C;  4G7O A;  3HOZ C;  4A3F C;  1Y1W C;  1D6K A;  4GZY A;  3CQZ C;  2O5J A;  1HQM A;  5HQH A;  4BY1 C;  3K7A C;  3HOY C;  3S14 C;  3PO2 C;  4A3B C;  4A3E C;  3M3Y C;  4Q5S A;  2A6H A;  1I3Q C;  5TMF A;  3LYW A;  3GTG C;  5C4X C;  4IO9 S;  3KW2 A;  1EUQ A;  1QRU A;  3PO3 C;  5C4J C;  4X6A C;  3W2W B;  2JA8 C;  4H4K A;  1SMY A;  3S1Q C;  5GAD W;  4U67 S;  4MEX A;  2R7Z C;  2KPU A;  4A3L C;  5JVG S;  5GAE W;  2ZJQ S;  4JXX A;  1O0B A;  1EUY A;  1TWC C;  4J3C A;  2YU9 C;  3S17 C;  1ZYR A;  2A69 A;  2PMZ D;  3GTJ C;  2PPB A;  2PNW A;  1ZJW A;  1K83 C;  3GTM C;  4MEY A;  1QTQ A;  1NYL A;  2RE8 A;  5HL7 S;  3DXJ A;  5D4D A;  1TWH C;  3S1M C;  5BNZ A;  1YNN A;  4H3S A;  4C2M C;  4QJV A;  5IYC C;  4A3C C;  4XLP A;  2EGW A;  1I50 C;  4MQ9 A;  4L69 A;  3W2V B;  1R9T C;  4BXX C;  4BBR C;  3S1N C;  2BE5 A;  4OIN A;  1O0C A;  2EGV A;  3HOW C;  1TWF C;  3WOD A;  2E2H C;  3I4M C;  4YFK A;  4BY7 C;  2L3U A;  1SFO C;  2O5I A;  4KN4 A;  4YFX A;  2B63 C;  2G5D A;  1TWG C;  4E8B A;  2PI8 A;  2A68 A;  5IYB C;  2ZJP S;  3EQL A;  4ZH4 A;  4XLN A;  1GTS A;  3M4O C;  4LJZ A;  4XSX A;  5C44 C;  5IZN A;  1QRS A;  1FEU A;  2NVX C;  4Y52 C;  3S1R C;  4KMU A;  2JA5 C;  5DM6 S;  3CZB A;  4JYZ A;  3H3V D;  5GAG W;  4Q4Z A;  2JA6 C;  4IOA S;  2PJJ A;  1I6V A;  2CX8 A;  4A93 C;  2NWA A;  4OIR A;  1IW7 A;  1VHY A;  5C3E C;  4G7Z A;  4A3I C;  2E2J C;  4OIQ A;  5IP9 C;  5DM7 S;  4QIW D;  4WFA S;  1B75 A;  1Y1V C;  4OIP A;  4A3D C;  1Z85 A;  3DLL S;  4WFN S;  2KXY A;  2R92 C;  4KN7 A;  1WCM C;  4Y7N C;  3S2H C;  3PIP S;  2GAE A;  4NOI A;  4C3H C;  4V19 4;  2RD2 A;  3GTO C;  4LLG A;  5JVH S;  3H0G C;  5IYD C;  4WFB S;  5GAH W;  1I6H C;  5TMC A;  4A3M C;  2WAQ D;  3GTQ C;  5IP7 C;  2E2I C;  5FLM C;  3HOU C;  3HKZ D;  1VHK A;  4JXZ A;  2PA8 D;  1TWA C;  1NXZ A;  1V6Z A;  4P2B A;  2NVY C;  4AYB D;  2JA7 C;  2R93 C;  4A3J C;  2AE0 X;  3J7Z V; 
#chains in the Genus database with same CATH homology
 3W2V B;  3DLL S;  4IOC S;  1GTR A;  4WFN S;  1O0C A;  4IO9 S;  1EUQ A;  1QRU A;  3W2W B;  4H4K A;  3PIP S;  5GAD W;  4U67 S;  5JVG S;  5GAE W;  2HZ7 A;  2ZJQ S;  2RD2 A;  4JXX A;  1O0B A;  1EUY A;  1QRT A;  4UY8 8;  4V19 4;  3X1L B;  4WF9 S;  5JVH S;  2ZJP S;  2ZJR S;  1GTS A;  3PIO S;  1ZJW A;  5IZN A;  1QRS A;  4WFB S;  5GAH W;  1FEU A;  1UDX A;  3AII A;  1DFU P;  5DM6 S;  4JYZ A;  3CF5 S;  1EXD A;  5GAG W;  1QTQ A;  1NYL A;  2RE8 A;  5HL7 S;  4IOA S;  4JXZ A;  4WCE S;  4P2B A;  5BNZ A;  4H3S A;  1D6K A;  5DM7 S;  4WFA S;  1B75 A;  3J7Z V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...