4U67S

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4u67S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4u67S02
1QTQA 4IOAS 4UY88 3DLLS 4WCES 3J7ZV 3PIPS 2RE8A 4IO9S 4JYZA 1EUQA 5GAGW 2RD2A 4WFAS 1QRTA 4WF9S 5JVHS 1DFUP 4P2BA 2HZ7A 4WFNS 3CF5S 1D6KA 5GAHW 1O0CA 1NYLA 1QRSA 4JXZA 1EXDA 1QRUA 1B75A 5GAEW 4U67S 3AIIA 1O0BA 5BNZA 1EUYA 1GTRA 2ZJRS 3PIOS 1FEUA 2ZJPS 5DM6S 4IOCS 5GADW 1ZJWA 4H3SA 1GTSA 4WFBS 5JVGS 4JXXA 5DM7S 2ZJQS 5HL7S 5IZNA
chains in the Genus database with same CATH superfamily
1QTQA 3J7ZV 4IO9S 1TWHC 3K7AC 2Y0SD 1V6ZA 3S16C 5JVHS 1Y1VC 1DFUP 1YNJA 1YNNA 4G7ZA 2HZ7A 2KQ1A 1I6VA 4YFKA 4V194 2PA8D 4MEXA 2R7ZC 1NYLA 4YG2A 5D4DA 3PO2C 1B75A 2CW0A 3I4NC 4XSXA 4X6AC 2A69A 4G7HA 3HOYC 2O5IA 1O0BA 4L69A 1Y1WC 3S2DC 2NVYC 1WCMC 2BE5A 4BY1C 4QIWD 2PI8A 3WODA 3PIOS 2WB1D 4LK1A 3GTKC 3S1RC 5GADW 5IP7C 1GTSA 2JA7C 4OIPA 2NVTC 5C4JC 3S2HC 2PMZD 2PPBA 2Z0YA 1EUQA 1TWCC 4MEYA 4UY88 4LJZA 3DLLS 2RE8A 5HQHA 1QRTA 2JA5C 3S17C 3CZBA 3HOXC 4WFAS 4AYBD 4A3CC 4BBSC 1I6HC 4A3DC 1NXZA 2YU9C 2NVQC 2PNWA 4BXXC 5GAHW 4E8BA 3HOUC 1TWAC 3HOZC 1EXDA 1QRUA 2KXYA 5C3EC 2A68A 3DXJA 4U67S 2CX8A 4OIQA 4JK1A 2WAQD 2E2IC 4YFXA 2ZJRS 3M3YC 4OINA 3I4MC 4C3HC 3S1MC 2NWAA 4LK0A 2GAEA 4KN4A 5DM6S 4A3KC 2JA6C 3S14C 4A3IC 1K83C 5IYBC 4BBRC 5C44C 2KPUA 2EGWA 5FLMC 4JXXA 1UDXA 5IYDC 2O5JA 5IZNA 3W2WB 3X1LB 4IOAS 4JXZA 1TWFC 4MQ9A 1VHKA 4A3EC 3GTPC 2G5DA 3PO3C 4JYZA 3KW2A 2A6EA 4Y52C 3GTOC 4C3JC 3GTLC 3RZDC 4WF9S 3S1QC 1ZYRA 4A3BC 1D6KA 3EQLA 2JA8C 4A3MC 4OIRA 1QRSA 4ZH4A 1SFOC 2R92C 4C3IC 5BNZA 2G6GA 4A3JC 1TWGC 2E2JC 2E2HC 3GTMC 2L5NA 2AE0X 1FEUA 3HKZD 4Q4ZA 2ZJPS 4KMUA 4IOCS 1ZJWA 4QJVA 4H3SA 3GTGC 5C4XC 1IW7A 3GTQC 5JVGS 2VUMC 3HOWC 3H0GC 3HOVC 1GTRA 5DM7S 4XSZA 4A3LC 5HL7S 3CQZC 3S15C 2PJJA 4WCES 3PIPS 4KN7A 3S1NC 5GAGW 2RD2A 5IYCC 4OIOA 4P2BA 3W2VB 1SMYA 3CF5S 4WFNS 3M4OC 3LYWA 1R9TC 4A93C 2R93C 2EGVA 1O0CA 1VHYA 2NVXC 4A3GC 1I3QC 3RZOC 2PICA 5GAEW 4XLPA 4XLNA 3AIIA 4Q5SA 1BDFA 4Y7NC 1EUYA 4J3CA 4H4KA 1I50C 4YFNA 1HQMA 4A3FC 3H3VD 4GZYA 4LLGA 5TMFA 4C2MC 4G7OA 5TMCA 4BY7C 4WFBS 5IP9C 3GTJC 3FKIC 1Z85A 2A6HA 2L3UA 2ZJQS 2B63C 4NOIA
chains in the Genus database with same CATH topology
1QTQA 3X1LB 4IOAS 4UY88 3DLLS 4WCES 3J7ZV 3PIPS 2RE8A 4IO9S 4JYZA 1EUQA 5GAGW 2RD2A 4WFAS 1QRTA 4WF9S 5JVHS 1DFUP 3W2VB 4P2BA 2HZ7A 4WFNS 3CF5S 1D6KA 5GAHW 4V194 1O0CA 3W2WB 1NYLA 1QRSA 4JXZA 1EXDA 1QRUA 1B75A 5GAEW 4U67S 3AIIA 1O0BA 5BNZA 1EUYA 1GTRA 4H4KA 2ZJRS 3PIOS 1FEUA 2ZJPS 5DM6S 4IOCS 5GADW 1ZJWA 4H3SA 1GTSA 4WFBS 5JVGS 4JXXA 1UDXA 5DM7S 2ZJQS 5HL7S 5IZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QTQ A;  4IOA S;  4UY8 8;  3DLL S;  4WCE S;  3J7Z V;  3PIP S;  2RE8 A;  4IO9 S;  4JYZ A;  1EUQ A;  5GAG W;  2RD2 A;  4WFA S;  1QRT A;  4WF9 S;  5JVH S;  1DFU P;  4P2B A;  2HZ7 A;  4WFN S;  3CF5 S;  1D6K A;  5GAH W;  1O0C A;  1NYL A;  1QRS A;  4JXZ A;  1EXD A;  1QRU A;  1B75 A;  5GAE W;  4U67 S;  3AII A;  1O0B A;  5BNZ A;  1EUY A;  1GTR A;  2ZJR S;  3PIO S;  1FEU A;  2ZJP S;  5DM6 S;  4IOC S;  5GAD W;  1ZJW A;  4H3S A;  1GTS A;  4WFB S;  5JVG S;  4JXX A;  5DM7 S;  2ZJQ S;  5HL7 S;  5IZN A; 
#chains in the Genus database with same CATH topology
 1QTQ A;  3J7Z V;  4IO9 S;  1TWH C;  3K7A C;  2Y0S D;  1V6Z A;  3S16 C;  5JVH S;  1Y1V C;  1DFU P;  1YNJ A;  1YNN A;  4G7Z A;  2HZ7 A;  2KQ1 A;  1I6V A;  4YFK A;  4V19 4;  2PA8 D;  4MEX A;  2R7Z C;  1NYL A;  4YG2 A;  5D4D A;  3PO2 C;  1B75 A;  2CW0 A;  3I4N C;  4XSX A;  4X6A C;  2A69 A;  4G7H A;  3HOY C;  2O5I A;  1O0B A;  4L69 A;  1Y1W C;  3S2D C;  2NVY C;  1WCM C;  2BE5 A;  4BY1 C;  4QIW D;  2PI8 A;  3WOD A;  3PIO S;  2WB1 D;  4LK1 A;  3GTK C;  3S1R C;  5GAD W;  5IP7 C;  1GTS A;  2JA7 C;  4OIP A;  2NVT C;  5C4J C;  3S2H C;  2PMZ D;  2PPB A;  2Z0Y A;  1EUQ A;  1TWC C;  4MEY A;  4UY8 8;  4LJZ A;  3DLL S;  2RE8 A;  5HQH A;  1QRT A;  2JA5 C;  3S17 C;  3CZB A;  3HOX C;  4WFA S;  4AYB D;  4A3C C;  4BBS C;  1I6H C;  4A3D C;  1NXZ A;  2YU9 C;  2NVQ C;  2PNW A;  4BXX C;  5GAH W;  4E8B A;  3HOU C;  1TWA C;  3HOZ C;  1EXD A;  1QRU A;  2KXY A;  5C3E C;  2A68 A;  3DXJ A;  4U67 S;  2CX8 A;  4OIQ A;  4JK1 A;  2WAQ D;  2E2I C;  4YFX A;  2ZJR S;  3M3Y C;  4OIN A;  3I4M C;  4C3H C;  3S1M C;  2NWA A;  4LK0 A;  2GAE A;  4KN4 A;  5DM6 S;  4A3K C;  2JA6 C;  3S14 C;  4A3I C;  1K83 C;  5IYB C;  4BBR C;  5C44 C;  2KPU A;  2EGW A;  5FLM C;  4JXX A;  1UDX A;  5IYD C;  2O5J A;  5IZN A;  3W2W B;  3X1L B;  4IOA S;  4JXZ A;  1TWF C;  4MQ9 A;  1VHK A;  4A3E C;  3GTP C;  2G5D A;  3PO3 C;  4JYZ A;  3KW2 A;  2A6E A;  4Y52 C;  3GTO C;  4C3J C;  3GTL C;  3RZD C;  4WF9 S;  3S1Q C;  1ZYR A;  4A3B C;  1D6K A;  3EQL A;  2JA8 C;  4A3M C;  4OIR A;  1QRS A;  4ZH4 A;  1SFO C;  2R92 C;  4C3I C;  5BNZ A;  2G6G A;  4A3J C;  1TWG C;  2E2J C;  2E2H C;  3GTM C;  2L5N A;  2AE0 X;  1FEU A;  3HKZ D;  4Q4Z A;  2ZJP S;  4KMU A;  4IOC S;  1ZJW A;  4QJV A;  4H3S A;  3GTG C;  5C4X C;  1IW7 A;  3GTQ C;  5JVG S;  2VUM C;  3HOW C;  3H0G C;  3HOV C;  1GTR A;  5DM7 S;  4XSZ A;  4A3L C;  5HL7 S;  3CQZ C;  3S15 C;  2PJJ A;  4WCE S;  3PIP S;  4KN7 A;  3S1N C;  5GAG W;  2RD2 A;  5IYC C;  4OIO A;  4P2B A;  3W2V B;  1SMY A;  3CF5 S;  4WFN S;  3M4O C;  3LYW A;  1R9T C;  4A93 C;  2R93 C;  2EGV A;  1O0C A;  1VHY A;  2NVX C;  4A3G C;  1I3Q C;  3RZO C;  2PIC A;  5GAE W;  4XLP A;  4XLN A;  3AII A;  4Q5S A;  1BDF A;  4Y7N C;  1EUY A;  4J3C A;  4H4K A;  1I50 C;  4YFN A;  1HQM A;  4A3F C;  3H3V D;  4GZY A;  4LLG A;  5TMF A;  4C2M C;  4G7O A;  5TMC A;  4BY7 C;  4WFB S;  5IP9 C;  3GTJ C;  3FKI C;  1Z85 A;  2A6H A;  2L3U A;  2ZJQ S;  2B63 C;  4NOI A; 
#chains in the Genus database with same CATH homology
 1QTQ A;  3X1L B;  4IOA S;  4UY8 8;  3DLL S;  4WCE S;  3J7Z V;  3PIP S;  2RE8 A;  4IO9 S;  4JYZ A;  1EUQ A;  5GAG W;  2RD2 A;  4WFA S;  1QRT A;  4WF9 S;  5JVH S;  1DFU P;  3W2V B;  4P2B A;  2HZ7 A;  4WFN S;  3CF5 S;  1D6K A;  5GAH W;  4V19 4;  1O0C A;  3W2W B;  1NYL A;  1QRS A;  4JXZ A;  1EXD A;  1QRU A;  1B75 A;  5GAE W;  4U67 S;  3AII A;  1O0B A;  5BNZ A;  1EUY A;  1GTR A;  4H4K A;  2ZJR S;  3PIO S;  1FEU A;  2ZJP S;  5DM6 S;  4IOC S;  5GAD W;  1ZJW A;  4H3S A;  1GTS A;  4WFB S;  5JVG S;  4JXX A;  1UDX A;  5DM7 S;  2ZJQ S;  5HL7 S;  5IZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...