4U67S

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4u67S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4u67S02
4WCES 4WFAS 1NYLA 1GTRA 4IOCS 1ZJWA 3CF5S 1EXDA 1QRUA 1QRTA 4WFBS 1FEUA 5DM6S 4U67S 5BNZA 3J7ZV 5JVHS 4P2BA 4WF9S 4IO9S 2RD2A 4UY88 3DLLS 2ZJQS 5JVGS 3AIIA 5DM7S 5GAGW 1B75A 1QTQA 1QRSA 4JXZA 2ZJRS 1D6KA 4JXXA 2HZ7A 5GAEW 5GADW 3PIOS 5HL7S 3PIPS 4JYZA 1O0BA 2RE8A 5GAHW 1EUQA 1O0CA 1EUYA 1GTSA 1DFUP 5IZNA 4WFNS 4H3SA 2ZJPS 4IOAS
chains in the Genus database with same CATH superfamily
3K7AC 3CQZC 2E2HC 3RZOC 1UDXA 1I6VA 1YNNA 2R7ZC 4YFKA 3GTGC 5FLMC 2AE0X 3HOVC 4QIWD 1EXDA 5C4JC 2A69A 2G5DA 2PJJA 4Y7NC 4XLPA 4A3KC 2CW0A 3GTOC 2B63C 1SMYA 4UY88 3AIIA 2O5IA 3S2DC 2KXYA 4XSZA 1QTQA 1QRSA 4JXZA 1BDFA 2ZJRS 2EGVA 2PMZD 4A3IC 3HOYC 1VHKA 4IOAS 5HL7S 2PICA 4KN4A 1VHYA 5TMFA 1HQMA 4G7HA 4BBSC 5GAHW 3S17C 1TWFC 1R9TC 4C2MC 2BE5A 4J3CA 1TWCC 2WAQD 4KMUA 3S1QC 3HOZC 2NVXC 1I6HC 2YU9C 4OIOA 3KW2A 2NVTC 3W2VB 4V194 4OIPA 3LYWA 1ZJWA 3CF5S 4BBRC 2PA8D 2Y0SD 3S15C 4YFXA 4YFNA 3HOXC 1FEUA 5DM6S 4U67S 4A3MC 1YNJA 4A3DC 2Z0YA 1NXZA 5JVHS 2A6EA 2NVYC 4C3JC 4WF9S 4OIRA 4IO9S 2RD2A 3W2WB 4Y52C 3PO3C 4A3GC 4Q4ZA 4Q5SA 2GAEA 1ZYRA 1D6KA 3PIOS 5GAEW 5GADW 3H3VD 3I4NC 2PNWA 2L3UA 3S1NC 4MEYA 2EGWA 2RE8A 3GTMC 1O0CA 1K83C 1TWGC 1I3QC 5IP9C 4MEXA 4ZH4A 3S14C 4BXXC 1Y1VC 2ZJPS 4LLGA 2JA5C 1V6ZA 4WFAS 1SFOC 3WODA 4A3FC 1NYLA 1GTRA 4OIQA 5D4DA 4A3LC 1QRUA 2R93C 1QRTA 4WFBS 3I4MC 5C44C 2E2JC 3S16C 1TWAC 3J7ZV 3RZDC 5C4XC 2G6GA 4P2BA 4KN7A 2A68A 3GTQC 3S1MC 4JK1A 3FKIC 2O5JA 2ZJQS 4C3HC 2JA8C 3CZBA 1TWHC 3M3YC 4LJZA 5GAGW 3GTKC 1IW7A 2HZ7A 2A6HA 4AYBD 1EUQA 2PPBA 2R92C 4NOIA 1GTSA 5HQHA 4G7OA 4YG2A 4H3SA 4E8BA 4QJVA 4L69A 4XSXA 2VUMC 4WCES 3S2HC 3M4OC 2JA7C 4IOCS 3DXJA 4A3EC 1I50C 4C3IC 5C3EC 4G7ZA 1Y1WC 2KQ1A 2WB1D 5TMCA 4H4KA 5BNZA 5IYBC 4A3BC 1Z85A 4LK0A 3GTJC 4BY7C 3GTLC 3H0GC 2NWAA 4OINA 2JA6C 3HKZD 2E2IC 3DLLS 3EQLA 5JVGS 4GZYA 4XLNA 3HOWC 3S1RC 1WCMC 4BY1C 5DM7S 1B75A 4LK1A 5IYDC 4A3JC 2KPUA 2NVQC 4JXXA 3HOUC 3GTPC 3PIPS 4JYZA 4MQ9A 1O0BA 5IYCC 3PO2C 2PI8A 4X6AC 2CX8A 4A3CC 1EUYA 4A93C 1DFUP 2L5NA 5IZNA 4WFNS 5IP7C 3X1LB
chains in the Genus database with same CATH topology
1UDXA 4WCES 4WFAS 1NYLA 3W2VB 4V194 1GTRA 4IOCS 1ZJWA 3CF5S 1EXDA 1QRUA 1QRTA 4WFBS 1FEUA 5DM6S 4U67S 4H4KA 5BNZA 3J7ZV 5JVHS 4P2BA 4WF9S 4IO9S 2RD2A 3W2WB 4UY88 3DLLS 2ZJQS 5JVGS 3AIIA 5DM7S 5GAGW 1B75A 1QTQA 1QRSA 4JXZA 2ZJRS 1D6KA 4JXXA 2HZ7A 5GAEW 5GADW 3PIOS 4IOAS 5HL7S 3PIPS 4JYZA 1O0BA 2RE8A 5GAHW 1EUQA 1O0CA 1EUYA 1GTSA 1DFUP 5IZNA 4WFNS 4H3SA 2ZJPS 3X1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE S;  4WFA S;  1NYL A;  1GTR A;  4IOC S;  1ZJW A;  3CF5 S;  1EXD A;  1QRU A;  1QRT A;  4WFB S;  1FEU A;  5DM6 S;  4U67 S;  5BNZ A;  3J7Z V;  5JVH S;  4P2B A;  4WF9 S;  4IO9 S;  2RD2 A;  4UY8 8;  3DLL S;  2ZJQ S;  5JVG S;  3AII A;  5DM7 S;  5GAG W;  1B75 A;  1QTQ A;  1QRS A;  4JXZ A;  2ZJR S;  1D6K A;  4JXX A;  2HZ7 A;  5GAE W;  5GAD W;  3PIO S;  5HL7 S;  3PIP S;  4JYZ A;  1O0B A;  2RE8 A;  5GAH W;  1EUQ A;  1O0C A;  1EUY A;  1GTS A;  1DFU P;  5IZN A;  4WFN S;  4H3S A;  2ZJP S;  4IOA S; 
#chains in the Genus database with same CATH topology
 3K7A C;  3CQZ C;  2E2H C;  3RZO C;  1UDX A;  1I6V A;  1YNN A;  2R7Z C;  4YFK A;  3GTG C;  5FLM C;  2AE0 X;  3HOV C;  4QIW D;  1EXD A;  5C4J C;  2A69 A;  2G5D A;  2PJJ A;  4Y7N C;  4XLP A;  4A3K C;  2CW0 A;  3GTO C;  2B63 C;  1SMY A;  4UY8 8;  3AII A;  2O5I A;  3S2D C;  2KXY A;  4XSZ A;  1QTQ A;  1QRS A;  4JXZ A;  1BDF A;  2ZJR S;  2EGV A;  2PMZ D;  4A3I C;  3HOY C;  1VHK A;  4IOA S;  5HL7 S;  2PIC A;  4KN4 A;  1VHY A;  5TMF A;  1HQM A;  4G7H A;  4BBS C;  5GAH W;  3S17 C;  1TWF C;  1R9T C;  4C2M C;  2BE5 A;  4J3C A;  1TWC C;  2WAQ D;  4KMU A;  3S1Q C;  3HOZ C;  2NVX C;  1I6H C;  2YU9 C;  4OIO A;  3KW2 A;  2NVT C;  3W2V B;  4V19 4;  4OIP A;  3LYW A;  1ZJW A;  3CF5 S;  4BBR C;  2PA8 D;  2Y0S D;  3S15 C;  4YFX A;  4YFN A;  3HOX C;  1FEU A;  5DM6 S;  4U67 S;  4A3M C;  1YNJ A;  4A3D C;  2Z0Y A;  1NXZ A;  5JVH S;  2A6E A;  2NVY C;  4C3J C;  4WF9 S;  4OIR A;  4IO9 S;  2RD2 A;  3W2W B;  4Y52 C;  3PO3 C;  4A3G C;  4Q4Z A;  4Q5S A;  2GAE A;  1ZYR A;  1D6K A;  3PIO S;  5GAE W;  5GAD W;  3H3V D;  3I4N C;  2PNW A;  2L3U A;  3S1N C;  4MEY A;  2EGW A;  2RE8 A;  3GTM C;  1O0C A;  1K83 C;  1TWG C;  1I3Q C;  5IP9 C;  4MEX A;  4ZH4 A;  3S14 C;  4BXX C;  1Y1V C;  2ZJP S;  4LLG A;  2JA5 C;  1V6Z A;  4WFA S;  1SFO C;  3WOD A;  4A3F C;  1NYL A;  1GTR A;  4OIQ A;  5D4D A;  4A3L C;  1QRU A;  2R93 C;  1QRT A;  4WFB S;  3I4M C;  5C44 C;  2E2J C;  3S16 C;  1TWA C;  3J7Z V;  3RZD C;  5C4X C;  2G6G A;  4P2B A;  4KN7 A;  2A68 A;  3GTQ C;  3S1M C;  4JK1 A;  3FKI C;  2O5J A;  2ZJQ S;  4C3H C;  2JA8 C;  3CZB A;  1TWH C;  3M3Y C;  4LJZ A;  5GAG W;  3GTK C;  1IW7 A;  2HZ7 A;  2A6H A;  4AYB D;  1EUQ A;  2PPB A;  2R92 C;  4NOI A;  1GTS A;  5HQH A;  4G7O A;  4YG2 A;  4H3S A;  4E8B A;  4QJV A;  4L69 A;  4XSX A;  2VUM C;  4WCE S;  3S2H C;  3M4O C;  2JA7 C;  4IOC S;  3DXJ A;  4A3E C;  1I50 C;  4C3I C;  5C3E C;  4G7Z A;  1Y1W C;  2KQ1 A;  2WB1 D;  5TMC A;  4H4K A;  5BNZ A;  5IYB C;  4A3B C;  1Z85 A;  4LK0 A;  3GTJ C;  4BY7 C;  3GTL C;  3H0G C;  2NWA A;  4OIN A;  2JA6 C;  3HKZ D;  2E2I C;  3DLL S;  3EQL A;  5JVG S;  4GZY A;  4XLN A;  3HOW C;  3S1R C;  1WCM C;  4BY1 C;  5DM7 S;  1B75 A;  4LK1 A;  5IYD C;  4A3J C;  2KPU A;  2NVQ C;  4JXX A;  3HOU C;  3GTP C;  3PIP S;  4JYZ A;  4MQ9 A;  1O0B A;  5IYC C;  3PO2 C;  2PI8 A;  4X6A C;  2CX8 A;  4A3C C;  1EUY A;  4A93 C;  1DFU P;  2L5N A;  5IZN A;  4WFN S;  5IP7 C;  3X1L B; 
#chains in the Genus database with same CATH homology
 1UDX A;  4WCE S;  4WFA S;  1NYL A;  3W2V B;  4V19 4;  1GTR A;  4IOC S;  1ZJW A;  3CF5 S;  1EXD A;  1QRU A;  1QRT A;  4WFB S;  1FEU A;  5DM6 S;  4U67 S;  4H4K A;  5BNZ A;  3J7Z V;  5JVH S;  4P2B A;  4WF9 S;  4IO9 S;  2RD2 A;  3W2W B;  4UY8 8;  3DLL S;  2ZJQ S;  5JVG S;  3AII A;  5DM7 S;  5GAG W;  1B75 A;  1QTQ A;  1QRS A;  4JXZ A;  2ZJR S;  1D6K A;  4JXX A;  2HZ7 A;  5GAE W;  5GAD W;  3PIO S;  4IOA S;  5HL7 S;  3PIP S;  4JYZ A;  1O0B A;  2RE8 A;  5GAH W;  1EUQ A;  1O0C A;  1EUY A;  1GTS A;  1DFU P;  5IZN A;  4WFN S;  4H3S A;  2ZJP S;  3X1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...