4U67S

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4u67S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4u67S02
5GAHW 1NYLA 4U67S 1DFUP 3PIOS 4WFAS 4H3SA 3PIPS 2RD2A 1EUQA 2RE8A 1EUYA 4IO9S 5IZNA 4UY88 4WFNS 4JXZA 2ZJRS 1QTQA 4IOAS 1GTSA 1O0BA 5DM7S 3DLLS 1D6KA 2HZ7A 1B75A 2ZJPS 5BNZA 1GTRA 1QRSA 5GADW 3J7ZV 1QRTA 5GAEW 1QRUA 1FEUA 4WCES 5GAGW 5HL7S 4WFBS 1O0CA 1ZJWA 2ZJQS 4WF9S 3CF5S 5JVHS 4JXXA 5JVGS 4IOCS 1EXDA 3AIIA 4JYZA 5DM6S 4P2BA
chains in the Genus database with same CATH superfamily
5GAHW 1NYLA 1DFUP 2L5NA 3PO2C 2NWAA 3GTQC 1YNJA 4WFAS 3GTPC 3M3YC 1EUYA 1IW7A 4KN7A 3HOZC 4JXZA 2A6EA 5D4DA 2G6GA 3I4NC 1GTSA 5IYCC 4XSXA 4A3JC 1D6KA 5IP7C 2HZ7A 4JK1A 4QIWD 5IYDC 4Q4ZA 2YU9C 2KXYA 4XLNA 2ZJPS 3RZDC 1GTRA 3S1QC 2KQ1A 1QRSA 4GZYA 1I50C 4G7HA 1QRUA 2WAQD 2A68A 2R7ZC 3HOWC 4OIOA 2PA8D 4A3MC 3I4MC 3CQZC 5HQHA 4A3LC 1VHYA 3PO3C 2ZJQS 1SMYA 3CF5S 5JVHS 4C3IC 1NXZA 2NVXC 4BY7C 3X1LB 4X6AC 2CW0A 4XLPA 4OIQA 5DM6S 2JA7C 2E2IC 3GTOC 3S16C 4G7OA 1TWHC 3S1NC 3S2DC 2E2HC 1K83C 2RE8A 5C4XC 2EGVA 5IZNA 1TWAC 4WFNS 5C3EC 4YG2A 2JA6C 1Y1WC 4Q5SA 5DM7S 3DLLS 5C4JC 3HOXC 2BE5A 4A3EC 3FKIC 2PPBA 2O5JA 1I6VA 5IYBC 1I3QC 1QRTA 3LYWA 3S1MC 4H4KA 4OIRA 1FEUA 3CZBA 2NVQC 1SFOC 1HQMA 2KPUA 4KN4A 3M4OC 4A3CC 4JXXA 4IOCS 2AE0X 3AIIA 2VUMC 4V194 4A93C 4C3HC 4BXXC 4E8BA 4A3BC 1BDFA 3WODA 4H3SA 1TWFC 3DXJA 4LK0A 5IP9C 2O5IA 1QTQA 4LJZA 4IOAS 4ZH4A 1B75A 2EGWA 4YFXA 4BY1C 1Z85A 2PNWA 5GADW 4BBRC 4MEXA 4MEYA 5GAEW 2GAEA 5TMFA 4QJVA 4WCES 4KMUA 5HL7S 2NVYC 2E2JC 1UDXA 2NVTC 3GTGC 4C2MC 3S14C 1O0CA 3GTKC 1R9TC 4WF9S 4NOIA 5JVGS 1WCMC 3K7AC 1EXDA 3H3VD 4JYZA 1VHKA 4LK1A 4C3JC 4UY88 3S1RC 3H0GC 2PICA 4U67S 3PIOS 5FLMC 2A6HA 4AYBD 2PMZD 3PIPS 3W2WB 2RD2A 1EUQA 2L3UA 4IO9S 3GTLC 4Y52C 2ZJRS 2WB1D 5TMCA 1YNNA 2PI8A 2B63C 1V6ZA 2A69A 1O0BA 2Z0YA 3HKZD 4OINA 3GTMC 1I6HC 3HOUC 2JA5C 3EQLA 4Y7NC 3S2HC 4A3KC 3KW2A 4G7ZA 4A3IC 4A3FC 5BNZA 3W2VB 3RZOC 4L69A 4LLGA 3J7ZV 4OIPA 4BBSC 3GTJC 4J3CA 1Y1VC 2R93C 5GAGW 5C44C 2R92C 3HOYC 1ZJWA 4YFNA 2Y0SD 3S17C 4A3DC 2PJJA 4A3GC 3HOVC 2G5DA 3S15C 2CX8A 1TWCC 1TWGC 1ZYRA 4XSZA 4YFKA 2JA8C 4WFBS 4P2BA 4MQ9A
chains in the Genus database with same CATH topology
5GAHW 1NYLA 4U67S 1DFUP 3PIOS 4WFAS 4H3SA 3PIPS 3W2WB 2RD2A 2RE8A 1EUQA 4IO9S 5IZNA 1EUYA 4UY88 4WFNS 4JXZA 2ZJRS 1QTQA 4IOAS 1GTSA 1O0BA 5DM7S 3DLLS 1D6KA 2HZ7A 1B75A 2ZJPS 5BNZA 3W2VB 1GTRA 1QRSA 5GADW 3J7ZV 1QRTA 5GAEW 1QRUA 4H4KA 1FEUA 4WCES 5GAGW 5HL7S 4WFBS 1UDXA 1O0CA 1ZJWA 2ZJQS 4WF9S 3CF5S 5JVHS 4JXXA 5JVGS 4IOCS 1EXDA 3AIIA 3X1LB 4V194 4JYZA 5DM6S 4P2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAH W;  1NYL A;  4U67 S;  1DFU P;  3PIO S;  4WFA S;  4H3S A;  3PIP S;  2RD2 A;  1EUQ A;  2RE8 A;  1EUY A;  4IO9 S;  5IZN A;  4UY8 8;  4WFN S;  4JXZ A;  2ZJR S;  1QTQ A;  4IOA S;  1GTS A;  1O0B A;  5DM7 S;  3DLL S;  1D6K A;  2HZ7 A;  1B75 A;  2ZJP S;  5BNZ A;  1GTR A;  1QRS A;  5GAD W;  3J7Z V;  1QRT A;  5GAE W;  1QRU A;  1FEU A;  4WCE S;  5GAG W;  5HL7 S;  4WFB S;  1O0C A;  1ZJW A;  2ZJQ S;  4WF9 S;  3CF5 S;  5JVH S;  4JXX A;  5JVG S;  4IOC S;  1EXD A;  3AII A;  4JYZ A;  5DM6 S;  4P2B A; 
#chains in the Genus database with same CATH topology
 5GAH W;  1NYL A;  1DFU P;  2L5N A;  3PO2 C;  2NWA A;  3GTQ C;  1YNJ A;  4WFA S;  3GTP C;  3M3Y C;  1EUY A;  1IW7 A;  4KN7 A;  3HOZ C;  4JXZ A;  2A6E A;  5D4D A;  2G6G A;  3I4N C;  1GTS A;  5IYC C;  4XSX A;  4A3J C;  1D6K A;  5IP7 C;  2HZ7 A;  4JK1 A;  4QIW D;  5IYD C;  4Q4Z A;  2YU9 C;  2KXY A;  4XLN A;  2ZJP S;  3RZD C;  1GTR A;  3S1Q C;  2KQ1 A;  1QRS A;  4GZY A;  1I50 C;  4G7H A;  1QRU A;  2WAQ D;  2A68 A;  2R7Z C;  3HOW C;  4OIO A;  2PA8 D;  4A3M C;  3I4M C;  3CQZ C;  5HQH A;  4A3L C;  1VHY A;  3PO3 C;  2ZJQ S;  1SMY A;  3CF5 S;  5JVH S;  4C3I C;  1NXZ A;  2NVX C;  4BY7 C;  3X1L B;  4X6A C;  2CW0 A;  4XLP A;  4OIQ A;  5DM6 S;  2JA7 C;  2E2I C;  3GTO C;  3S16 C;  4G7O A;  1TWH C;  3S1N C;  3S2D C;  2E2H C;  1K83 C;  2RE8 A;  5C4X C;  2EGV A;  5IZN A;  1TWA C;  4WFN S;  5C3E C;  4YG2 A;  2JA6 C;  1Y1W C;  4Q5S A;  5DM7 S;  3DLL S;  5C4J C;  3HOX C;  2BE5 A;  4A3E C;  3FKI C;  2PPB A;  2O5J A;  1I6V A;  5IYB C;  1I3Q C;  1QRT A;  3LYW A;  3S1M C;  4H4K A;  4OIR A;  1FEU A;  3CZB A;  2NVQ C;  1SFO C;  1HQM A;  2KPU A;  4KN4 A;  3M4O C;  4A3C C;  4JXX A;  4IOC S;  2AE0 X;  3AII A;  2VUM C;  4V19 4;  4A93 C;  4C3H C;  4BXX C;  4E8B A;  4A3B C;  1BDF A;  3WOD A;  4H3S A;  1TWF C;  3DXJ A;  4LK0 A;  5IP9 C;  2O5I A;  1QTQ A;  4LJZ A;  4IOA S;  4ZH4 A;  1B75 A;  2EGW A;  4YFX A;  4BY1 C;  1Z85 A;  2PNW A;  5GAD W;  4BBR C;  4MEX A;  4MEY A;  5GAE W;  2GAE A;  5TMF A;  4QJV A;  4WCE S;  4KMU A;  5HL7 S;  2NVY C;  2E2J C;  1UDX A;  2NVT C;  3GTG C;  4C2M C;  3S14 C;  1O0C A;  3GTK C;  1R9T C;  4WF9 S;  4NOI A;  5JVG S;  1WCM C;  3K7A C;  1EXD A;  3H3V D;  4JYZ A;  1VHK A;  4LK1 A;  4C3J C;  4UY8 8;  3S1R C;  3H0G C;  2PIC A;  4U67 S;  3PIO S;  5FLM C;  2A6H A;  4AYB D;  2PMZ D;  3PIP S;  3W2W B;  2RD2 A;  1EUQ A;  2L3U A;  4IO9 S;  3GTL C;  4Y52 C;  2ZJR S;  2WB1 D;  5TMC A;  1YNN A;  2PI8 A;  2B63 C;  1V6Z A;  2A69 A;  1O0B A;  2Z0Y A;  3HKZ D;  4OIN A;  3GTM C;  1I6H C;  3HOU C;  2JA5 C;  3EQL A;  4Y7N C;  3S2H C;  4A3K C;  3KW2 A;  4G7Z A;  4A3I C;  4A3F C;  5BNZ A;  3W2V B;  3RZO C;  4L69 A;  4LLG A;  3J7Z V;  4OIP A;  4BBS C;  3GTJ C;  4J3C A;  1Y1V C;  2R93 C;  5GAG W;  5C44 C;  2R92 C;  3HOY C;  1ZJW A;  4YFN A;  2Y0S D;  3S17 C;  4A3D C;  2PJJ A;  4A3G C;  3HOV C;  2G5D A;  3S15 C;  2CX8 A;  1TWC C;  1TWG C;  1ZYR A;  4XSZ A;  4YFK A;  2JA8 C;  4WFB S;  4P2B A;  4MQ9 A; 
#chains in the Genus database with same CATH homology
 5GAH W;  1NYL A;  4U67 S;  1DFU P;  3PIO S;  4WFA S;  4H3S A;  3PIP S;  3W2W B;  2RD2 A;  2RE8 A;  1EUQ A;  4IO9 S;  5IZN A;  1EUY A;  4UY8 8;  4WFN S;  4JXZ A;  2ZJR S;  1QTQ A;  4IOA S;  1GTS A;  1O0B A;  5DM7 S;  3DLL S;  1D6K A;  2HZ7 A;  1B75 A;  2ZJP S;  5BNZ A;  3W2V B;  1GTR A;  1QRS A;  5GAD W;  3J7Z V;  1QRT A;  5GAE W;  1QRU A;  4H4K A;  1FEU A;  4WCE S;  5GAG W;  5HL7 S;  4WFB S;  1UDX A;  1O0C A;  1ZJW A;  2ZJQ S;  4WF9 S;  3CF5 S;  5JVH S;  4JXX A;  5JVG S;  4IOC S;  1EXD A;  3AII A;  3X1L B;  4V19 4;  4JYZ A;  5DM6 S;  4P2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...