3X1LB

Crystal structure of the crispr-cas rna silencing cmr complex bound to a target analog
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
319
Chain Sequence
MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLSREKKVVEEGMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cmr subunit Cmr2
publication title Crystal Structure of the CRISPR-Cas RNA Silencing Cmr Complex Bound to a Target Analog
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Rna binding protein/rna/dna
total genus 64
structure length 319
sequence length 322
ec nomenclature
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3x1lB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3x1lB03
4H4KA 3W2WB 3W2VB 3X1LB
chains in the Genus database with same CATH superfamily
3DU5A 2I6WA 1KLNA 4KO0B 3JQMA 4WFXA 4OIXA 3NNAA 2QA2A 1D9AA 3QIPA 2F8HA 3QBCA 4YOEA 5D0HA 3IS9B 3PIPS 4EGLA 4RKUC 2OPRA 1CULB 2ZD1B 3TW0A 3MD1A 5ETPA 5KFMA 4L73A 2VASA 1PAEX 2OPQA 5CCLA 2J9DA 5AE2A 2BRKA 3QAUA 2ACYA 3OR1A 2FPHX 1Y5NB 5F41A 4P52A 1QAXA 4NA3A 1XR6A 2WSFC 1S72S 3MMBA 4QJVA 2HAFA 1Q86T 2YKOA 1AW0A 2EBEA 2W24A 2CG4A 2HBQB 4PYAA 2XB2D 1T9VA 3SQGA 2YQ3A 4P74A 1TUGB 2VFUA 4NYOA 1WSVA 4WWSA 3EDRB 2Y3YA 3AJDA 3CMQA 3SEOA 4FNHA 5E7OB 4NMXA 5A2QY 2YXLA 2OMOA 3FCVA 2DBBA 4PWDB 4ECTA 3CCWA 4ETZA 1Q5VA 3TI0A 2DTJA 3KDOA 4DR2J 2ZH1A 2AU0A 4OYWA 2XG8A 3TJAA 3V6DA 3IBFB 1H73A 2RUGA 2ZBIA 5K9FA 4M5NA 2HRUA 1JIHA 2JNJA 4DOZA 4DV7F 1C0UB 2CPDA 2I1RA 4QR0A 2LYVA 4O0IA 5IC4B 3HHLC 3KK1B 3TAMA 2QL9B 3F44A 1EP4A 3Q8UA 4KYZA 1GK8A 5FLXU 3QIDA 1DBDA 3EVOA 4NCAA 4I2QB 2ATLA 1Z2ZA 1S6PA 2RQCA 2H9ZA 2CQGA 1IBLJ 3OTOJ 3SI8A 3C3LA 5KOXA 2GW8A 3NNCA 4CWBA 2CJKA 4QWDA 3W8PA 3G71S 4HDHA 3HFKA 3QT7A 1T94A 3LP2A 3K57A 4ZP7A 4K4UA 3H2LA 2M88A 2NZ4A 1K9MT 2M70A 5B0DA 4DHVA 1GMVA 3FKBA 3OBIA 2IY5B 4YUDA 5KG7A 2XMAA 4F67A 1J2VA 2CJBA 2DHHA 4G3IA 1HD0A 2B6AA 3UWTA 3QNWB 2IJFA 2DO4A 3GILA 1QRSA 5EX0A 3P96A 2IMWP 2D3UA 3CPWR 1UFWA 1ZZNA 5AJ3J 9RUBA 1SQFA 1U4BA 4PUOA 3M9MB 3N6MA 2OPSA 1SCJB 3K2YA 4Q8EA 5KFEA 5HK4A 4CLWA 4U8VA 3TUZC 3BO2A 4PAAA 4B3MJ 1RTDB 2ZOGA 4C11A 2VBWA 5KT4A 3EDQB 3RB6A 2WW8A 4D3HA 1Q5YA 4KH1B 4WFBQ 4Q0BA 3GJQB 2OHDA 2MZSA 2NUHA 3LQVA 1FO1A 1FVQA 4HVZA 4OJ1A 4F02A 1RWOB 4FZVA 2J76E 2NQPA 2CQDA 3GWCA 4W90B 1YJ9S 4P9SA 1ZM9A 2CJYB 2UVVA 2M52A 1SJ1A 2HZCA 3CC4S 3DYAA 2W2OP 2HBRB 3AOAA 2NREA 2XS7A 3UVJA 1BQNA 4ILMA 4WU2A 5DZ6A 3MWBA 4ICLA 2KN4A 4HHJA 4R25A 4K4SA 2N4DA 2HWIA 4RR5A 3WDOA 3T1HJ 3M8WA 1X9WA 3C15A 2P9EA 4MKBA 3CCRS 4DV5J 2DKOB 2OD4A 3GIKA 2OP5A 5JMNA 3D3CJ 3HDSA 3ET6A 2JEGA 1M90T 4M5DA 3MEKA 1TKTB 3OL8A 4WKYA 3RBDA 2EXUA 4X66F 3RTVA 2ZBPA 2ZH3A 1HWJA 1F1BB 2E5LF 2APOA 4LRAA 3HMJG 3GIRA 3I0SA 4KR0B 4L72B 3Q86A 2Z8QA 4O3OA 3C66A 2YKNA 3OSNA 3IRWP 3DLEB 4JI0F 2HS4A 3KLIA 1WHYA 3GTYX 2CPXA 3O1LA 4B3OB 5EWEA 1WOOA 4EZ6A 5KG6A 4DZDA 5IQ6A 2BW7A 4WIQA 2OPPB 1RWPB 3H59A 3B4DA 4LRDA 1HQUA 3TUIC 1HNWF 4LFCF 2FYXA 1F6TA 2F9JA 3G6VA 2BZ2A 4F2RA 3AQPA 1TAUA 1U8WA 3H42A 3BKTA 3NNHA 1VQ8S 3D54A 4WJBA 1S48A 1WELA 2P2CB 2JC1A 1U49A 4LUBA 5J2QB 1NK0A 1ZYQA 3NGTA 2PI8A 1EETB 2JZ5A 5LJ5Y 3MM6A 1U0SA 4TVAB 4ZKAA 4NLRA 1XK8A 4NLQA 4UZBA 2LA4A 1DZ5A 3PYFA 5C7PA 3K0JA 2UUCJ 3PR4A 2RB7A 3FUYA 1RWWB 1AXQA 1RT2B 3MM9B 3AB4B 3D1HA 2XMJA 1AFIA 3UR0A 1H2VZ 1PJ6A 2P6TA 1NYLA 1PAUB 2ADBA 1N5VA 3OR2B 4F26A 4CM0A 2LU2A 4B9VA 3OUYA 1LFWA 2O67A 1HQ2A 3G8TA 1N32J 1YRUA 3BR9A 2QYCA 2DIVA 3K17A 4OFZA 4M94A 3NL0A 2KZMA 1R6VA 3DLJA 3DLKA 3DOLB 5EWGA 4RBTA 3R5DA 3H5XA 1DARA 2RILA 3CJ4A 2MGZA 3T9ZA 5KT2A 2RHSB 3EGWB 4DX6A 3PYEA 3HSDA 1G1XA 2EFVA 5DM6S 3UN3A 4URGA 2BKNA 1NB7A 2XY6A 3GYGA 3HPOA 3FMBA 5ETNA 3HFVA 3UQSA 2DISA 5U47A 3BDEA 3QATA 1Q81T 1T3OA 1CC7A 2RRNA 2W01A 4LRCA 5F0UA 3TZWA 2B9YA 5CZVA 3BGLA 5E3RA 1Q4RA 3E01A 1VJWA 2B7CB 1CJUA 4B9UA 1FX2A 1YJ7A 6FD1A 1KFDA 5GAGI 5DETA 4N8NA 4PCQA 4JYZA 2QE5A 2HGMA 2CYYA 4CP5A 2YWFA 1SL2A 3P45B 1C2PA 3PW5A 1S0VA 1F9FA 3BO3A 1MWZA 4FBTA 5KFRA 4FN5A 3BGRA 2V4JA 4X62J 2DH7A 1TVRA 1S0OA 1IBLF 4QWAA 3OVBA 1JLCB 2G6GA 1HWLA 1TFYA 4XPCA 3R7NB 4NA1A 3KHLA 2ADCA 5J1EB 4IRCA 4FF3A 2HZVA 3ZNUA 4J5OA 4USWA 2YWGA 1LXNA 4YB7A 2IM0A 1NKCA 3CD6S 3HZGA 2HFNA 4ES1A 5H9FJ 3PZPA 3HHKA 4FPRA 1IXKA 4LSZB 5IM0B 4KAIA 5E3AA 2YH0A 2RQ4A 2DR5A 3AD8C 4ANEA 4ZCMA 2F9DA 3CMAS 4OYAA 3TP2A 3MAQA 2GMHA 3MECB 3MF5A 4DV4J 5AJ3F 1N5YA 1V5IB 2F8MA 4ZPDA 4I6YA 4Q2LA 2HHXA 2PO4A 2MY8A 2GS8A 4F4KA 3VQSA 3LGHA 3SSQA 4ED4A 1X8DA 3FJ2A 4MFBA 1FDAA 4CLTA 1HBMB 4KGKA 1RA6A 2AMCB 3G2XA 2JHEA 3QAEA 1DJ0A 4RO0A 2FB0A 4WFYA 4NXNF 2UU9J 1IR1A 4FPIA 5E0OA 2ZC3A 4ANCA 2W7OA 1CBKA 3UO0A 2FZKB 1PG5B 1TL1A 3KK3A 4KKOA 1EIYB 2CNLB 3IN5A 5LOQA 4Y2AA 3FEZA 1YHQS 2X51A 2B4UA 4DR1F 3G9CA 4U67S 3JSMB 1T3NA 2C3MA 2VD3A 1U7LA 1N54B 3OFFA 2C2EA 4M5MA 4CM2A 4ZJQA 1S77D 2QX0A 1VFJA 3L09A 3W2WB 4LIWA 2LEAA 4NI2A 3THPA 1EKSA 2RE1A 1SIZA 3EGNA 4DCOB 4QIEA 4QU6A 2FC9A 4X4TA 2ZM6F 3QSIA 4FF4A 4DR6F 4ED5A 3CF5S 4KIAA 3GV8B 3MM5A 5F8MA 4RW6B 1FWPA 4PYDA 5LMNF 3EUNA 4MYTA 2VFSA 2QMXA 2Q66A 1G4CA 5CCMA 1HNZF 4Y2MA 1HBNA 3KNGA 2YX4A 5KAKA 5A8WA 2Y0BB 3Q0AA 3BKFA 3D2WA 3V4IA 4YR2A 5HQMA 3SSSA 1RHRB 1CJTB 2NLWA 2AF6A 4LR7A 4KFBA 5KFDA 2CAJA 3AT1B 3DLLQ 4DV6J 1VLOA 1ITPA 4A8OA 1S1VA 2AYGA 2N7CA 3UD3P 2JX2A 4UQGA 5AXLA 3P4UB 1UDXA 4FXDA 2VQFJ 2HNDB 4QR1A 1JLQA 2YX7A 4QU7A 1Y9OA 2RS8A 4AYBD 3QWPA 1U1OA 1PYTA 2B4PA 3IG1A 2DR8A 1U02A 1WSRA 4J9MA 1HI0P 4A8YA 4DQPA 5DDQC 1RT4A 3GYNA 3HO1A 4MH8A 4DL5A 3EZOA 3BQ2A 2WONB 5CYJA 2JJ4D 3MMCB 3AIIA 2F4VF 3WQPA 3ILIA 4QIFA 4DPWA 2QN6B 3A4TA 2DNHA 3BV8A 1RZMA 4IG0B 4GC7A 3CD0A 2H3EB 3Q22A 2ROEA 4RW9A 2K2PA 1UW4A 4ZPTR 3TARA 4GO5X 2E7VA 2PDAA 3NMRA 3OL7A 2MQ8A 4DV0F 2J7WA 2PICA 3NS5A 2M2BA 3L3CA 1GMUA 4WTYA 3J80Y 5KG2A 1T05A 1WG5A 5HMYA 4NLYA 3EGVA 1RBLA 1RABB 3M2VB 4WXWA 1EQMA 3D66A 3GP9A 2AZ3A 4UT4A 2MKHA 1N32F 2O66A 1V5VA 3HD1A 3CC7S 2AP6A 5K20B 2N4CA 3PW4A 4MKYA 1B3TA 1ZAXA 2YNHB 1S1UA 1HNXJ 4TU9A 1VBKA 1TAQA 3UN2A 4XTTA 1YQHA 3OHAA 1U25A 5M2UA 1REVB 5D4PA 1AZSA 4IH5A 1WF1A 2LQJA 2KU7A 1VQ4S 2BACA 4WPAA 2B0GA 4OZJA 3OTEA 4DEZA 3NBPB 2BJDA 2WVBA 3CCTA 1JNZB 5KG5A 5THWA 3A3OB 2GGPA 2MQMA 5KFNA 4I67A 3N5FA 5FDLA 4FVMA 2XZWA 5LM7E 3D67A 5B7WA 2UUBF 1S0MA 4CLYA 2EI5A 2GQ2A 2Q6BA 3RW6A 3E51A 1KNZA 2GO9A 4C4WA 3C6TB 1HWUA 3T5JA 3TR5A 2W2MP 1RLDA 1I1GA 2MKKA 3PW0A 1K8AT 1IKVA 4AFFA 4PXCA 4F7VA 1T9WA 4DV3F 3TUJC 4X4QA 1REGX 1M5KC 5IZNA 3TO8A 4DFPA 2PNWA 4J9VA 1HKAA 4GO7X 3UE2A 2M8DB 4H4OA 3HT3A 2JVRA 3WIUA 4M5HA 4HI2A 4K5SA 2R7RA 1M1GA 1WHXA 4HTJA 4CNYA 1FTCA 4J37A 1AFJA 3DGPB 3WC2A 3I0RA 1FDDA 5IV4A 1WACA 3IRXB 1LWCB 4OX6A 4CYUA 2GIQA 3DM2B 3T5HA 1X5TA 1VBXA 4YMEA 4F4WA 2JFKA 1Q8IA 3MM7A 4KJIA 1Z2LA 2ZE2A 1PBUA 1EKRA 2GHWA 1QSYA 3ZZOA 2RF2A 2W4CA 2DR9A 1LW0A 2FZCB 3ETOA 2PEHA 2XHWA 3K5OA 4ZVRB 1APSA 2V4RA 4C7QA 1IWAA 4OL8A 2U1AA 2WZ1A 1GNKA 4O44A 2UXCF 2HS3A 2HNZB 3HHNB 4I68A 3AHPA 1Y4ZB 3PYDA 1NPRA 4DUYF 4TKTA 4X4NA 3B54A 1S9GB 2A1BA 3DHWC 3VF0B 3LPYA 5DDPC 2IYGA 1UAWA 5M2RA 4H54A 2I5JB 1AA1B 1IBMJ 3L95X 2HWHA 3IO1A 2YNGA 3SCJE 4UTGA 4NYZA 1B4SA 3T6JA 2MKCA 4B3SF 2ASDA 2HHHF 3V6HA 1PIEA 5KFSA 2H48B 2CQ2A 3ZTRA 4X4OA 2C2OB 5H9EJ 5LJ3Y 2KFYA 3GB0A 3VAKA 2BM1A 4MIAA 4PABA 2QSFA 4GC6A 3X1LB 3UN5A 3CO9A 2DHAA 2R7VA 5HL7S 2ACMA 3HSJA 4M5JA 1WKKA 1SH2A 4ZVPB 2JLGA 4I69A 2XYHB 1MMNA 1TL3A 2E44A 5GADU 2F40A 2RHQB 3V81B 4OQJA 5HP1A 2VBYA 2NYIA 2DCUB 2GJIA 3RAMA 1NCLA 7AT1B 2LA6A 3AD7C 4C8LA 5IT0A 2KTQA 5F8HA 2F7VA 3HP6A 2KFNA 2ASJA 1HIYA 3CCUS 3CB4A 3NLCA 1N56A 1WG4A 1A0OB 3DCAA 1LEOA 3QIPB 1VQMS 2WVCA 2QT7A 2KVIA 2RE8A 3CIMA 4JI2J 4OI6A 2OPRB 1MMDA 2V8VA 3FMWA 3N28A 2ZWPA 4DS5A 2BKOA 3FEXB 3L9ZA 2UVWA 5KG1A 4JB8B 5B0BA 1U1QA 3OR1B 3DKDA 3GE9A 5KFOA 3IBCB 3MMBB 5D78A 3SMZA 2GJ2A 4FDFA 2VZ9A 1K0TA 3PJ9A 3AOCA 2R4FA 5BR8J 4MAKA 3SQGB 1R8CA 1R8HA 4ZN3A 4YB6A 1GTRA 2IM1A 3B82A 4EI2A 3TX8A 3A12A 2JRSA 1H74A 5GADI 5D4LA 1CG2A 2AD9A 1KTQA 1S7IA 3WHIA 5EN1A 3MPYA 3K7RA 2FJBB 3W66A 4DR3F 1M1KT 1AUDA 4ZP8A 4WF9S 3AXMA 3CJTA 1SC4B 2MEWA 1P9QC 4LF5F 4OHYA 1NPKA 2DNZA 4K0KF 4RUBA 2XZDB 2EFNA 5GAHU 3KNAA 1XQIA 4HH1A 3WBZA 1RISA 4Z7YA 2MZTA 3W5YA 2DIUA 4IOAQ 3KMSA 3CJ2A 2Z30B 5T7LA 5A2QU 2M7SA 4MYUA 1XJWB 5JUMA 3TAMB 3L7OA 3MCNA 1S9FA 1EP4B 2HHPA 4ES3A 3DGVA 1NJWA 2X3DA 2DGVA 1S6PB 2IVFB 3HVRA 4QW9A 3W63A 3KJQB 5D3GA 5JVGQ 1S1WA 2OAUA 3BH6B 1H3DA 4PG5A 3QFWA 1XN9A 4CZCA 5IV3A 3SCIE 3ONQA 2YPYA 1HNXF 1BHNA 1UEKA 2VC0A 3IFEA 2R7XA 4EBCA 3ZXWA 4CTAA 3A8JA 1TMJA 4K7QA 4F0MA 4DSLA 3ZZZA 2DNRA 2DY9A 5KG4A 3EICA 1AUSL 4YHHJ 1XR7A 3HHLD 6AT1B 2B6AB 3DOMA 3V5RA 3U1NA 2H4WB 4DJBA 3LWLA 4TQSA 3CJ5A 2YKMA 3MMAA 4PUOB 1RAEB 4ZVHA 2OPSB 4IOCS 2FHKA 3MOZA 4Z37A 2M8HA 3TAPA 2WOMA 3KHHA 2I8EA 4C11B 1URRA 2HW3A 4USMA 4YS2A 4DUZJ 4WP3A 3MR2A 4QBUA 4ZJLA 4ALZA 3K5LA 1GTHA 1M1HA 4QZVB 3A3PB 3RBZA 2UXDJ 1DURA 4R5PA 4R0JA 3CWJA 2B43A 3OXFA 3BSOA 5CHCB 4XDDA 2KHDA 2A0FB 3DYAB 1IR2A 5D77A 2NWAA 2X3GA 1Q79A 2KKHA 3UVJB 3MZIA 1BQNB 2XMVA 4M5IA 4X64F 5FLXY 3J7AN 2R2TA 3CGIA 4A8KA 4ICLB 2HQGA 3KLHA 1RQ0A 4TNOA 2D3OR 2PSZA 1VI7A 5IT4A 1IKWA 2XS2A 2YTCA 3C15B 3FEYB 4U9RA 1TR0A 4DR5J 1BC6A 1UA1A 3W5ZA 1ZTTA 1WOPA 3ET6B 4J9RA 2BBEA 2Y1JA 1XBWA 4M5DB 4QYZK 3AJ2A 3JQJA 2LEPA 8RUCA 2KDOA 2J0SD 1S76D 3CVKA 1C1BA 2DGTA 1K1QA 1HPZA 1T8EA 4CLFA 1XNRJ 2DJWA 4X4UA 3I0SB 5HI7A 1T03B 1U1KA 4GKJJ 3QLHA 3T41A 4N7TA 2YKNB 1BUXA 2HNYA 2BANA 1SJQA 1NXIA 3KLIB 1QSLA 4JI8J 5HQ8A 1LFPA 1RACB 2ZUAA 2KYZA 3M30B 2GAHC 2DPIA 2KB2A 3EWGA 3CCMS 4M8LA 4Y0FA 1PYOB 4XPEA 2RKIA 1C4CA 2IYIA 4PG4A 1HQUB 2G2YA 3PVXA 1KDNA 3Q24A 2KI2A 4ATNA 1S99A 2KRRA 1XERA 1XR5A 2O5DA 2CQ0A 2KL8A 1SKUB 5SZTA 2Z0GA 3EM1A 4G1QA 2XGPA 1WI6A 3G8QA 2FVPA 1SBRA 1T9TA 3QO9A 1L3UA 2CJQA 5E33A 1LWFA 1WC5A 4MJKA 4HYKA 2AJFE 3AB2B 3CUNA 1C4AA 1X5PA 3TJ9A 3KHGA 5HAOA 3RBXA 1P6TA 2K7JA 4J9UE 2BJ9A 3DXSX 2V0NA 2NSBA 4LSNA 3BR8A 1M5SA 1VIOA 1DFUP 4WFNQ 4P7VA 3QMQA 3S1TA 3OPKA 3L7PA 2VB6A 3EE3A 2HVHA 5DO2A 4RU9A 3OUYB 5D0EA 1OPZA 1GFWB 1D8ZA 4IFYA 1XNQF 1NDLA 4HR2A 1T02A 1N5QA 4YB1P 4OYZA 4ZN1A 2A18A 3DLKB 3RU0A 1HMVA 1UVKA 1HWKA 2J6TA 3G6ES 2Z2ZA 1MMLA 4A8XA 2M5YA 2MQOA 2WSEC 2RJZA 4EO8A 5JXSA 2R8GA 2Z4PA 2AV5A 2IRXA 4PPDA 3UD5A 2ZJRS 1F2HA 5ADZA 1HFEL 1Y11A 3U02A 2GC8A 1IVZA 5L1LA 2MLYA 4DR7F 4AQYF 7FD1A 1HI1A 3TOQA 2ROGA 4LR8A 3VR1A 2V8GA 3LGNA 2B8PA 1N34J 3B6BA 3E01B 1JK9B 3BSNA 2FY1A 1IN0A 4LRBA 3W2VA 1B7YB 4WCES 1CJUB 2ZOFA 4B3RF 1SXLA 4UY88 2AKWB 3A8EA 1FT8A 1W7WA 1JLBA 3QT5A 2QYGA 2W7PA 1G2EA 4NPOA 3BGRB 2QMUB 4GVLA 1DHMA 3U1LA 2G2ZA 2EEYA 1TVRB 4JI4J 1MROA 1QAYA 3W60A 3U7JA 3A3NB 4X4PA 4N76A 2ZH4A 2R42A 3TVZA 2XGQA 2HVIA 4MKVA 4LVOP 4LRFA 1TKZA 2LP4A 1OO0B 1JLAA 3O5TB 4DV1F 3PTWA 1U2FA 3TX0A 1BXNA 4RLEA 1FFSB 1OSCA 2EKNA 4DV2J 5J2PA 1FJGF 3L7UA 4IDKA 3HHEA 2XCAA 4B02A 1IKXA 4CI0B 1C0TA 3GJRB 1VK3A 4FS1A 1N5YB 3JXOA 1IWGA 1KVIA 2VV5A 1D9FA 2Z2MA 4A46A 2VFTA 1ULRA 1KWMA 1I94F 2CPFA 3T19A 2OD6A 1NJZA 3CZBA 4MFBB 4A8SA 2FVRA 4F36A 2PA3A 5HANA 5DDOC 4ZA1A 3DMJA 4CH1A 2D9OA 2PFDA 2RIJA 3UDVA 1ZPVA 1MSWD 1FCAA 1S57A 2N3OA 4P10A 2ZHOA 1EXDA 3DRSA 2NXUA 1RKJA 4YN3B 1OJ4A 1NO8A 2HHSA 4TLQA 1V6HA 2JSXA 3R7SB 1GX6A 1TL1B 3KK3B 2HQIA 4KKOB 4OV6A 4KPYA 4ZK7M 1GT8A 1R8PA 3NY0A 4O3PA 1GQEA 5SUHA 4USHA 1RT6A 3P5BP 4OI4A 4NMLA 4NLOA 1NSQA 3OQ2A 4NI2B 3Q89A 4A48A 3EPIA 1H7XA 2FJAB 1GH8A 1O5JA 1S0NA 5KFWA 3QGPA 4CRJA 1KONA 3M6VA 5KFKA 3RRGA 1RB0A 4ELUA 3IWNC 2QLWA 1IBCB 3GV7B 1E6VA 5LXRA 2VQEJ 1U09A 4DPYA 1Y00A 2U2FA 1HBNB 1RKIA 1XNRF 5A8WB 3VAIA 3RRHA 3V4IB 2LLZA 5KT7A 3HJVA 1X4FA 2YH1A 1WEXA 1QRUA 3KWMA 5C24B 4WYLA 4W92B 4KFBB 4EBEA 1YWXA 4JI8F 4JI1J 2LVWA 1X4BA 4ZP9A 3BQ1A 1S1VB 1UWBA 4DL7A 4Y2CA 1YGYA 4NRTA 1VC6A 2RDIA 2HG4A 3PW7A 5F8GA 2AYEA 3KOAA 3JS9A 1X4EA 5HMWA 2MY7A 3MD3A 2V8HA 3M32B 2RNEA 4L76A 2DXEA 4EMDA 1JLQB 4K8RA 4M5LA 4B3TF 4E8UA 3IG1B 1MN7A 4HI1A 2OSRA 1DQAA 4ECUA 3Q8YA 2YWEA 3PKYA 1RT4B 2L3MA 1VCTA 3TUPA 1PO6A 1LXJA 4E0DA 1ZM2A 3CTRA 4L75A 5KG3A 1DLOA 1R0BG 1S12A 2VOPA 1UETA 4JV5J 2KXHA 1SJRA 1PILA 1U45A 4QWBA 4RNHA 1RT5A 2CWXA 3LO3A 3GR1A 2ZITA 3TZZA 1RTZA 1D9DA 4CLZA 2M3DA 4EU0A 1FKPA 1FKOA 2IM2A 3ZZRA 4IO1A 4FYVB 4J7CA 4IQMA 3M9OB 1T05B 1TL5A 2W2NP 1FJ7A 4I2PA 2XLIA 1VQOS 4NZ0A 2DH9A 2MPUA 1XWLA 1TV6A 5IFMA 5HMZA 1NK6A 3F56A 4C3LA 3JYTA 5E2QA 2MJNA 3M6UA 5HVHA 3JQKA 4N41A 1S1UB 3M05A 1RYRA 4AD6A 1BQMA 1RTJA 4AXIA 4A8WA 4DPOA 1ACMB 1AZSB 1HYSA 3CDAA 2W1BA 1BY9A 3CCJS 1CC8A 2EFPA 2X1BA 1RHJB 1TUVA 1U6BA 3BZQA 4UZCA 2WSCC 4MT1A 2PT0A 2BUNA 5J2NA 4IO9S 3FFIA 5GVQA 2HBZB 2FDNA 1YITS 2V8PA 2GGPB 5IXUA 5FDLB 4QOTA 1KTVA 2CVIA 3BYPA 1UVMA 3DRRB 1QAIA 2QZ8A 3OVAA 4BS2A 1WC6A 3D6HB 2EKYA 4DWIA 1T9UA 1H7WA 5ETQA 3QPIA 4Y00A 1IKVB 4DL0C 2HHQA 1RADB 3BSCA 4AUKA 4ER8A 1NAQA 2Q6CA 1U6ZA 2ZWOA 2R7TA 4PPZA 3VHQA 3KW2A 3RR7A 2BE2A 4H4OB 3OW2R 4WXOA 2H5IB 5DLFA 2YNIB 3TJ8A 4KHPJ 4K4ZA 3I0RB 4PXBA 1IKYA 2VL1A 4CYUB 1U1RA 4WU3A 1T95A 1I6JA 2CQHA 3HFZB 2R3VA 3MM7B 2ZE2B 1UEVA 3W64A 5I3QA 2GVZB 2RF2B 3SV3A 2ZUGA 1LW0B 4NE9C 5GAEU 1NZAA 3C16B 1WC0A 1JNRB 5H1SV 3M8QA 4Y3CA 4O44B 2XCPA 5K14A 2R7QA 5LL6d 5DGAA 1RP5A 4FYDA 1FDBA 2XHCA 4G1PA 1CQMA 3IR5B 5GADW 1B0VA 1RXOB 1U24A 1IJEB 2B7BB 3H8YA 2YNGB 2DRAA 2QO3A 2G0IA 4ID8A 1KQFB 3H5SA 2OEMA 4DF8A 4O23A 2CQ4A 1SKRA 3JTOA 5CYQA 3P49B 3OSPA 3P3DA 2Z56B 4JI7J 1DAXA 2V68A 2ZJPS 4F3OA 4IRDA 1D6KA 3FBCA 4LF9J 2J6SA 1A6LA 3HVWA 3NOCA 2V9KA 4DLGA 1RBOB 1LQ9A 5JJBA 3AJ1A 2NR0A 3NGDA 4JUZA 1TL3B 2MQNA 4KSEB 5BYQA 3CJSA 1HQEB 2HQ3A 2HS0A 2YKAA 4DSFA 5HP1B 2EFGA 1GXUA 2VFRA 3HHLA 4CCHA 3P5TL 2VBXA 1RWVB 2DNKA 3HVTA 1OIAA 4YY3F 5A8KA 4PQAA 3ZO7A 2CQCA 3PV8A 2KHCA 1YKWA 1EUQA 4CO3A 1TK8A 4LF7F 2RD2A 2ALYB 4Y2KA 2ZJQS 4Y34A 2BQRA 3Q8VA 1SJFA 1CULA 4ETXA 1FRIA 1XMQJ 2PN6A 5A6WA 1L5UA 4ZMMA 5GAHW 3VGTA 2W8KA 2D41A 1W2BR 2DGWA 2W25A 2PEBA 4LF8F 4JI1F 1IQTA 2E29A 4F4ZA 3VAHA 4MK7A 1CS4A 2HMIB 2Y0SD 2A6OA 3MCOA 2UUAF 3RAXA 3F41A 4RW8A 4JXXA 2A10A 1HNVA 2NXNA 3D4JA 3TEGA 2BJ8A 3RYLA 4EZ9A 3RJMB 4JI5F 2DHGA 2HLTA 2XYGB 2J8AA 2AE0X 1FK9A 4P7TA 4DCJB 1QE1A 1W26A 2GA7A 2NS1B 4CO5A 2HYIB 4LFAF 1WD6A 2R7SA 3QT8A 2HURA 1S1XA 4PWDA 3W8GA 3A13A 1VK8A 2O01C 1VBYA 4NLXA 1WG1A 1ZBTA 1W2IA 1VQKS 2YPZA 1R31A 2VIHA 3SDEA 4TXSA 5L9XA 2DD8S 5T7LB 5K8MA 4DXLA 1N33J 2DNLA 2VG5A 4F4AA 2HFUA 1UVLA 1IQZA 2VU5A 4HDGA 1CEZA 4OX9J 4A4JA 1MWYA 1UVNA 2ZDOA 3KK1A 5D3GB 3MEGA 4CO2A 1KSPA 1IM6A 4ZIWA 4DUTA 1YJTA 4NLUA 1S1WB 4X65J 4WYWA 4EO6A 1MNEA 2AT1B 4I2QA 4FYYB 2G4BA 2EVZA 2XMTA 4J90A 5CQGA 2C2KB 3BN4A 3IMQJ 2OH2A 1WC4A 1QTQA 3BQ0A 1ZAWA 4EK2A 1LOUA 3SCLE 4CTAB 4DQQA 5KFYA 4JYAF 3MURP 2ERRA 2DITA 1IBKF 5KFVA 3GZ7A 3R9LA 3ENVA 2FC8A 3A8KA 3DOMB 1TKDA 2E1AA 2FLOA 4LF4F 2X7IA 2YKMB 2DNYA 3MPWA 1UZDA 4BWMA 2MXYA 2WOMB 2AX0A 4BWJA 1ZPWX 4LFBF 2HVEA 2KYXA 4CT9A 4C48A 3GONA 2H54B 1RAFB 2B8QA 3VZHA 2X1AA 1TMMA 1TUWA 4HT5A 2F65A 5D4NA 4F50A 2QRRA 2XY5A 1OS5A 4R5PB 2DPJA 3SFGA 4NEZA 3ZFVA 4NLDA 3HT0A 4DL4A 1RAAB 2LECA 3M2UA 1DTQA 4H4MA 3KXDA 4Z2XA 1RHUB 1J5EF 1W25A 3R97A 4OX7A 3KLHB 5ETSA 3DLBA 3NG8A 3IGVA 1IKWB 4KV8A 4NX9A 2AHOB 1YJVA 3N0VA 3CCES 3QZ7A 4U7CA 5G0RA 1XMOJ 1LK5A 3E8OA 1KEKA 1X0FA 1U1NA 2OTLS 5F8LA 2UXBJ 1TU0B 2G0JA 2VA3A 3ENQA 1C1BB 1SI9A 1OQ3A 1H6KX 2O3DA 4EYIB 1HPZB 2FZGB 3US5A 1R27B 3WX8A 1U6FA 2FQQB 3D9BA 2VFVA 4RNFA 4B17A 2DXDA 3QLHB 1SPBP 1WEYA 3MAAA 2HNYB 5HO4A 2BANB 4N56A 3V6JA 1VQYA 4DS4A 4K4XA 3VGVA 2VC1A 2CPJA 5DG7A 1WC3A 4YDDB 3PRBA 1FA0A 4QCLA 5DQGA 3KDNA 1RHMB 5HROA 4QYZJ 2CDQA 4NZ6A 5MAOA 4RU2A 3BGFA 4A8FA 1NHUA 4TYAA 1FRKA 4ZJOA 3H2UB 3GFHA 2J9CA 4OJGA 4CO4A 2Z58B 3UDEA 4CNZA 2KT2A 3LP0A 3VVTA 1U8SA 3BF4A 1RT3A 3BPSP 4G1QB 1FRJA 3MEEA 1HHQA 1K1SA 4ILRA 2E7WA 2ILYA 3OFEA 1IM4A 3QO9B 2W8LA 2AJ2A 3I82A 2RH3A 3IBWA 2MKIA 1I51B 2KJVA 4ZPVR 5HLFA 3T5KA 2OFGX 1BQXA 1AB8A 1KBRA 1DQ8A 1VQLS 4DFKA 3CMES 4LSNB 3X3UA 4MTPA 2RU3A 3B4MA 1JLGA 3N6NA 1ZTWA 1RE1B 2LDIA 4HTIA 3MM9A 1MWQA 2V6AA 3CJKA 2R7UA 2BV3A 4U7UD 3RB4A 4IFYB 2CPZA 3PIOQ 4P73A 4ZCIA 4P2FA 1NJYA 4F0KA 1ZZFA 2HEKA 5KG0A 3FGVA 2R8KA 2XLJA 1NUEA 3QWUA 5DM7Q 2POKA 2W9BA 1L3TA 1HMVB 2GJFA 4ZVUB 1SVDA 3O6QA 2MLXA 3ITHB 4E8BA 2ZH2A 1DFDA 3C14A 1EJ7L 2ILZA 3QRQA 1QDUB 4ZVTB 2D69A 2HFZA 5EDWA 1FD8A 3KLVA 4Y2IA 3PHTA 2E5HA 1D09B 2MQLA 4WK3A 2ZVSA 4K2XA 2C2RA 1MN9A 3LAMA 3C19A 2EG2A 2ZDPA 5LMUJ 3BBCA 2FJDB 2VKRA 5CXTA 3TZYA 2VPWB 2R2SA 2LXUA 2VG7A 1FX4A 2AGQA 1UEUA 1Y0HA 5C42A 3NWGA 1NU4A 5E3CA 4M95A 1S1TA 4DF4A 3UD4P 5LXYA 4ZLJA 1D1UA 2MZ1A 4OI2A 3KG4A 3TEHB 4GRSA 3W2VB 2FHJD 5L39A 1N33F 5EX3A 1H38A 3VZIA 1JLBB 3Q2SC 4QR2A 2ZZMA 2YQ1A 3D28A 3GFXA 1RWMB 4HT7A 2F5GA 5JVHQ 1URNA 5IWAJ 3MMJA 1SJ4P 3K8VA 5H9FK 3ZTPA 2IVYA 1NEEA 5A76A 2YY3A 1GX5A 3PJXA 4NL5A 1RBAA 3HZEA 1Q7LB 2XO6A 2HK2A 1RTHA 2CRLA 3FSYA 1LNQA 2DHSA 2E1RA 4RNNA 1TKZB 2OGUA 4NZ7A 3VALA 2HVZA 1TKXA 3WIVA 1Y3KA 1ICEB 1JLAB 2LDYA 1Q8LA 2NXJA 2GHVC 3NAHA 4USKA 2BQUA 2BE7D 5DLGA 1RAGB 2IC3A 1ROFA 4DU7A 4Q43A 3PDNA 1VR6A 5J2PB 3R27A 2MMYA 4IDKB 2G5DA 2HQFA 5DS7A 4KE5A 1IKXB 2PA8D 1N8RT 1C0TB 2DNGA 3OLAA 4Q7AA 2D3ZA 4Q2MA 2DHXA 1FXRA 4DQSA 5KFBA 4C3MA 3K5NA 4M1KA 3RUBL 4PXEA 2CKWA 2HHUA 3ICLA 2LQ9A 3J7YU 4ENOA 4ELTA 3M8ZA 1V9OA 2Z2YB 3AA8A 5EWFA 1ZAVA 2QC3A 3VAJA 2XMKA 5HATA 4X84A 2VPZB 4JI3J 4IFVA 1RT1A 3DRSB 3BH7B 3HKWA 2OJ3A 1BE4A 2NPFA 3GIIA 3DDKA 4P2MA 3RAQA 1BLUA 2O1PA 3E3XA 3QQCD 3WC0A 1RT6B 5I42A 1NK8A 4DR2F 4F3QA 2LXFA 5E41A 3TA2A 4NXMJ 4JBCA 5ETMA 1M0SA 3W62A 2PMZD 1KS2A 1WUUA 1HR0J 1SQEA 1KLMA 4O3NA 4LJMA 4LF6J 3T1YJ 2BOAA 2CIMA 2UV8G 3N4WA 3MAHA 4C8KA 2EFOA 1SC3B 1X4AA 1SIWB 1TTHB 2AYMA 3MM8A 3I87A 4RW4A 2G1DA 3S8SA 3GMGA 1E6VB 2EFQA 3PY8A 3S01A 2WW4A 3AD9C 3BJYA 3M8PB 4X4SA 1AYEA 4DBQA 4ECRA 2HK3A 1WKJA 3UNGC 2C3PA 4J3CA 4XO0A 2VDHA 4YB5A 3OTOF 2E9ZA 3RB3A 1U0HB 3Q83A 4AL7A 4OZ1A 2V4QA 2A2DA 4X2BA 3NS6A 3ZZTA 3M6XA 3OXGA 3DOKA 2CNOB 3PO5A 2IAJA 1QUPA 5HVFA 1ZM4A 1S6OA 4L69A 4IOBA 4IH6A 4QQBA 2CPIA 3M7VA 4NLVA 1WDDA 5C5JA 3HXMA 1WTFA 2F4FA 2BX6A 2VONA 1NDCA 5KFCA 2IMOA 3VCDA 4ECXA 4R8UA 4TY8A 4N47A 2ATCB 4KTQA 4UOFA 2LMIA 1P9YA 1TELA 1Q95G 3UCGA 2PMWA 1KQGB 1B70B 2P9GA 3THTA 3SYZA 3POTA 3QSYB 1FRHA 2ZBRA 5L9NA 1SV5A 4ZVFA 1DLOB 4YQWA 2H5JB 2WONA 4OZ0A 3QZ8A 2OUGA 5I3UA 4B3MF 3TVKA 5F3ZA 2F8EX 3RRKA 1VMBA 5I3PA 1MU2A 1RSCA 2QV6A 2CJ9A 2ASLA 3CNQP 4DV7J 4JP8A 4CLSA 1FKPB 2R8IA 1FKOB 1UCNA 3BPDA 1SJ3P 3HCXA 3R2CJ 2DK2A 3HK2A 3I9ZA 3KK2A 2QJ3A 3W1YC 3LF0A 1FVSA 4I2PB 1XEZA 3SBMA 1T11A 3VQTA 1TV6B 3J81Y 3JYTB 1X4HA 4ZIVA 5A0YA 1FESA 3ELHA 3CD5A 3Q8SB 2JEFA 3OHBA 1BQMB 1RTJB 3CJQA 3HX9A 4YFUA 3PX0A 2QA1A 1HYSB 3T1HF 3RBEA 3M1VA 2YNHA 4DV5F 3M8RA 2J9EA 2JH3A 1REVA 3RGIA 2XEXA 3FFIB 2KM8B 4RWXA 4WK1A 3RZAA 3ZTQA 5B09A 2FLPA 2C3OA 1N5TA 5EHHA 3G86A 3QYYA 3KLGA 2ZC4A 1JMTA 4Q8FA 3ZZ0A 2VOOA 1S5ZA 3H7HB 2HFSA 3MPVA 4NLSA 4KPCA 4LBHA 5GAEW 2UZAA 4JV1A 1OY8A 1FFGB 2HHVA 3S6EA 3W9HA 5FIIA 2BE2B 5AXKA 1PC5A 4L6V3 1B0PA 4IG3A 3MEDB 4Q5VA 1JXEA 4OZ5A 5IWAF 4WFAS 2W2QP 3PIPQ 4PRFA 1FXLA 5B0AA 1GAOA 2B9EA 2HSEB 5B08A 2HPUA 2J5AA 3T5LA 4FNIA 4ED3A 5KFZA 2XBPA 2MDAA 3V2UC 4ZPAA 3R5GA 5D0RA 3CE8A 4DPUA 2YWKA 1RA7A 2R2RA 4K4WA 3H5YA 1DTTA 3DGPA 4L3NA 1UVJA 3PEJA 3J7ZV 5J2MA 2EGWA 5BYRA 2GHPA 2CPHA 4ANDA 2IVMA 1WHWA 4O4GA 3JSBA 2UUCF 3M8QB 3MFHA 3OL9A 1LW2A 1Q1KA 5K14B 2PGCA 1S9EA 5AXNA 1XMBA 1FI4A 1Z1ZA 1FRMA 5H9EK 1YJWS 1F9HA 1S49A 2X1GA 1XC9A 4JOUA 5E5NA 3GJSB 3PM9A 2Z0YA 4ZPBA 2QTWA 2H4YB 2E5LJ 3FQLA 1WI8A 1TL7A 4J9OA 4C6AA 4G6VB 2KG1A 1G3OA 1O0PA 3BS9A 4DMZA 1HBUA 5CYQB 4JI0J 3LALA 3RG6A 1EX8A 4EEYA 3FZ2A 2CQPA 4Q45A 5A8RA 4GKKJ 5KFLA 3CCLS 1WDTA 3BSAA 3BREA 4UUWA 1HNWJ 3KG1A 4LFCJ 4M63A 2HQDA 5ETTA 2GV1A 3GLJA 2WRMA 4ID5B 2PFFB 4MK9A 2CXEA 1FRLA 1P8GA 2FUG9 4URQU 3FC9A 3CJRA 4P75A 5IT9U 3T6BA 1S79A 3TAQA 5IOLA 3JAMY 3HHLB 3MI7X 3DLLS 2UUWA 3EVMA 2Y8WA 2OELA 3UDCA 3JSRA 3VV2B 4P6QA 5BJRA 1JKHA 4LIRA 4HKQA 3VGUA 2C42A 3NXZA 3ILJA 1RTIA 2ZNZA 2HIQA 1J5OA 4A8MP 4DPXA 1H2UX 2HGNA 4F25A 4OI3A 4EWTA 1H2TZ 3H90A 1N6QA 1T9YA 4X62F 4I6AA 3K5PA 4ELVA 5F9NA 3BB5A 3ISND 4RNMA 1VHFA 3UNYA 3FDSA 2VODA 3VVUA 1FNMA 4XDCA 1CS4B 5CD4A 4C8ZA 3SQOP 4FKXA 2YNFA 1NH8A 4RW8B 2HFVA 5F8JA 1HNVB 4JV2A 3SFUA 3D0HE 1HL6A 1FK9B 2EPIA 1VRUA 2K06A 3MUMP 3NCQA 2ZH9A 5C2CA 3KJVA 4F4YA 5BNZA 1UW9A 2CPEA 4H4KC 1QE1B 2HGLA 1GTSA 2AJ1A 3DN9A 2OSQA 1S1XB 2BR0A 4DV4F 4LF2A 4UOHA 4OHVA 2EG1A 2OEKA 4P2XA 4K5RA 2XS5A 3VAFA 3SDEB 1K44A 4OZLA 4IR9A 2D1CA 3J7ZT 1IR0A 1OPIA 3ETMA 2QL5B 4K4TA 3KHRA 2V2QA 4IRKA 3KFWX 2VG5B 4KT0C 2CZ4A 5CH7B 1Y7PA 4EBDA 1VRTA 4KHRA 4G65A 6FDRA 2UU9F 2IA0A 1Q53A 4OHZA 2VICA 2L9NA 3KLEA 4W4MA 3MEGB 1RWKB 1UTAA 5C25A 3K59A 2WVEA 1LKZA 4FBUA 1R3NA 3EXYA 1UJ4A 2DNNA 5D6GA 4OYPA 1VHIA 3EJMA 1B64A 4CQ1A 4ED0A 2HRTA 2AJQA 4OYIA 1XIQA 1K47A 2DNQA 2CZ9A 3AODA 5F3TA 3NCPA 3DRYA 4F3MA 2MKYA 1YBAA 3EMTA 3NGUA 1VDHA 3KJFB 3OLBA 2RDJA 2FY8A 2QA4G 1D0EA 3AQOA 2RD5C 4UW2A 4ILLA 1E6YA 2G9OA 2SXLA 3M8YA 5E3QA 1KKHA 2OPQB 3KUGA 1YIJS 3DLGA 3EVWA 1TK5A 1PGZA 1R0AA 1UWAA 4C0OC 2CQBA 5F0WA 2EC2A 4KC5A 2Q3PA 2DXFA 4ED1A 4DV6F 1FD2A 2XMMA 4P2BA 1F9EB 3HSZA 4J9QA 3OD2A 1U48A 4UF4A 2WAQD 5HJYA 1L3VA 2VQFF 5RUBA 1L3KA 4NXNJ 2RVJA 3M2UB 2VPYB 3DRXA 4GMKA 5DG8A 4PKDB 1DTQB 1R0CB 4H4MB 3ZZUA 3IM9A 1S6QA 4RUAA 2OFHX 4DQIA 2MZJA 4DR1J 3PR5B 2FD2A 3DRPA 1PCAA 4NCGA 5HMXA 2K1RA 3V6DB 1V3SA 4KV8B 2FLLA 2JEJA 1QSSA 5G0RB 4KGMA 4QW8A 1EARA 4FYWB 3UI3A 4TU7A 3EPGA 4ZP6A 3OV7A 2HZ7A 3UDLA 2ZM6J 1FTRA 2HFOA 4DR6J 2ZKUA 4OI0A 5KFGA 1RT7A 3H2VE 3FSXA 5LMNJ 4O0NA 1X4GA 4U96A 3NGSA 2FHJA 2CG8A 4LREA 1HNZJ 2MKSA 5DM6Q 5FJ4A 1JLEA 3MAAB 2IIHA 1Y3JA 2W9CA 2GIRA 1Q8BA 5AXMA 1T03A 2B4VA 2L9DA 4PEOA 3LP2B 1RCXB 1WORA 4CH0S 1FE4A 5HROB 1A7GE 3N5BA 4GKKF 5D15A 4KQZA 3KYLA 1VHYA 1CJKA 3M30A 2HKEA 1HARA 4OLPA 5MLCV 4RZRA 1TK0A 1HNIA 4FVCA 2K3IA 3J7Z5 3MXHP 1SC1B 2VJVA 5B0FA 4TY9A 3LP0B 3J81j 5GAHI 3ILLA 1RT3B 3KUEA 1F5CA 3MEEB 4HACA 1EAYC 3D0IE 2GCFA 1VQ9S 2AEFA 1X60A 4ZHRA 4NEYA 4DN9A 3PNIA 3N79A 5HBMA 2BMBA 3C6UA 5CD4H 2FJXA 4Q44A 5HLFB 2F4VJ 3KLFA 4OYXA 4MK8A 3LGMA 5J1NA 5KT3A 2RRAA 2MJUA 4Q0BB 1NKBA 2V2KA 3NS7B 5AE3A 4URSA 3HD2A 4ED7A 3QJJA 3DU6A 4LF1A 5AE1A 3F73A 1JLGB 2KT5A 1JXVA 3GFYA 2YWHA 2FJEB 3BM7A 1NK4A 3CJKB 2WCXA 3OFGA 4DV0J 3W3SA 3CIZA 2YWWA 4RBUA 3ULHA 3RB0A 2QLXA 5GAGU 3IR6B 2MHNA 1GTEA 4NYPA 2OIHA 4ZS6A 4DI6A 1U1MA 3FBBA 2W9BB 1FEHA 3U27A 3PX6A 4IOAS 1S4EA 4KGZB 8AT1B 4QWEA 1JJ2R 1H98A 4KBIA 3C14B 1O6XA 1HBOA 1YJNS 2I0XA 3I6PA 2J8SA 3SSRA 3MUVP 2GFFA 2JC0A 2BM0A 3BGOP 2VUGA 2V63A 1FFWB 2WB4A 2FIUA 2R9LA 4CO1A 2N3LA 1NJIT 4K50A 5JVGS 2VG7B 5L1IA 2KZZA 2UUBJ 1IBMF 5C42B 4J9NA 1S1TB 1O0BA 4U67Q 4WIIA 3LOUA 5D4OA 4YEAA 2D74B 4WE1A 2Y1RI 1YI2S 3HHDA 3HF5A 2RUSA 2KRBA 1SH3A 2AX1A 2CNKB 2DY1A 2PI5A 4DV3J 4WTOB 1YZ7A 2OMLA 3PACA 3AY0A 4USUA 3DI6A 4OYOA 1OY9A 2DNPA 1LWEA 4OLOA 2YX1A 1WNEA 1VISA 1RU2A 5J1PA 2GQCA 1Y5LB 3CF5Q 1VQPS 4C8MA 2GAEA 2DR7A 1H72C 3AA9A 5LSLA 1EHWA 1BMQB 3FRZA 2JLEA 3I31A 4ITSA 4JXZA 1RTHB 4NLGA 3IR7B 5CAAA 3MM6B 1TL4A 1FHTA 1TKXB 5KT6A 1N0UA 2V94A 2K3KA 1F3FA 3I55S 3UR3C 2EK1A 2IC3B 2L9WA 1U26A 3BBFA 4JI2F 2JVOA 4DSIA 2WB1D 5B0EA 2QFIA 2RMLA 5LT5A 3GQCA 2B51A 2UXCJ 5BYSA 1P1TA 1RUSA 2NUUG 5HSPA 4OYBA 2HIYA 4TN2A 2JEIA 4DUYJ 3CJ8A 3BDPA 1ZM3A 1YJRA 3GIJA 4WFAQ 4K2JA 3I56S 3K5MA 4I6WA 4KRWA 3MOJB 3UCUP 3OTBA 4KHMA 2AW0A 2BEFA 7FDRA 3F0NA 4B3SJ 1ZS6A 2KT3A 3EZ5A 2DGXA 5BR8F 4DL6A 2FLNA 1HHTP 2HHHJ 4B9NA 2FVSA 1DRZA 2YQ0A 4BHQA 4IFVB 1RT1B 5A6PA 2MGZB 3J7A1 2B5JA 3SIPB 4V194 5K8NA 3R2DJ 3M2RA 5K8OA 1NSKL 1HWIA 4LT6A 2G1HA 3KG0A 4FF1A 2H65B 3TRGA 3R5JB 3SV4A 4KH0B 5I42B 2LQ8A 2ZBQA 2XO7A 4S0MA 1N4LA 2IA6A 3D1QA 2V34A 3FCWA 1GMWD 1KLMB 2J0XA 3IM8A 2K8GA 4ZDNA 2QG9B 4R0EA 2RU9A 1C1CA 2PC6A 3P6YC 4HLBA 2CJAA 3MM8B 2F1FA 4RW4B 2V2ZA 2P6SA 4OV1A 2LFVA 3NAIA 1HD1A 3O3LA 3S7RA 2NPIA 1OSDA 2ZHBA 4AXJA 2D9PA 2L08A 4GVBA 1N5SA 2V4JB 3ZTOA 1VGYA 1QTMA 5L8RC 3A8IA 1S59A 3OT9A 4FXVA 4DN0A 1T0TV 3GFZA 2XY7A 1RWUA 4AL5A 2KJWA 1V3RA 4UY8T 3QRRA 5L46A 3DXBA 1QUVA 1PC4A 3DOKB 3OL6A 2EC0A 3GCXP 2IAJB 2CX8A 4I1TA 4F2SA 2XSFA 2KO1A 2QLFB 3R5BA 5C24A 2WHOA 4NCBA 1Q78A 2OLWA 4O3RA 1KR4A 1GXTA 2R7OA 4M5GA 2FGCA 3H25A 1VOMA 4FXWA 4O3QA 2VPXB 1ZJWA 5L38A 1UJ6A 4WFNS 3LWMA 4YHHF 1WKLA 4R8UB 2R7WA 4K59A 4TY8B 2ZZTA 1NMEB 1H0HB 2WK4A 3BEGB 5ETLA 1KN6A 3M32A 4DZ6A 4DR3J 4B9LA 4BLGA 4XK8C 1T7PA 1X31C 3Q23A 3I9V9 3POTB 3AXKA 4RW7A 1SV5B 5DJBA 2UP1A 4LF5J 1RLCL 2CQIA 4K0KJ 2KXNB 5I3UB 4CT8A 1ELOA 2F63A 2BDPA 3PO4A 4U7UK 1MU2B 3IC1A 4IH7A 2MZRA 4DUZF 4I7FA 1NM2A 4ED6A 1RU1A 5IS2A 3QGHA 3W5XA 1NH7A 2RT3A 1YRTA 1PSDA 2J9DE 1BWEA 2UXDF 4U95A 3KK2B 4C8NA 1PJ5A 2GIFA 3ZC4A 1PKUA 4OZ2A 4DPTA 2BXJA 4FKYA 4P2SA 4JI6J 1YK9A 3OTCA 1U2CA 2V5HG 1O0CA 5A0YB 4QIVA 3CULA 1F60B 3B78A 3H40A 2DH8A 2X1FA 2CJXB 2M4MA 4NWBA 3GV5B 3M1VB 2P9CA 4DLEA 2VG6A 3DNCA 1O8BA 4RNOA 4DR5F 1D8YA 4F04B 2DGSA 2MTLA 3MM5B 3PYGA 3M4XA 1NSAA 1KD1T 2E1CA 1RDRA 3G82A 4ZPWR 1SC6A 1TZ0A 2C2NA 1KHWA 3J81U 3R5CA 5HL7Q 2BA9A 2KH9A 3KLGB 1UL3A 5L1KA 2XTJP 1DQ9A 2EBGA 4XAKA 4GKJF 1FWKA 3V6KA 2XNRA 2DR6A 2QA4S 3DRRA 1F5AA 5D0GA 1V3ZA 2NZCA 1SKWA 1A9NB 2OEJA 3ZZPA 3MCMA 4X4VA 3W7BA 3CC2S 4C2MA 3EX7B 1SL1A 2QLJB 4DQRA 4ECYA 1UJ5A 4PG8A 5CA5A 2XNQA 3H0PA 5GMKa 1RCOB 1N48A 4BDPA 4IG3B 3VAMA 3GSIA 2L48A 2GVDA 3NMAA 5GMDA 1CJVA 2BVZA 2YNIA 3R6GB 4DFMA 4Y6IA 1DTTB 4E98A 2VKZG 1MW7A 5J2MB 4X64J 1RWNB 2IHR1 3D6MB 2WVDA 2C2ZB 4O4GB 5L1JA 4QIWD 3BKUA 4ZCKA 1KVKA 2DO0A 4UY85 1LW2B 3H4DA 4I0WA 1Q16B 1SL0A 2GVZA 1X4DA 2QIFA 2MKJA 3A1YG 1S9EB 4RW9B 2YKQA 3TQ1A 2RDDA 3C16A 1QTNB 2ZVIA 1RHQB 2G13A 3ISZA 1SUQA 2M9KA 1KC8T 2N7YA 2QGFB 2IM3A 2QFJA 1NK5A 3D3BJ 4L3KA 2JFDA 3T9NA 3V4MA 2AZ1A 1JQGA 2ZNYA 4ZLNA 1TL7B 2H51B 4B9TA 4WF9Q 1SH0A 2W9AA 4WZMA 3CDUA 2NYHA 3GU0A 1HBUB 5HN0A 3N6LA 3ZZYA 4DX8H 4HH0A 4ECSA 2AGOA 1U2RA 3DLHA 1VQ5S 2R2UA 5A8RB 9ATCB 4TQRA 2BKPA 2CFXA 2MLZA 1N0VC 5ETVA 1WOSA 3D5MA 4OHWA 2C2DA 1L3SA 1NHKL 2FHOB 2MB0B 4ECQA 2MQPA 4ECZA 5CYMA 2Q43A 1JXLA 3MGJA 3H98A 3NGKA 3KTQA 2UVUA 4J9LA 4CDIA 3QGGA 3PJWA 2MZQA 1FWLA 2XSJA 4OX8A 4DL3A 4DG1A 1CSJA 1HQEA 4C97A 3G6YA 4L74A 3FNNA 1BD6A 3CD7A 3I96A 3CEDA 1VQSA 3Q8QB 1N34F 4Y28C 1N52B 2GX8A 1M5OC 2XM3A 4ZOSA 2CZVC 2QEXS 2AYBA 1JKHB 4ZVQB 4MIBA 4Y65A 4LQ9A 4F4XA 3FVYA 2AEJA 2EK6A 1Y5IB 1RTIB 3LH2S 1R6YA 4ED2A 1J5OB 2BJ7A 1VQNS 4C98A 5GMEA 1UPPA 1N6QB 1X0PA 3L4BC 3JAMU 4LR9A 4JI4F 3LP1A 1B75A 3ENWA 3ZNJ1 3EXCX 3UW1A 3IXQA 4ERDA 2ALZA 5KFIA 3E2EA 2V2VA 3DHXA 1XNQJ 3PG9A 4IOCQ 4I56A 2BRLA 3D7SB 3C8YA 3SCKE 5F9LA 2YNFB 1UMJA 4CLKA 4N77A 1WTBA 4C3KA 1OQ6A 2NCKL 3MR6A 2HMIA 1QD1A 3TYTA 1VRUB 2GMLA 4ZLPA 5KFJA 3KJVB 1UFLA 3NEKA 4DV2F 4WBFA 3MPUB 2NSCA 2HBYB 3O2IA 2LKZA 3IA0A 2ZH8A 2GZOA 1T9XA 2FTRA 2HZAA 4LSLA 4UQTA 2NXCA 1JLFA 4BC7A 2RQKA 5AT1B 2F3JA 4U8YA 2E9RX 5DZ7A 4CLLA 2WBRA 2XLKA 2B56A 2R8HA 2QSWA 4DR7J 2E66A 4AQYJ 1VS3A 4I64A 3MR7A 1VRQC 3GPAA 5IT9Y 2HRYA 1QJHA 3VWSA 4PQUA 2P5VA 1F0XA 2Z2LA 3QFHA 3LAKA 4OZ3A 1VRTB 3C2PA 3SXLA 5LSRA 2J6UA 3W61A 4B3RJ 2ZOMA 3KLEB 4N5SA 4WFZA 5DDRC 5C25B 1RAHB 4JI6F 1OY6A 5GAEI 4O4RA 3ISNC 2DRBA 2PIIA 1UVIA 1FKAF 4J91A 1FNXH 3JTPA 3IWLA 3VAGA 4DDFA 4C8YA 1UPMB 1HHSA 2ROPA 2V50A 3BGUA 3KMQA 1HLWA 2V67A 1EB0A 1VYAA 4KO0A 2A2CA 1E6YB 4DV1J 2IJNA 2VQEF 3LA0A 4C0HA 1LK7A 3MR5A 1KP6A 2BABA 3IS9A 4HEA9 1NHVA 4YP3A 2ZD1A 4YR0A 1FJGJ 3DLGB 5ETOA 3MR3A 4N8OA 4ES2A 3W9JA 2I9SA 1R0AB 2CNNB 3GSDA 1JB0C 4PR6A 4CLPA 2Y1IA 2K7KA 2J0WA 2PD1A 1VC0A 2GAGC 1NZ8A 1KQSR 1I94J 1FDNA 2ZH5A 3O44A 2IRUA 1RAJA 5DG9A 1KHVA 2KFZA 4FP9A 1X5SA 2LEBA 1YJUA 2FGOA 2Q1LA 3KJNB 3NWRA 1UFKA 1RI7A 4KY3A 1S6QB 4WP9A 3DRPB 4NCGB 3LANA 4NA2A 4LQ3A 2K1RB 5KOWA 5KFXA 3CCSS 4HHUA 4V19J 4OYMA 2ZHAA 3JSYA 2OKQA 2YBVA 4NLWA 3PXGa 1R43A 2AIRB 1NRKA 3MFIA 3H5UA 3PHEA 3ADAC 1UA0A 1B7FA 1RAOA 2QLBB 4JV5F 3PCOB 4CIOA 1C0UA 4RJVA 3BYRA 2B9XA 1RT7B 4F8RA 4B9MA 2CPYA 2XYPB 1JLEB 1M5HA 5KFPA 2W9CB 4EUVA 2IDEA 2HVDA 2ZJRQ 3NOGA 3LW5C 2XWXA 1ZOTA 2LQBA 4I4BA 4OZNA 3W9IA 1CJKB 1R8AA 4DSJA 3MUTP 4FF2A 1HNIB 1KVJA 1QY7A 1KOHA 2XC9A 3RW7A 4WCEQ 2C2MB 2C1EB 3TVYA 1F2GA 2DGQA 4HACB 2ZZNA 3IP0A 3QJLA 4B3TJ 1Q82T 2FJVA 3MMAB 5GAGW 4ZHRB 8ATCB 2CWKA 1CVJA 5T41A 1YX2A 1RGVA 4MKAA 2BOPA 5M2PA 5HBMB 5E3PA 4OHXA 3R5AA 4F0HA 3C6UB 3EYZA 2IDLA 4DX5A 2HHWA 4OJHA 3KLFB 4WZQA 2IPOB 5T14A 3AH6A 1HA1A 4WP8A 2GQQA 2BJ1A 4DSEA 1RTDA 3CSKA 2L41A 4P71A 3EGZA 2Y8YA 3NKYA 1WJ9A 4HL9A 5KFAA 2IFXA 3CCQS 3T3FA 2VF3A 3U1MA 4KHPF 2G0CA 3TNVA 5K5MA 3K8WA 4A8QA 1G7CB 4Z7CA 1RWXB 3GR0A 4TYBA 1NNDA 1Y10A 1GXLA 3BBBA 1U47A 1WHVA 2HAIA 3D68A 4DR4J 1KQKA 2E5GA 3R1LA 1I3OB 1HBOB 2HWTA 1Q7YT 2A3JA 2Z57B 4DL2A 3FBEA 2Y1LB 3GIMA 4YDXA 3ITHA 4XIUA 1MLAA 2YVSA 1GMWA 1WF0A 1V6ZA 3CCVS 2CVEA 1TKTA 4UUXA 1NDPA 3D6FB 3Q8RB 2E5IA 3HI9A 3C46A 4RUCA 4ED8A 4FS2A 1VC5A 3WX4A 3CJ0A 2PMHA 4KGXB 4QPTA 4WE1B 1QVGR 4LBIA 2AEMA 2LCWA 4EFAC 1NBEB 3DLEA 4BC9A 5LSOA 1B99A 4JI7F 2RKIB 5BXIA 3DI6B 4B3OA 2BYCA 2C3YA 1LWEB 4LF9F 1AROP 3OXLA 2V8DA 2ZH7A 2CA9A 2EW9A 4H3SA 4PWUA 2OPPA 2BE9B 1BWVA 2JWNA 3Q2TC 1SB6A 5B0GA 3JTNA 4J9KA 3PX4A 4C0BA 3VGSA 4ZVEA 4IQXA 3K58A 3G96A 3UFCX 2XMWA 2MQQA 1VQ7S 5DGBA 3QT6A 1VIXA 1X4CA 3UCZP 5J2QA 1LWFB 3FQKA 2DEJA 4J9PA 2VDIA 1YBTA 2XI3A 2AWZA 4ZITA 1YG0A 1EETA 3MTJA 1JJ4A 4PG7A 3D6TB 3M6WA 2J7UA 4B08A 4NLTA 2JLFA 2R8JA 3FRYA 1B0TA 1RT2A 1VHKA 4P72A 3MCSA 1FXDA 1XMQF 1TFWA 2M0GB 4J9SA 2JL9A 2RS2A 4C9DA 3I5CA 1CPZA 2W2PP 3OR2A 2PJJA 3T1AA 2JDJA 2B3TB 2E5JA 1Q0NA 5KT5A 1WEZA 3PRDA 2B5JB 4YR3A 4D3GA 3DOLA 4QPXA 3B8HA 3M2RB 2E1MC 5KFUA 4CO0A 2BJEA 5ETRA 1QLNA 1JJHA 4E2FB 3HJFA 2VH7A 2HQCA 4K4VA 1X9MA 1FJEB 3D0GE 3HM9A 3H20A 4ZCLA 1S7HA 3OVSA 5CZXA 1CQNA 2DB1A 3D1OA 5DQIA 1PJ7A 1C1CB 1FEEA 1Q8KA 3TA1A 2MSTA 3CDBA 3FZBA 5F8IA 3LTOA 4YY3J 1OMSA 4USJC 2CQ3A 2CQ1A 5F8NA 4OX9F 3CCZA 2DGOA 2OTJS 4LF7J 4GVBB 1X5OA 2DEIA 1FRXA 3QRPA 3N01A 4IO9Q 3M8SA 1SKSA 1MROB 3TQEA 5IC6B 1Z4UA 4X65F 3M8PA 1CLFA 2DT9A 2AGPA 1HW8A 4ZVOB 1ZA1B 1JLCA 1U0HA 3MHYA 4G1IA 5IQQA 1N36J 2E9TA 1RHKB 4LF8J 1N88A 3HKZD 5J1EA 2HHTA 4WFBS 2HLUA 3G6XA 2AJ4A 2UUAJ 2D3O1 2FHMA 2ABYA 4AL6A 4PZVA 3UPFA 4NRUA 3MDFA 1NKEA 3QJPA 4JI5J 3NCRA 5IM0A 3N9UC 2RQMA 2C22A 4V19X 1YBUA 3PIOS 4RW7B 4LFAJ 2ASYA 1ZH5A 4ZVGA 2BQ3A 1FEUA 4IYQA 3MECA 4KB7A 1EUYA 5DM7S 4BCAA 2QL7B 2GO8A 4USIA 2XMUA 3DMJB 3CXCR 1FE0A 2B4OA 4I7FB 2KG0A 5K8PA 2CDRB 1JX4A 5KFHA 3R6LB 1HBMA 1S97A 1NLKL 2G2OA 3OFHA 1M5VC 1SQGA 3OTDA 3BO4A 2YKPA 1NB2A 3FK4A 3KKFA 3HULA 4ECVA 2BJ3A 3MTKA 2MYFA 2KXFA 4MMOA 1G6BA 4CLUA 3QGIA 3H4BA 5IZHA 1YSJA 3JSMA 1P27B 2ZBCA 2VBZA 1F3VA 3CDWA 4DR4F 3CO0P 2UV8A 2VG6B 1UKUA 2Q79A 1XMOF 3W2WA 1AT1B 2WVFA 3CJ3A 3K89A 3ILOA 4OMFG 1HW9A 1FF2A 4LBPA 2UXBF 2ZFHA 4IR1A 4CH7A 1U1PA 3TANA 5HJXA 2FJWA 1NXZA 4OJ3A 3G82B 4DU8A 2CUYA 2ZJPQ 4JYAJ 5JVHS 1IJFB 3J80U 1S6UA 2JOQA 2LU1A 5C2GA 2V69A 2DNOA 4RW6A 3NRBA 1IBKJ 2DGUA 3J7YI 1BGXT 5ITHA 4A47A 1EQ0A 3PKMA 1KRPA 2NXEA 4LF4J 1YTYA 3BN7A 2AQ4A 3WZ0A 3CT9A 1CJTA 2ZKTA 2C28A 1UWBB 2N82B 4LFBJ 1K0VA 1QM9A 2MHEA 3VTIA 3I4PA 4NASA 2GMJA 3DC2A 3HSGA 2VJUA 2GVDB 2EWHA 2VHGA 4OI1A 3OJSA 2E1PA 1RAIB 2C3UA 4NLPA 4FYXB 1YVFA 1CJVB 2XI2A 4QWCA 1OYEA 4AE5A 3PEHA 3MEDA 1MG7A 2HNDA 4U6PA 1KOOA 4RWWA 2ZJQQ 1WWHA 3TZXA 3W65A 4IKAA 5HQLA 4ZPCA 4ZVSB 1DY3A 1UZHA 3OJUA 3AOBA 1J5EJ 2IRYA 4LMZA 4ECWA 1J27A 2OI2A 3MMCA 2IBOA 3HVAA 4USTA 2I2YA 2RRBA 1RT5B 2PE8A 1TQLA 1YRXA 4DCPB 3DDIA 3GG1A 1SUQB 5B0CA 5ETKA 4IG0A 1VLYA 1JWWA 4RUHA 1ZETA 5G4DA 2ZH6A 2IJRA 1S4FA 3TWZA 1O51A 3GG0A 1QVFR 2CADA 2W4PA 3Q8PB 5HVGA 5D8HB 3HLUA 5I4MA 3TA0A 1OWXA 1X7VA 1FERA 4WKRA 5KFTA 3R1HA 4USVA 3M2VA 3JB9k 2I38A 3NP5A 1YLXA 1PYSB 4DFJA 1LV5A 3G8SA 2W4DA 4H4KA 3THVA 2MSSA 5KFQA 3R8YA 4X4RA 2FVCA 1VJQA 3O8WA 1D3WA 5DRKA 3MPDA 2A6MA 4RX6A 1NDKA 4RBVA 4TU8A 5J2NB 2W7AA 5FD1A 5CYMB 2EGVA 3PW2A 1GEHA 3IAM9 1F5BA 2XULA 3R7BB 2QMWA 3CW2C 4RPFA 2RSQA 4W98A 5LMUF 4EYHB 3NBPA 3P8BB 4M5KA 2J0QD 4HHHA 2XSJB 1KFSA 3DDNA 3PFEA 3FSIA 3GCWP 4DG1B 4K4YA 3AFGA 3PRVA 1NK7A 4ID5A 4B9SA 1R7IA 3ZTSA 2UUTA 1NSPA 3LPEA 3C6TA 3GYXB 1IUJA 4KGVB 2DVIA 2B9WA 1PBAA 1K73T 4MIWA 2DCLA 4DX7A 2LXIA 3AAWB 1EZZB 3NGRA 1VQ6S 2PI4A 3IGNA 5CABA 2COLA 3I32A 4LVNP 1R89A 2P8IA 1UP1A 1R8BA 1FJCA 2DRDA 2XZTB 3FBFA 2DYAA 1IKYB 3RR8A 5KFFA 3LP1B 1XTZA 2GNKA 3I5BA 3IRXA 1LWCA 2UVRA 2H5EA 2DNMA 5KTQA 3DM2A 3IWXA 1YZ6A 2E7XA 1TP7A 2VA2A 1N36F 1OYDA 1I5OB 3LUYA 3I4HX 4V1Ak 2ZEJA 1P1LA 4QIGA 2OO4A 4UOCA 1VBZA 2RAQA 2H1YA 3DFEA 2FVQA 3G87A 1RJJA 2AJ0A 2KVQE 1FNOA 4AT1B 1YDLA 4PXDA 4QYRA 2HNZA 1WC1A 4ZLLA 4X66J 4LSLB 4DSKA 1QAJA 1JLFB 3EZUA 2IBKA 3KUHA 1S9GA 1U1LA 2XWYA 2I5JA 2KM8C 4BBYA 3GJTB 4PQUB 1RYSA 5DQHA 3CDEA 4TLRA 3R3TA 4JI3F 3PFOA 2V9WA 1ZA2B 1M5PC 2WBMA 3M9NB 4RL1A 1LWXA 4IUFA 3FCHA 1NPPA 1WF2A 3I5AA 3ENAA 4C8OA 1QRTA 4O3SA 4PWWA 1JJCB 1X9SA 1NK9A 1NJXA 2LQ5A 2D7SA 4JV0A 2Y9HA 2XQCA 1Z85A 2WTFA 4PG6A 5EGYA 4NXMF 5EUHA 3V81A 1HI8A 2BW2A 3G4SS 1S10A 1HR0F 3SZ2A 4NOHA 3HVTB 4UOGA 3T1YF 2J7KA 4LF6F 1RK8A 5A8KB 3IAS9
chains in the Genus database with same CATH topology
3DU5A 4X4UA 4DFMA 3I0SB 4Y6IA 3VAJA 2XMKA 1KLNA 5HI7A 4KO0B 1DTTB 4X84A 1T03B 4WFXA 4E98A 1U1KA 3QLHA 2VPZB 4OIXA 4IFVA 2VKZG 1RT1A 3DRSB 3NNAA 2QA2A 1D9AA 3QIPA 3HKWA 1MW7A 2YKNB 2F8HA 4YOEA 2HNYA 5J2MB 2OJ3A 2BANA 2IHR1 2NPFA 3IS9B 3GIIA 3PIPS 4EGLA 4RKUC 2OPRA 3DDKA 1SJQA 4O4GB 2ZD1B 3KLIB 1QSLA 3TW0A 5L1JA 3RAQA 5HQ8A 1LFPA 3MD1A 1BLUA 4QIWD 5KFMA 2KYZA 2O1PA 3M30B 3E3XA 2DPIA 4ZCKA 4UY85 2DO0A 1LW2B 2VASA 2KB2A 4I0WA 3WC0A 3H4DA 1Q16B 1SL0A 1RT6B 3CCMS 2OPQA 4M8LA 5I42A 1NK8A 1X4DA 2QIFA 2MKJA 3A1YG 1S9EB 4RW9B 4F3QA 5CCLA 4Y0FA 2YKQA 4DR2F 2LXFA 3TQ1A 2J9DA 5AE2A 5E41A 4XPEA 2BRKA 2RKIA 1C4CA 2IYIA 3QAUA 3TA2A 4PG4A 1HQUB 2ACYA 2G13A 3OR1A 3ISZA 3PVXA 1SUQA 2M9KA 4JBCA 2FPHX 1Y5NB 5F41A 1M0SA 1KC8T 2N7YA 2PMZD 1KS2A 2IM3A 2QFJA 1QAXA 4NA3A 1NK5A 1XR6A 2WSFC 1S72S 1SQEA 3Q24A 1KLMA 3MMBA 2KI2A 4QJVA 4ATNA 4O3NA 2JFDA 2YKOA 3T9NA 1S99A 1Q86T 2KRRA 1XERA 1XR5A 2O5DA 2CQ0A 1AW0A 4LJMA 3V4MA 2EBEA 2W24A 2CG4A 5SZTA 2CIMA 2UV8G 3N4WA 2Z0GA 2ZNYA 2XB2D 3MAHA 4G1QA 4C8KA 2EFOA 4B9TA 1SH0A 4WF9Q 1X4AA 3SQGA 2XGPA 1SIWB 1WI6A 2AYMA 3G8QA 2W9AA 3MM8A 3I87A 2YQ3A 2G1DA 4RW4A 2FVPA 2VFUA 4WZMA 1SBRA 4NYOA 3S8SA 3CDUA 3GMGA 1E6VB 1HBUB 5HN0A 3N6LA 2EFQA 3ZZYA 3QO9A 4DX8H 4HH0A 3PY8A 3S01A 3SEOA 4ECSA 4FNHA 2AGOA 5E7OB 1U2RA 1L3UA 2CJQA 3DLHA 1VQ5S 5E33A 3BJYA 1LWFA 2R2UA 3M8PB 4MJKA 4HYKA 5A2QY 4X4SA 2OMOA 2AJFE 4DBQA 5A8RB 3AB2B 4ECRA 3CUNA 2DBBA 1C4AA 1X5PA 4PWDB 3UNGC 3KHGA 4TQRA 2C3PA 4ECTA 3CCWA 1P6TA 2CFXA 4ETZA 1N0VC 2K7JA 4XO0A 3D5MA 4OHWA 3TI0A 2C2DA 3DXSX 4YB5A 2DTJA 3OTOF 1L3SA 2E9ZA 3RB3A 2V0NA 2NSBA 4AL7A 4LSNA 3BR8A 1M5SA 4OZ1A 2V4QA 2FHOB 2ZH1A 2MB0B 2A2DA 4ECQA 1VIOA 3NS6A 2MQPA 2AU0A 4X2BA 4ECZA 5CYMA 2Q43A 3ZZTA 1DFUP 3M6XA 3OXGA 1JXLA 3DOKA 4WFNQ 4P7VA 3MGJA 3PO5A 2IAJA 1QUPA 3QMQA 3S1TA 2XG8A 3V6DA 1ZM4A 3H98A 3OPKA 3NGKA 1S6OA 3L7PA 2RUGA 2ZBIA 3KTQA 2VB6A 4IOBA 4IH6A 2UVUA 5K9FA 2HVHA 4J9LA 3QGGA 5DO2A 4RU9A 2HRUA 3PJWA 2MZQA 4QQBA 1JIHA 3OUYB 2XSJA 4OX8A 2CPIA 4DL3A 4NLVA 1OPZA 4DOZA 4DV7F 5C5JA 1C0UB 1D8ZA 4IFYA 2CPDA 3HXMA 1CSJA 1HQEA 1WTFA 2I1RA 4QR0A 2LYVA 4C97A 4DG1A 4O0IA 3G6YA 1XNQF 2VONA 3FNNA 5KFCA 1T02A 1BD6A 1N5QA 2IMOA 3CD7A 3I96A 3VCDA 4YB1P 3CEDA 1VQSA 3HHLC 4R8UA 3Q8QB 3KK1B 4ECXA 3TAMA 1N34F 4TY8A 4Y28C 1N52B 2A18A 4N47A 3F44A 2GX8A 1EP4A 1M5OC 3DLKB 3QIDA 3RU0A 1DBDA 4NCAA 4I2QB 4KTQA 1HMVA 2ATLA 1UVKA 4ZOSA 2CZVC 1Z2ZA 2QEXS 2LMIA 2AYBA 1S6PA 1JKHB 1HWKA 2RQCA 3UCGA 2H9ZA 4MIBA 2J6TA 1KQGB 3THTA 2P9GA 4Y65A 3G6ES 3SYZA 2CQGA 4LQ9A 3POTA 4F4XA 1FRHA 3FVYA 3SI8A 2EK6A 1Y5IB 1RTIB 3LH2S 5L9NA 1R6YA 1MMLA 1SV5A 4A8XA 5KOXA 4ED2A 4ZVFA 3C3LA 1J5OB 2M5YA 2MQOA 2WSEC 2RJZA 2GW8A 1VQNS 3NNCA 1DLOB 4EO8A 2CJKA 4C98A 4QWDA 4YQWA 5JXSA 2WONA 4OZ0A 3QZ8A 2R8GA 5I3UA 4B3MF 3TVKA 2Z4PA 5F3ZA 3G71S 2F8EX 1N6QB 4HDHA 3RRKA 1X0PA 1VMBA 2AV5A 3HFKA 5I3PA 2IRXA 1T94A 4PPDA 1MU2A 2ZJRS 3LP2A 4JI4F 3K57A 3LP1A 5ADZA 1HFEL 1B75A 3ENWA 4ZP7A 2QV6A 4K4UA 2CJ9A 3H2LA 2ASLA 3EXCX 2M88A 3U02A 3UW1A 2GC8A 3IXQA 2NZ4A 4ERDA 5L1LA 2ALZA 5KFIA 3E2EA 1K9MT 3DHXA 2M70A 1FKPB 2R8IA 1FKOB 5B0DA 4DHVA 1SJ3P 4DR7F 4AQYF 7FD1A 1HI1A 2DK2A 3TOQA 3HK2A 3OBIA 3I9ZA 4IOCQ 2ROGA 3VR1A 4I56A 2V8GA 4YUDA 2BRLA 5KG7A 3C8YA 3SCKE 3KK2A 5F9LA 3LGNA 4F67A 1J2VA 2CJBA 2YNFB 3LF0A 1FVSA 1UMJA 4G3IA 1HD0A 4I2PB 3E01B 1JK9B 2B6AA 3UWTA 3BSNA 2IJFA 2FY1A 1XEZA 2DO4A 1IN0A 3GILA 1QRSA 3VQTA 1TV6B 4N77A 5EX0A 3P96A 2IMWP 3W2VA 1WTBA 2D3UA 4C3KA 1OQ6A 3J81Y 4WCES 3CPWR 2ZOFA 1UFWA 4B3RF 1ZZNA 3MR6A 2HMIA 3JYTB 1SXLA 1X4HA 3TYTA 1VRUB 2GMLA 4ZLPA 4UY88 5KFJA 3KJVB 1U4BA 4PUOA 1UFLA 3A8EA 1FESA 5A0YA 1FT8A 2OPSA 3N6MA 3M9MB 4DV2F 1JLBA 3CD5A 3K2YA 3Q8SB 2JEFA 3OHBA 4Q8EA 2NSCA 1BQMB 1RTJB 5KFEA 3O2IA 2LKZA 2W7PA 3IA0A 3HX9A 4YFUA 3PX0A 2QA1A 1HYSB 3T1HF 3TUZC 3BO2A 3RBEA 2ZH8A 1G2EA 4NPOA 3BGRB 1RTDB 3M1VA 2FTRA 2ZOGA 4C11A 2VBWA 2YNHA 4LSLA 4UQTA 5KT4A 4DV5F 1DHMA 3U1LA 3M8RA 3RB6A 1TVRB 1JLFA 2WW8A 4D3HA 2J9EA 2JH3A 1MROA 1REVA 4BC7A 2RQKA 2XEXA 2F3JA 1QAYA 4WFBQ 2E9RX 4Q0BA 3FFIB 3U7JA 2KM8B 4RWXA 4WK1A 4X4PA 2WBRA 2XLKA 2B56A 4N76A 2ZH4A 3TVZA 2MZSA 2R8HA 3RZAA 2NUHA 2XGQA 5B09A 3LQVA 2HVIA 1FO1A 1FVQA 2QSWA 4HVZA 2FLPA 4OJ1A 2E66A 1VS3A 4I64A 4LVOP 2C3OA 1TKZA 5IT9Y 4F02A 4FZVA 2J76E 2HRYA 2NQPA 1N5TA 1QJHA 2CQDA 1OO0B 3GWCA 5EHHA 3G86A 3VWSA 1YJ9S 4PQUA 3QYYA 4W90B 1JLAA 2P5VA 1ZM9A 3KLGA 2UVVA 2ZC4A 1F0XA 2Z2LA 3LAKA 2M52A 3C2PA 1VRTB 1SJ1A 2HZCA 3SXLA 5LSRA 1JMTA 3CC4S 4Q8FA 3ZZ0A 2VOOA 3DYAA 2J6UA 3O5TB 4DV1F 2NREA 2XS7A 1U2FA 4RLEA 1BQNA 2ZOMA 3MPVA 3KLEB 4ILMA 4NLSA 1OSCA 4WU2A 4N5SA 4WFZA 3MWBA 4ICLA 5GAEW 5DDRC 5J2PA 1FJGF 2KN4A 5C25B 4HHJA 4IDKA 4R25A 4K4SA 2N4DA 3HHEA 3IRWP 2XCAA 2HWIA 4JI6F 3WDOA 4B02A 1X9WA 1IKXA 2UZAA 2P9EA 4CI0B 1C0TA 4JV1A 1VK3A 4MKBA 4FS1A 2HHVA 5GAEI 3CCRS 3S6EA 1N5YB 4O4RA 3ISNC 1KVIA 2OD4A 2BE2B 5FIIA 3GIKA 2DRBA 2VV5A 2OP5A 5AXKA 2PIIA 1PC5A 4L6V3 2Z2MA 1D9FA 1B0PA 4A46A 2VFTA 4IG3A 1ULRA 3MEDB 3HDSA 1FKAF 2JEGA 1UVIA 4Q5VA 1M90T 1I94F 4M5DA 3MEKA 1TKTB 2CPFA 3OL8A 1JXEA 4WKYA 3T19A 4OZ5A 1FNXH 2OD6A 3RBDA 5IWAF 4WFAS 3JTPA 3IWLA 3VAGA 1NJZA 4MFBB 4A8SA 4DDFA 2FVRA 4C8YA 4X66F 2PA3A 1HHSA 3PIPQ 4PRFA 1FXLA 5B0AA 2ROPA 5DDOC 1GAOA 4ZA1A 3RTVA 5B08A 3DMJA 2HPUA 4CH1A 2D9OA 2ZH3A 2RIJA 1HWJA 2J5AA 3T5LA 2APOA 4FNIA 3HMJG 3BGUA 5KFZA 4ED3A 2E5LF 3KMQA 1ZPVA 1MSWD 1FCAA 2XBPA 2MDAA 3V2UC 4ZPAA 3I0SA 4KR0B 3CE8A 4L72B 2N3OA 2YWKA 1RA7A 4KO0A 2R2RA 4K4WA 3H5YA 1DTTA 3DGPA 4L3NA 2Z8QA 2ZHOA 1EXDA 2A2CA 1E6YB 1UVJA 3DRSA 4O3OA 2IJNA 3PEJA 3J7ZV 2NXUA 1RKJA 2VQEF 3C66A 2YKNA 5J2MA 1NO8A 4C0HA 4TLQA 1LK7A 3MR5A 1V6HA 2JSXA 3OSNA 2HHSA 2BABA 1GX6A 1TL1B 3KK3B 2HQIA 3IS9A 3DLEB 4HEA9 4KKOB 4JI0F 5BYRA 2GHPA 2CPHA 1NHVA 2HS4A 4ZK7M 4KPYA 2IVMA 1WHWA 4O4GA 4YP3A 2ZD1A 3KLIA 1WHYA 4YR0A 3JSBA 3DLGB 2CPXA 3O1LA 4B3OB 1GT8A 1R8PA 5EWEA 4EZ6A 3MR3A 4N8OA 5KG6A 2UUCF 3M8QB 4ES2A 3MFHA 4O3PA 3OL9A 1LW2A 1GQEA 1Q1KA 5SUHA 2I9SA 1R0AB 5K14B 2PGCA 5IQ6A 4USHA 2OPPB 1RT6A 1JB0C 3GSDA 4PR6A 2Y1IA 1S9EA 4OI4A 3H59A 3B4DA 5AXNA 1XMBA 2K7KA 4NMLA 2J0WA 4NLOA 1HQUA 2PD1A 3OQ2A 3TUIC 1VC0A 1HNWF 1Z1ZA 1FRMA 4A48A 3EPIA 4LFCF 1H7XA 2FJAB 1YJWS 1GH8A 1S49A 2F9JA 1KQSR 2X1GA 1XC9A 3G6VA 2BZ2A 1FDNA 4JOUA 1O5JA 5E5NA 4F2RA 2ZH5A 3AQPA 1TAUA 1S0NA 3PM9A 5KFWA 3O44A 2IRUA 4ZPBA 3QGPA 1RAJA 3NNHA 5DG9A 1VQ8S 3D54A 4WJBA 1S48A 1KONA 1WELA 1KHVA 2KFZA 4FP9A 1X5SA 2JC1A 3M6VA 1U49A 3FQLA 1WI8A 4LUBA 4J9OA 5KFKA 4G6VB 2KG1A 3RRGA 5J2QB 1G3OA 4ELUA 3IWNC 1O0PA 2QLWA 2LEBA 1YJUA 2FGOA 2Q1LA 1NK0A 1ZYQA 3BS9A 3GV7B 4DMZA 1E6VA 1EETB 2JZ5A 1HBUA 5LJ5Y 5LXRA 3MM6A 1U09A 1Y00A 1RI7A 4ZKAA 2U2FA 5CYQB 1S6QB 4NLRA 3LALA 1HBNB 1XK8A 4EEYA 3FZ2A 1RKIA 4NLQA 1XNRF 2CQPA 5A8WB 4Q45A 5A8RA 3VAIA 1DZ5A 2LA4A 3DRPB 3RRHA 3V4IB 5KFLA 4NCGB 2LLZA 3LANA 5KT7A 3K0JA 3PR4A 4NA2A 2RB7A 1X4FA 3CCLS 2YH1A 4LQ3A 1WEXA 2K1RB 5KOWA 5KFXA 1QRUA 3CCSS 3KWMA 3BSAA 1AXQA 3BREA 1RT2B 5C24B 4V19J 4WYLA 3MM9B 4W92B 4KFBB 2ZHAA 4EBEA 3JSYA 1YWXA 4UUWA 3AB4B 2OKQA 3D1HA 4NLWA 3KG1A 4JI8F 2XMJA 3PXGa 1R43A 1AFIA 2LVWA 1NRKA 4M63A 3MFIA 3H5UA 3UR0A 1X4BA 4ZP9A 3PHEA 1H2VZ 1UA0A 3BQ1A 1B7FA 2GV1A 1S1VB 1UWBA 4DL7A 2P6TA 1YGYA 4NRTA 4Y2CA 1VC6A 4JV5F 1NYLA 2RDIA 2WRMA 2ADBA 4ID5B 1N5VA 2HG4A 3OR2B 4MK9A 4F26A 2PFFB 3PW7A 2LU2A 4B9VA 1FRLA 1P8GA 2AYEA 2FUG9 4URQU 5F8GA 3OUYA 1LFWA 1X4EA 3KOAA 5HMWA 2O67A 4CIOA 2MY7A 3T6BA 1C0UA 1S79A 3MD3A 3G8TA 2B9XA 1RT7B 2V8HA 3M32B 3TAQA 1YRUA 2RNEA 3JAMY 3BR9A 3HHLB 2QYCA 3MI7X 2DIVA 1JLQB 4B9MA 4F8RA 3DLLS 2UUWA 4B3TF 4OFZA 4E8UA 4M94A 3IG1B 2CPYA 3NL0A 2KZMA 1JLEB 4HI1A 2OSRA 1M5HA 3DLJA 5KFPA 3UDCA 1DQAA 3DLKA 3DOLB 2W9CB 4EUVA 4ECUA 5EWGA 3JSRA 2YWEA 4RBTA 3PKYA 1RT4B 4P6QA 2ZJRQ 2L3MA 5BJRA 1JKHA 4LIRA 3R5DA 4HKQA 3H5XA 1PO6A 1DARA 1LXJA 2C42A 2RILA 3CJ4A 3T9ZA 2MGZA 4E0DA 1RTIA 2ZNZA 2HIQA 1ZM2A 5KT2A 3CTRA 1J5OA 3EGWB 3LW5C 4A8MP 5KG3A 2XWXA 1ZOTA 2LQBA 1DLOA 4I4BA 1H2UX 1G1XA 2HGNA 4OZNA 2EFVA 5DM6S 4URGA 4F25A 4OI3A 2VOPA 4EWTA 1NB7A 1H2TZ 2XY6A 1N6QA 3HPOA 1R8AA 3FMBA 4X62F 1UETA 4I6AA 4DSJA 3MUTP 3K5PA 2KXHA 3UQSA 4FF2A 1SJRA 1PILA 1HNIB 1U45A 4QWBA 4RNHA 1RT5A 1KVJA 2DISA 1QY7A 4ELVA 3LO3A