3X1LB

Crystal structure of the crispr-cas rna silencing cmr complex bound to a target analog
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
319
Chain Sequence
MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLSREKKVVEEGMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna/dna
molecule keywords CRISPR system Cmr subunit Cmr2
publication title Crystal Structure of the CRISPR-Cas RNA Silencing Cmr Complex Bound to a Target Analog
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
total genus 64
structure length 319
sequence length 322
ec nomenclature
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3x1lB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3x1lB03
3X1LB 4H4KA 3W2WB 3W2VB
chains in the Genus database with same CATH superfamily
2C2OB 5A8KB 1FX2A 1RT6A 4OZ1A 4R5PB 3IWXA 3ENQA 2ZH7A 1XN9A 1NRKA 3CDAA 2UXCF 3KLEB 5M2PA 2B0GA 3MFHA 1MWZA 5A2QU 2VPXB 5KFLA 5J1PA 2NPFA 4NLVA 4KHRA 4LRDA 3KHRA 2PMHA 4OV6A 4KBIA 2OPSA 1Q4RA 4OYBA 2HFUA 5HJYA 2PEHA 4G1QB 1ZA2B 2ALZA 3TAMA 1TKZA 3LO3A 2ERRA 1Q7YT 5C24B 2EPIA 3D0GE 4MKAA 4DQIA 3G6VA 4K5SA 2AJQA 4U7UD 3GYGA 3BYPA 1EQ0A 1JXEA 2PI8A 4WIQA 1RYSA 2ZNYA 1QLNA 2WTFA 4TVAB 4ECVA 2VHGA 1XR7A 5FLXY 2DO4A 1RKIA 5K14B 2B7BB 4BDPA 1S0MA 2R7XA 2QL5B 3HVWA 2YY3A 3DMJB 4X4TA 4XIUA 2L9NA 1R8AA 6AT1B 3H0PA 2HLUA 1KWMA 4QWEA 5HK4A 3H4DA 1M5KC 1FRXA 1WACA 3NY0A 3HX9A 2NZ4A 1U8WA 4D3GA 5HO4A 4ZVSB 3QO9B 3BSAA 1AA1B 5B09A 2OSRA 4H4OA 2M7SA 5BR8J 4USWA 1IKYA 4KV8A 1G6BA 3CNQP 4FPIA 3HVTA 3PX4A 1B64A 3L95X 1HMVA 2HPUA 2V8DA 1Q86T 3OLBA 1U2CA 4FF3A 4C8LA 2MYFA 2M70A 1CBKA 4ZP8A 5ADZA 5I3QA 3OHAA 4G1PA 1A9NB 2DK2A 3CTRA 1UFLA 1HD0A 2Y1IA 2CPEA 4I6WA 1RT4B 1KN6A 1TFWA 2K3IA 4U7CA 4NPOA 3AFGA 1IBLF 5A6PA 1M5HA 1ZAVA 1FWKA 3M30A 4MFBB 3RAMA 1R8BA 2MZJA 3RBZA 3HFVA 2OI2A 4RWWA 2H4WB 5KFOA 3DRSB 2QYCA 2J5AA 5CYJA 1GXTA 4A8QA 3W63A 4CYUA 1JXLA 2Q1LA 1HNXJ 1YBAA 3R7NB 2X1BA 3PTWA 4TU9A 4C8YA 4DFJA 3TUIC 2RQ4A 2J8AA 2VG6B 3ZZTA 1UCNA 2XCPA 2YNFB 2R8GA 3KYLA 4J9SA 3F44A 1EARA 1X4HA 2B9WA 4FP9A 1IKWB 4CLUA 4KKOA 2ACMA 4P2MA 1YX2A 2CQ4A 1HKAA 4RW8A 4RZRA 4BWJA 2OMOA 1LWFB 3BV8A 2YKMB 4B3RF 4DR5J 2VG5B 5KFBA 2HBRB 2NUUG 3A3PB 1CJUB 2YNGA 3D2WA 3NOCA 4NYOA 4RKUC 3LPYA 5LSRA 5J2NB 3JQMA 1S9GB 3Q83A 5BJRA 5L38A 5F8JA 4Y2AA 3RRKA 2RS2A 3MHYA 2D7SA 5AE1A 3LP1A 1R8PA 2ZZMA 2DR9A 1S1WB 1NHUA 2KYXA 2E7VA 2DCUB 3DOKB 3TARA 3BR9A 2LMIA 3K5OA 3GIMA 2F5GA 4I56A 1S1UB 3FDSA 1ZETA 3BBCA 3DHXA 3KK3A 4IO1A 4HLBA 1QSSA 5IS2A 2AU0A 2RAQA 1D0EA 3PCOB 1NSPA 1DZ5A 2BKOA 4A8XA 1KVIA 1IR0A 3W61A 4TYAA 1CULA 2R7SA 1YJVA 5KOXA 3W2WA 2N82B 2DR8A 4Z7YA 1RU1A 5K9FA 3NKYA 3QJPA 2WONB 4M5IA 3ZO7A 1N88A 4DV0F 3UO0A 1O6XA 4RW6B 2EI5A 1HBNB 4FYWB 3DCAA 3R2CJ 2F4FA 4F4KA 1HBOB 1KOHA 5MAOA 2V4QA 3EGZA 1JLBB 2QSWA 3P4UB 1RISA 1T3NA 3ZC4A 3MM5A 3I5BA 4BHQA 1WWHA 4KRWA 2DPJA 1RT1B 3S1TA 4ZP9A 2ZJQQ 4I2QA 5T7LB 1VC0A 3FBEA 1UL3A 3EVWA 5J1EA 3V6DA 4PPZA 2K2PA 4BC9A 4HDGA 4RJVA 2WB4A 3KG1A 3LP0A 1RHUB 2GVZB 1NSQA 4DUYF 1K8AT 3OFHA 1U1PA 2AYBA 2D3ZA 1QRUA 1HLWA 3MAHA 2WCXA 1JXVA 4PZVA 4O44A 1C1BB 3THVA 5H9FJ 2C28A 5CHCB 3NCQA 3O1LA 4Q44A 1D3WA 2CQ1A 4FBUA 3A12A 2DD8S 1RWNB 2HNYA 3G2XA 2ZWPA 3BKFA 1HNXF 2DNYA 4TYBA 4P2XA 2V9WA 1HBUB 3QLHB 2W9BB 5BYQA 4KFBA 2MQPA 1FEEA 5U47A 4WP9A 3PJWA 1CQMA 4YB1P 2LVWA 1YGYA 1UJ4A 4ZHRB 1NJZA 1PYSB 4KGKA 3NXZA 3R6GB 4Y2CA 1HQ2A 4C8ZA 4LSNA 1Y5NB 4IR1A 2F8MA 3I82A 2XSJB 5K20B 2JEJA 4YB6A 1VRTB 1FFGB 1UVLA 5KFTA 4KGZB 4DR5F 3PYGA 3HO1A 5LSLA 2HK2A 4X4NA 1RJJA 1IQZA 1FEUA 3MAAB 1AROP 3RRGA 4QBUA 5K8NA 1YTYA 2YKQA 3KDOA 4IRDA 2MQMA 1J5EF 1Q8LA 3QGPA 2CJAA 3HT0A 3ENAA 1R3NA 3C46A 2MLZA 3LPEA 4YS2A 4RR5A 1NH7A 3KK2B 4ED5A 4ECSA 1UVMA 5GADU 2IM0A 4OHYA 2JH3A 4RW7A 1HWUA 2WBRA 4DS5A 3EZUA 1OSCA 3NP5A 5HN0A 3MR5A 5HLFB 3M8YA 3L09A 3ELHA 2M3DA 3EJMA 4XAKA 4DI6A 3QMQA 4NX9A 4K5RA 5D0RA 1DTTA 3ZZPA 2HQDA 2ZDPA 1S1XB 3RR8A 1B75A 1BUXA 5B0FA 4M5DB 2V4JA 1RA7A 1BQMB 2MY7A 2XC9A 3I56S 4GRSA 3PRDA 1A7GE 4C11A 2RDIA 3ADAC 1S6OA 4C0HA 5I4MA 4F3QA 1QTQA 2BM1A 3MMAA 3V5RA 1NJXA 2HNZB 1IM4A 1RTDB 1O0CA 3ENWA 2BBEA 4H54A 1JJ2R 3J7ZV 2ACYA 4DL0C 4JXZA 5HQMA 1T94A 3VTIA 5CCMA 1JMTA 2F4VJ 4AUKA 2H48B 3VAFA 3CXCR 3MEGB 4LBPA 2MHNA 1B0TA 1WHXA 3PY8A 5F8HA 1RT2B 1FKOB 3TUPA 4KT0C 4OI0A 1S1VB 3TVYA 7FDRA 4CO4A 3P96A 3N6NA 3TW0A 1HW8A 4NL5A 3R1LA 2C3YA 3SFGA 1DARA 2Y1JA 4FNIA 4DL4A 1J27A 3WZ0A 2AGOA 3ZZRA 5AJ3F 3HDSA 4MKVA 4NYZA 2BUNA 3OL9A 2L9WA 1S4FA 4FXWA 2FJEB 3HULA 2B8QA 3MM9A 2JJ4D 3M2RB 2E5LJ 2Y0SD 1S49A 5HP1B 2EGVA 4AQYF 2GCFA 1U2RA 1TR0A 2AMCB 4LF4F 1WHWA 2GHWA 2HMIB 5D6GA 1XNQJ 2E9ZA 4PEOA 2KXFA 8RUCA 3G6XA 4KHPJ 4ECTA 2GMJA 2GGPB 3OW2R 4X65F 4U96A 2XHWA 1ZJWA 4ZP6A 3EE3A 2HS0A 2RKIA 2FHMA 3MECA 4FPRA 1WEYA 3DLEA 2PI4A 2WOMB 1SV5A 2XMWA 3IWNC 3N6MA 3J81Y 2UUAF 5KG1A 5FJ4A 3P49B 1C1CB 3EWGA 1D8ZA 2ILZA 4N47A 2GJIA 4OZ2A 2KB2A 3J7AN 1UA0A 1GXLA 2PDAA 2MZRA 2IAJA 1U1LA 3OXGA 5IFMA 2OTJS 3QJJA 8AT1B 2OGUA 1T05B 3MCOA 1I1GA 3WIUA 1RT3A 1W26A 4RWXA 4Y3CA 4EZ9A 3CMAS 2GMLA 3FMWA 2JC1A 2RH3A 5THWA 1U47A 3KLGA 2CNNB 2XEXA 1P1TA 1RT7B 2XI3A 3NRBA 2BE9B 1C0TA 2K1RB 3U1NA 1SVDA 3C15B 4R0JA 2RRBA 1FEHA 4ZITA 3BGRA 4IH6A 1SQFA 4LF6J 2Z58B 1GTSA 4DOZA 1BD6A 1F5CA 3E01A 1QUVA 4QR1A 1N5YA 3WBZA 2QL7B 4CDIA 3NBPB 2LA4A 3HPOA 1Y7PA 1MWQA 2CFXA 4YY3F 2QC3A 4BLGA 2FC8A 2KT5A 2RU9A 3ZZYA 3PYEA 2A1BA 1UWBA 4XTTA 5D0HA 2KVIA 3LALA 3BKUA 4FF2A 5GMKa 3KLHB 3ITHB 2GVDB 3QZ8A 3T5JA 3UD3P 3DRPB 2DHAA 1D9FA 2PEBA 2LEAA 4ECXA 1EUQA 1PC4A 1JLFB 4A4JA 2XGPA 2J7WA 1X5SA 3QT6A 1SIZA 3BPSP 4RNNA 4KYZA 2IYIA 2AGQA 4P2FA 1VRUB 1F2GA 4QIEA 4TY8B 4NASA 4QYZK 2V34A 1M5OC 2XYGB 4X4OA 1JKHA 3C16B 2KJVA 2H9ZA 2ATLA 2XHCA 2X3GA 5B08A 2ZOGA 4ZOSA 1FDDA 2G2YA 2AIRB 2HVZA 5RUBA 4DR4F 3QFHA 2JRSA 4FF1A 4MJKA 4GC6A 5LMUJ 4OX9F 3P8BB 4J9PA 2CKWA 1SH2A 5JVHS 3AODA 3D4JA 2E5IA 3RAXA 4TY9A 4CIOA 3G9CA 3AOAA 3IO1A 4HACA 3NS7B 3TI0A 4W98A 2V8PA 2WVFA 4C8NA 4J3CA 3BO4A 4Z37A 4JI4J 1FJ7A 2GQQA 1XNQF 1FK9B 4J9MA 5L9NA 4DV1J 1HIYA 1HWIA 3CD0A 4ZPAA 4OYAA 4RW4B 1QTMA 2DY1A 3AIIA 4IOBA 2C2NA 4DX8H 3PG9A 1Q53A 1I51B 2Z8QA 1QUPA 3KNGA 4TNOA 2P9GA 4ZA1A 4HHHA 5CD4H 2XS5A 1H2UX 4RW9B 1HD1A 4K4WA 4K0KJ 1E6YB 2AJ4A 3NL0A 2ROGA 2BW7A 2HEKA 3T1YF 5KFEA 2RMLA 1OMSA 2HHVA 2P5VA 2QMWA 1J5OA 4KH0B 3PDNA 2XYHB 4PG4A 1MMLA 1TK8A 3HKZD 3PO4A 1H98A 1KNZA 4I67A 3C6TB 3BKTA 5I42A 2OMLA 1HA1A 4DL7A 1IR2A 4M94A 4P52A 5KFQA 2OPQA 1PG5B 5IT9U 3CJ4A 1S76D 4UY88 5BNZA 1N5SA 3CCUS 1GX6A 3I96A 3TUZC 2POKA 2CNOB 3M1VB 4PYAA 3HHDA 2FC9A 3RGIA 5DQHA 3D28A 3K8VA 2PJJA 1RBLA 1G7CB 4XO0A 1WELA 3AJ2A 1LKZA 2FHKA 2JVOA 2P9CA 2GW8A 3C3LA 2HAFA 3A4TA 2O5DA 4KE5A 5GVQA 5GAEI 1MMDA 2WSEC 3OL6A 2BANB 3HHKA 2RF2B 1Y3KA 2DNQA 1I5OB 3RYLA 2RE8A 4MMOA 4LREA 5T14A 3LWMA 2KFYA 3C66A 5JXSA 1SH0A 2CDQA 1LK5A 4GVLA 4LRCA 2CQGA 4F4YA 2VFTA 3CCLS 5C5JA 2NSBA 5DG9A 2HVEA 2PICA 2DRDA 4LSLA 5EGYA 2FTRA 2J6TA 3TUJC 1FRLA 2L9DA 2BJ9A 1VCTA 1WF2A 2CXEA 1CEZA 2PN6A 1WOSA 1VQMS 4M5MA 2BJ7A 4F2SA 3PIOQ 3F41A 5ETMA 2FJVA 3LA0A 4ZN1A 1URNA 4OHWA 3BH6B 4DSKA 4ED1A 3D3BJ 4YB5A 3HSJA 1T9VA 4I6AA 2MZSA 3TANA 1KLMB 1S6PB 2VICA 2D74B 3PW2A 3G71S 5KOWA 2K7KA 3FCWA 4ID5A 2ZE2A 2BRLA 2BJ8A 1TMMA 1YKWA 1HHTP 1UJ5A 2JEFA 2VQEJ 1SJQA 1E6VB 3B8HA 3G82B 4USIA 3VAGA 1UEKA 3CUNA 4DV1F 4L74A 1RTIA 4LF9F 3VVTA 4N56A 2F9DA 3QWUA 2ZBPA 3BSCA 4NLGA 2EBGA 1RWMB 5KFAA 2D3O1 2CQ3A 3RB0A 2ZHOA 1M1HA 1G2EA 5ETVA 3P3DA 1YI2S 1LW2B 1R8CA 1TL7A 4K4XA 5CXTA 1WG1A 3KMSA 3EZ5A 3EICA 1SC1B 1O0PA 2Y3YA 1V6HA 4ZIVA 2FIUA 3CMES 2C22A 4K0KF 3GG0A 1VHFA 3DN9A 1KFSA 5HQ8A 1SQEA 4JYZA 2GO8A 1OO0B 1SL2A 3C6UA 1CG2A 1JIHA 4QIFA 1TUVA 3GCXP 3BH7B 2OKQA 1M1GA 3CCZA 1U6BA 3FQKA 4F04B 4B9MA 3V4MA 1CJKA 3TJ8A 1QRSA 4ES1A 3J80Y 2MTLA 1RT6B 4Y65A 1PIEA 5DG7A 2VIHA 4JI5J 4ZVHA 2VQFJ 1NB7A 3JYTA 3TAPA 2BJ1A 3HXMA 4NLRA 3WC2A 3ILJA 2P8IA 3MF5A 1WDTA 3W9JA 2PO4A 2KXHA 2MGZA 3HHLD 2ZVIA 1H72C 4RX6A 3D67A 4KGXB 4OQJA 1IKXA 4DFPA 2OPSB 4GMKA 3TAMB 4OYIA 1TKZB 2IDEA 2VKZG 4ED3A 1L3VA 1NKCA 2BJDA 3UWTA 3PX6A 3K58A 3POTA 4JV5J 4O3PA 3AHPA 1LW0A 1YJUA 1N0UA 4DUTA 4KH1B 1PKUA 1P6TA 3T1HJ 3PXGa 5KFMA 1C0UA 3QJLA 2VA3A 2NREA 4FYDA 5EUHA 3UDVA 3EXCX 5HSPA 4P2SA 4WYLA 1EX8A 4CH0S 1GTRA 5AT1B 3G8SA 2BDPA 2PIIA 3M8QA 1DFDA 1B99A 4O3OA 4A8MP 1UKUA 4PRFA 4NLOA 2HZAA 3JTNA 3DGPA 2YQ0A 1Q95G 2RVJA 4H4OB 1YZ6A 4ICLA 3K57A 1IKYB 1AUSL 1T9XA 4DR3F 1S7IA 5DQGA 5BXIA 3HVTB 1HMVB 4V1Ak 1JLCA 4ANCA 1SB6A 4JI6J 1SQGA 4JI7J 4ZLPA 1BE4A 1RAEB 2VBXA 1NJWA 3O6QA 5KT4A 2BMBA 4JI0J 2VQEF 3RBEA 1SJ3P 3K17A 8ATCB 4OHXA 1N6QA 4ES3A 3OR2A 1RAOA 2YVSA 3A8KA 3P5BP 4EGLA 2YWHA 3E51A 1RABB 2MKYA 3A8JA 1S1TA 2OEKA 3C19A 1BWVA 2MPUA 4F0HA 1NK6A 3FNNA 2IIHA 1MWYA 2IRXA 3S8SA 1S9EA 2QO3A 2DXDA 4DN0A 2XY7A 3M30B 2CPZA 2W8KA 5T41A 5G4DA 2QA2A 3ISNC 5AXNA 4QIWD 1HHQA 3LP2A 3IC1A 3ZZOA 2ZHAA 1KRPA 1F3VA 2J0QD 5AXKA 4DDFA 1BC6A 1GFWB 1P9YA 4M1KA 4CYUB 4TKTA 3F56A 1SJ4P 1X7VA 3K5LA 3PEJA 4WZQA 1X9MA 1NK8A 4NCAA 3I5CA 5KFRA 4JI5F 2D9OA 3H8YA 4WK1A 2KTQA 2VQFF 1SJRA 2KH9A 3VGUA 2WZ1A 4B9SA 3IAM9 3NWRA 3GFHA 2G0JA 1RSCA 2GAGC 4KKOB 2BQUA 2IRYA 2CVEA 4RW8B 5A76A 1PAEX 4QR0A 1BY9A 2EEYA 1NHKL 3WX8A 4A46A 1DBDA 3VAJA 3AB2B 4MT1A 2FLLA 4KHMA 5HVHA 2B6AA 1YVFA 3GV7B 4OYPA 3DRXA 1QD1A 2YNGB 4ZCLA 3TJ9A 2LDIA 3MMBA 4CH7A 3FGVA 3SDEA 2XLJA 1UETA 3CJ3A 4GO7X 4Y2IA 1K9MT 4Y6IA 2CNKB 4GO5X 1I3OB 2N7CA 3LP1B 4ZLLA 2MY8A 3SSSA 2DRAA 1D6KA 3GSDA 2CWXA 4NYPA 4DF4A 3NAHA 2XG8A 4X2BA 2L08A 1VQPS 3BGUA 4WCEQ 2GIQA 4DQPA 4LF7J 2BV3A 1Z85A 3KK3B 1RAGB 1F0XA 4XPCA 3BBBA 3EGVA 3NGTA 2LECA 4FYYB 3FMBA 2Z0YA 1VHKA 2MJUA 4J9UE 4F4ZA 5B0AA 3W8PA 3FVYA 3VAKA 2FJBB 2O67A 4A47A 4PQAA 2W2QP 1IJEB 5JVHQ 1CULB 3TVZA 1U24A 2WVBA 3W2WB 4BCAA 4ZJOA 3G6ES 2ZUAA 2R2UA 1XQIA 5EX3A 2DXEA 5D4NA 5KFFA 2P2CB 4JI6F 3R7BB 3T9ZA 2R7VA 1LV5A 3UR0A 4LR9A 4JUZA 4C3MA 2X1AA 1YJNS 4NWBA 3CJTA 3ICLA 4JI0F 2HFSA 4OI1A 2W8LA 1EP4A 1U02A 2HK3A 3MURP 3MM5B 1MN7A 1CJTA 5F41A 1X4EA 3HP6A 1RYRA 5HBMA 4P10A 2DGVA 2DBBA 5B0DA 4I2QB 2QL9B 1YBUA 2QRRA 1VFJA 5J1EB 4N41A 3V6DB 1NM2A 4MYUA 2QLJB 1KBRA 3TX0A 3BQ0A 1NJYA 1KQGB 1KTVA 2V50A 1NBEB 4QWAA 4MK8A 1SPBP 4B17A 1L3UA 3OBIA 2V4RA 4FXDA 4O44B 3W60A 5DRKA 5JUMA 1YIJS 3LAMA 1MMNA 4B3SJ 3RG6A 3RJMB 1VBXA 4NLQA 4YDDB 1TK5A 4V19X 4NZ0A 4JV2A 2HNYB 4P7VA 5IV4A 2Z2MA 1WKJA 2QIFA 2B7CB 3D1QA 2ASJA 2YXLA 1XJWB 1N52B 2BJEA 4KFBB 2W24A 3SI8A 3BREA 1WTBA 2E5GA 3KJQB 2CPJA 2DXFA 4F25A 1VBZA 5DM7Q 2VG7A 3D5MA 4IG3A 4LR8A 3ZTQA 1VC6A 3U02A 2AYMA 2JLEA 2KU7A 4DXLA 1AUDA 1NXIA 3WIVA 4LSNB 1Z2ZA 2I2YA 2FB0A 1LFWA 4U8YA 3DNCA 2QEXS 1TZ0A 4HI1A 2FVQA 3R5JB 2H5JB 2RQCA 1VQKS 2O01C 4WE1A 2HW3A 1UTAA 2HNDA 4GKKJ 1REVA 2QMXA 1R0AA 1XNRJ 4QWDA 1SKSA 3T19A 3KJVA 4P75A 2PFFB 5J2PA 5C25A 3W5ZA 1UEUA 1NK0A 5DDRC 1YZ7A 1Q78A 4K8RA 2RUGA 5CQGA 1NH8A 3R1HA 9ATCB 4Y0FA 3W62A 2PA8D 5GAEU 2HWTA 2ZOFA 3DDNA 3DOMA 9RUBA 1OY9A 1KEKA 5CABA 2WVDA 5H1SV 2EFGA 4H4KA 3K5PA 4LF7F 2HQGA 2LLZA 1IM6A 4ZVGA 3IAS9 1RTHA 5H9FK 1IBKJ 5B7WA 1W7WA 3H4BA 4X4VA 1NU4A 3G87A 3IG1A 2OELA 3TZZA 2FYXA 4C7QA 2XI2A 3H25A 2EC0A 2QLXA 2DIVA 3A3OB 1VLOA 4Q2LA 5KT2A 2VBZA 2MQLA 1K73T 1TL3A 1DTTB 3OTOJ 1S0NA 4WZMA 2XYPB 3B6BA 2VOPA 2VV5A 3PNIA 3DLLS 2V4JB 1TKTA 2VASA 2ZBRA 5J2MA 3W2VA 4HTIA 4J9OA 5F3TA 3MMAB 1TV6A 4ENOA 3A3NB 2KKHA 4ECUA 3MOZA 4HTJA 1WHYA 4MAKA 1U1RA 2EC2A 1N36J 1ZTWA 3I4PA 1N54B 3DFEA 1V3SA 2FJWA 4ELVA 4U6PA 3GJTB 2OFGX 3UDCA 2LEPA 2UU9F 4DR2F 2HRTA 3S6EA 4G1IA 3F73A 3T3FA 5J1NA 3BSOA 4DV6J 3HKWA 2AEMA 3L7PA 2DJWA 2IBOA 3L3CA 1EJ7L 4B3SF 3VCDA 4GC7A 4O4RA 1FFSB 2FLOA 4J9RA 3SCKE 2XO6A 1FTRA 4YP3A 2HFNA 3AOCA 2ZNZA 4G3IA 4ZPBA 3IR5B 1S10A 1NDCA 3OVAA 3IR7B 4MKYA 4CQ1A 1X4DA 5AXMA 2IA6A 4OX8A 3D1HA 4U67Q 1URRA 3KHHA 4MIWA 3MM9B 1FO1A 3D6MB 3MPDA 5I3PA 1S0VA 2SXLA 2Y9HA 3OTCA 2KT3A 2QX0A 2N4CA 3CJRA 2CG8A 3VAMA 5E3RA 1GMVA 2C2RA 2J9DE 4E98A 1SKUB 1NKBA 2UVWA 3CC4S 3NNHA 2R8KA 3HVAA 4DUZJ 4BS2A 1FXLA 2FLNA 1NHVA 1WF0A 2RKIB 1XMBA 3GJQB 3MECB 4K4YA 3DLEB 1KHVA 2WBMA 2JFDA 1RADB 4ITSA 1SV5B 3HD2A 3CIZA 1U1OA 4DX7A 4NMXA 1YG0A 4X62J 4CRJA 1HNZF 5LMNJ 1RWKB 2GJ2A 3JAMY 3D0HE 2OTLS 1PJ5A 3G8TA 3KLEA 4FZVA 2YWKA 3JS9A 4CO3A 3E2EA 4NMLA 4NXNJ 4WIIA 1VLYA 2IAJB 3FEYB 4CLSA 2YNIA 3IXQA 2IVMA 5CCLA 4U8VA 1RT3B 5FD1A 5DDPC 2DGXA 1C4AA 2J9DA 3BN4A 3M9MB 5GAGW 3M6UA 3HZGA 3KMQA 5KFIA 1DTQA 1C0TB 2C3MA 2X7IA 5KFDA 3ETOA 4FXVA 3D0IE 3JSBA 5K8OA 3BGRB 2UUWA 2NR0A 1HI1A 3CO0P 2XZWA 3VF0B 4C98A 1TMJA 2JSXA 4WFNS 3E01B 1N5YB 1FDBA 1PGZA 1XERA 5K5MA 2DH9A 1NO8A 3TX8A 4KQZA 2ZITA 4IKAA 1R0BG 1X4FA 3KHGA 3M2UA 1UWBB 3KTQA 2ZJPS 2DNZA 4NRTA 3VHQA 3MD1A 5M2RA 2IBKA 4DV7F 1N36F 1UEVA 1KOOA 4UUXA 2FLPA 2OP5A 3WX4A 4EEYA 2HVIA 4PG5A 3CF5Q 3MMCA 2XNQA 3AB4B 3ZXWA 3B78A 3QO9A 3NS5A 4OJ3A 4RU2A 4P9SA 2CPIA 1MSWD 5D0EA 4IRCA 5CAAA 1WC0A 5DLGA 3QPIA 5EWEA 2O3DA 1SL0A 4DV6F 2UV8A 3LH2S 3FSYA 2OEMA 2BJ3A 1MW7A 1KQFB 3H20A 3WDOA 4P72A 1JKHB 5LJ3Y 4DS4A 3DI6A 3H2VE 3VQTA 5ETOA 3MM7A 4LVOP 1FRKA 1VC5A 2F1FA 4DPTA 2LQBA 2AZ3A 2EBEA 3TEHB 2HQCA 4OI4A 2HZCA 3M2VA 1M1KT 1LWEA 3IWLA 4WFZA 3LF0A 3CW2C 1PSDA 4HACB 1OS5A 1TKDA 1XIQA 4H4MA 2KN4A 3PEHA 2IPOB 3WQPA 5KFUA 3W66A 2JZ5A 2RD5C 3CJKA 2NXUA 3CJ8A 2M8HA 4DUZF 2G13A 1MN9A 3AQPA 2ZEJA 3OXFA 2EK1A 2UXDF 1EETA 3OXLA 3N4WA 1X4GA 3BO3A 4DSFA 2MZTA 2BE7D 3I6PA 4M63A 3IMQJ 4DFMA 2RIJA 5ETSA 3O8WA 1M90T 3Q0AA 1HNIA 4J7CA 2GC8A 2G5DA 2YWEA 4OI2A 4KY3A 4NLSA 4IG0A 2B5JA 4MKBA 4DU8A 4NXNF 4QCLA 1VQ5S 5KT5A 4RUHA 4OZLA 4AL7A 4QW9A 1J5OB 5CYMA 1F5AA 1FERA 3TR5A 1CQNA 1SIWB 2Y8YA 1VJWA 2Y0BB 4I64A 4NLWA 2E1RA 5HANA 1ZOTA 3J7ZT 4NOHA 3CEDA 5I42B 5KTQA 3QRRA 5FLXU 1CJUA 2NS1B 4YB7A 3DC2A 4BWMA 2OPQB 3FEXB 3PJ9A 2CX8A 3PIPQ 5F8NA 4M5JA 3JTPA 3T1AA 4DL6A 4USTA 4HH1A 5DS7A 4ZVRB 2ZWOA 4F7VA 1KTQA 1UFKA 4C97A 4CCHA 5D77A 2E44A 3M4XA 2MQOA 3PW4A 5IT0A 1IN0A 1H73A 4NZ6A 2FJDB 2RHSB 3LAKA 1KSPA 2XY5A 4USJC 2K8GA 1WKLA 4CO1A 2V2KA 4HKQA 4Q0BA 4L69A 3CPWR 1FVSA 3RU0A 3QT8A 2Q66A 4C3KA 4R8UA 3UFCX 2DHXA 1D09B 3EVOA 5EX0A 4CT8A 1FXDA 2DYAA 2MKCA 1ZM4A 2GS8A 2QV6A 4RLEA 2FY1A 2B9EA 2XSFA 2JX2A 3M8ZA 4UZCA 1AB8A 4O3QA 5CD4A 5E7OB 2EFVA 2OFHX 5DDQC 4PUOA 4M5KA 1HW9A 2R4FA 4B3OA 4PWDA 3H2UB 5GAGI 1NUEA 2I1RA 1N8RT 1HFEL 2YQ1A 3PX0A 2ZD1A 4YEAA 4B3RJ 4LSLB 2M0GB 1QVGR 4NA1A 1AYEA 1LOUA 1BHNA 2ILYA 1IR1A 5C7PA 6FD1A 1WC3A 2LP4A 1YRTA 3MR6A 2E9RX 2V8HA 1FA0A 2RS8A 3I0SA 1WHVA 1AZSA 2AGPA 2KO1A 2DISA 2DGUA 2HBQB 3JSMA 3V81A 3CDEA 3OSNA 2F9JA 4HVZA 1GNKA 4WFAS 2EFNA 5DG8A 4F0KA 4K7QA 4B3MJ 3P5TL 5J2QA 1L3KA 3RUBL 3J7A1 4PG6A 4CP5A 1Y00A 4ID5B 3AOBA 1P27B 2MB0B 2ZE2B 1T03A 4HDHA 1VQ9S 1RKJA 4ES2A 1PBAA 2HKEA 4O3RA 4X4QA 3HVRA 3H40A 3CDUA 4ID8A 1I94J 4ZS6A 1RTIB 5CZXA 1U26A 3DKDA 2C3OA 1VYAA 3L4BC 2YPZA 1WG5A 4L76A 2YX1A 1RBOB 1RWVB 5DJBA 3HMJG 4EBEA 3SQGA 2NLWA 1TL7B 2O66A 4ZK7M 5C42A 3N5FA 5GAHU 1APSA 4DV0J 4TU7A 2C2DA 4CTAA 3PVXA 1N5TA 4QWCA 2KXNB 3NGSA 1TFYA 2GHVC 5KG6A 2GNKA 5KFGA 1FWPA 4QYRA 4UQTA 3I5AA 4IOCS 4L73A 4WKRA 2V6AA 3C6UB 2J6SA 3HFZB 3SCJE 2GO9A 1HQUA 3TEGA 5KT7A 2XZDB 2V2VA 1X0PA 4IOAS 1CJKB 1RI7A 3W1YC 5D3GA 1NZ8A 3W5XA 4J9LA 4F67A 1R27B 3W7BA 5EDWA 4I4BA 1RB0A 1TL1A 3JYTB 4DUYJ 4YDXA 1S48A 2GHPA 2R7RA 3PJXA 1TU0B 1PO6A 2MGZB 2DGTA 5E3AA 1VQSA 4CWBA 3NNAA 1DQ9A 2UVVA 4AXJA 1SKWA 4B9TA 1WTFA 4W90B 3Q2TC 2Y1RI 1T3OA 2CVIA 4QJVA 4B9LA 4DL2A 2R7QA 4UOCA 4L3KA 2ABYA 2RU3A 3POTB 3M8WA 2UUCJ 3AXMA 2JLFA 4URQU 1KONA 4C0BA 5IV3A 3BEGB 2FPHX 3QRPA 3HFKA 3MFIA 4Q43A 1MROA 3W65A 1C0UB 1UWAA 1WC5A 3RTVA 1U1KA 2EG1A 5KT3A 3TVKA 1D9DA 3IRWP 4C8OA 2AT1B 3M8QB 5DZ6A 2CDRB 4M5GA 3GB0A 3JQJA 2F3JA 4OZJA 2I9SA 5DETA 4WTYA 1PBUA 1FKAF 1S12A 3OQ2A 2PSZA 3HI9A 3DGPB 5C2GA 2V8VA 4ICLB 2C1EB 2J7KA 2HHUA 3H98A 4NI2A 1J5EJ 1A0OB 2U1AA 3BZQA 4OHZA 3OFGA 4B3MF 1WSVA 1JLCB 3VZHA 1EQMA 3M6XA 5D15A 1DAXA 2HHPA 1NDKA 4KR0B 2JHEA 4J90A 4YOEA 3RRHA 3DRRA 1FKOA 3NAIA 2CPHA 2NUHA 3TZWA 1I94F 1CJVA 1N6QB 3SEOA 1X8DA 5AE3A 3EPGA 2IC3A 2EXUA 4Y28C 5C2CA 4DX5A 4ZLJA 2ZJRQ 4NLPA 3CCVS 1VS3A 3B54A 4RUCA 2AF6A 4B9UA 4HT5A 4I68A 2GIFA 1S1TB 5KFYA 4PXCA 3A8IA 4GKJJ 4WBFA 3BGLA 4M8LA 3LUYA 1S9EB 3MAQA 4PAAA 3NS6A 5HMYA 5JVGQ 5HATA 2VKRA 1OY8A 2KM8C 1JX4A 4LF8J 3KHLA 4ZN3A 2YKAA 3R6LB 3OLAA 1RTJA 4X4PA 2QGFB 3LP2B 1RE1B 1CC7A 5G0RA 2UZAA 2R8IA 1VR6A 4J9QA 2XMUA 1YQHA 3M8RA 3BSNA 1JNZB 2RUSA 1SI9A 2V0NA 4LQ9A 3GCWP 1FRIA 5KG3A 1KFDA 5D78A 2DNPA 3C8YA 1BQXA 4JV1A 5CH7B 4ECYA 2GA7A 1JLGA 2N4DA 3CDWA 2M8DB 2B4VA 1NK9A 3Q8SB 3M05A 3KUHA 4P6QA 1FXRA 2FZCB 2ZJPQ 2V2QA 5E3PA 1S99A 5GADW 4U95A 2J76E 1V9OA 2Z57B 2R42A 3MM8A 2B6AB 1T9UA 2KRBA 4KGVB 1V5IB 5AJ3J 1QTNB 2I38A 3MMBB 2AZ1A 3SDEB 3MR2A 1OYDA 3KJNB 1ZYQA 2D9PA 2UUCF 4ZLNA 3Q2SC 2WB1D 1U49A 2VD3A 1JLEA 1RT5A 4AQYJ 2E1AA 2G2ZA 5SZTA 1FDNA 4LF4J 1OY6A 1T9TA 2HLTA 4RBTA 3CB4A 4H4KC 2ZBIA 3ZTSA 1JWWA 2DNRA 4N8NA 4X65J 2DGOA 3NBPA 3IA0A 1NKEA 1B0VA 2CQBA 2Q43A 3LANA 1H38A 3IS9A 1C2PA 4W4MA 3MXHP 1VGYA 2PMWA 2BYCA 2XMKA 3VGTA 2OAUA 4ZKAA 3GYNA 4OLOA 2UUAJ 2DIUA 2ZM6J 4RNFA 2YNHA 2DHHA 2VL1A 2PMZD 1P8GA 4ZPTR 1DQ8A 1JQGA 4V19J 1SC3B 4M5HA 2ASLA 5HI7A 2VUGA 1ZM9A 1X5OA 4DV4J 2B4UA 2G1DA 3CULA 2EFOA 3NNCA 4TU8A 2V63A 4TY8A 4FVCA 2HS3A 1FD8A 1EP4B 3J7YU 2BEFA 2J7UA 1CJTB 2V68A 2W25A 3V2UC 1IUJA 4IFVA 5HBMB 1WF1A 2LQ5A 1XMQF 5A8WA 5HROA 1VBYA 3UPFA 2E1PA 4IRKA 1ZM3A 3Q89A 1NPPA 4ED2A 2EW9A 3TZXA 4GKJF 3GG1A 3AQOA 2Z56B 4ZCMA 1FESA 2NQPA 2AEJA 1RWWB 2LU2A 1WORA 4EWTA 2KM8B 2ZH5A 3ZFVA 1WEXA 3OVBA 4LF8F 1N0VC 3BYRA 3ILIA 3FSIA 4YY3J 3THTA 1VK8A 1AW0A 4WU3A 4ZDNA 3ZTOA 4TN2A 1RAAB 4DV5J 2W9CA 2XBPA 1MU2A 4P71A 4CZCA 3J81U 3CO9A 1YJ7A 2RJZA 5KG2A 2CZVC 1NSKL 4UUWA 5B0EA 5KFJA 3CJ0A 3UD5A 1BQNA 2J9CA 3R3TA 1H3DA 1H74A 1HNVA 2ZJQS 2O1PA 1W25A 2VG7B 4IG3B 4OFZA 3VQSA 4DSIA 1LWCA 3V6HA 1RAHB 2ROEA 5K8PA 1Z4UA 2P6TA 4KPCA 4LJMA 1HQEA 1V3RA 2XQCA 3M9NB 4CT9A 3FBBA 4WE1B 3O5TB 2HNDB 1FVQA 1TQLA 3DLJA 1WD6A 1REVB 1R0AB 2CPXA 2KI2A 1EZZB 4I1TA 1WEZA 2UXBF 1F2HA 4A8YA 2Q3PA 1WJ9A 4WK3A 2VZ9A 3R5DA 5C25B 5J2PB 4B9VA 4DR4J 3N01A 4OX9J 2MMYA 1DLOA 1P1LA 1K44A 2NXNA 5E0OA 4YMEA 2RDDA 3E3XA 2MKSA 2OH2A 1D9AA 3DOMB 5EN1A 3H5UA 4AL5A 3FBFA 4CLFA 5CYQA 4CNYA 5KFKA 3D6TB 2JC0A 2J6UA 2YBVA 4RBVA 3Q22A 1TKXA 1RTHB 4E8UA 5IWAF 2V9KA 4OZ0A 2DEJA 1QY7A 7FD1A 4NEZA 4DPWA 5IC4B 1DURA 4ZMMA 5L8RC 2CAJA 3IG1B 4JBCA 2HFOA 4TLQA 3RZAA 3VWSA 1QAIA 3EZOA 1FRHA 2ZM6F 4F3MA 5DO2A 3R27A 4E0DA 1FRJA 1TL3B 3L9ZA 3RR7A 5GADI 4DV3F 3JSRA 2XLKA 2ALYB 4ERDA 3KKFA 3T1YJ 2EKNA 2L3MA 1TKTB 5F8IA 1LXNA 4MK9A 4KGMA 1FD2A 2RNEA 4DV4F 2A3JA 5J2MB 3W2VB 1WSRA 1F9HA 5FDLA 1TV6B 1VI7A 4DG1B 2BX6A 2DTJA 1HR0F 1GX5A 3QAEA 3RBXA 1UDXA 3EVMA 1Y5LB 1EKSA 3PRBA 4JI8F 5IOLA 3QYYA 2A2CA 3DLGA 1PJ7A 3BDPA 3AAWB 4UY85 1RHKB 5KFZA 2OIHA 2HHHJ 3K7RA 3T5LA 2YTCA 2EGWA 2HRYA 2A6MA 5D4PA 3ZZUA 1RCXB 5HMWA 3DLHA 3MEEA 3PKMA 1U7LA 3RB3A 3DLBA 3KG4A 4Y34A 1RHQB 3TA2A 4HEA9 4P74A 4JI1F 2J0XA 2F8EX 3FZBA 4UZBA 3TWZA 4DV5F 4OIXA 4DCJB 4UF4A 3MCMA 3NG8A 3KLFA 2M2BA 2VPYB 4AE5A 3GWCA 2B4OA 3JB9k 4XDDA 4DSJA 4S0MA 4OV1A 2LXFA 4F4WA 2OPRA 3R9LA 2AJ0A 3MTJA 2HWIA 3AJ1A 4WXWA 1ZZFA 1G4CA 2GX8A 3SMZA 4DV2F 1LXJA 3DDKA 3I32A 3N6LA 3I9V9 2MSSA 3RW7A 3D3CJ 2AX0A 2R8JA 4I7FA 4ECZA 3UCGA 4C3LA 4B9NA 2BZ2A 4N5SA 2KFZA 2BQRA 4ZVQB 3EUNA 1JB0C 1FKPA 2X1GA 1G1XA 3IP0A 4UY8T 4DSEA 4OL8A 3ENVA 3M7VA 2ZVSA 4AFFA 3X1LB 3NMAA 2ZKTA 2DR5A 4ZVTB 4J37A 1XTZA 1UAWA 2CIMA 2YNIB 1AFIA 3AY0A 1EHWA 3KG0A 4LF9J 1F9FA 2BOAA 3UI3A 2J0WA 4I2PA 1DTQB 1DQAA 2G0CA 1SC6A 1RWOB 1S77D 5HL7S 2OPPA 4PXEA 3DHWC 5A0YA 2DR7A 4ETXA 5HVGA 4OJ1A 2LKZA 4NCBA 3HK2A 3FFIA 2AQ4A 1F5BA 2VPZB 1BMQB 1YDLA 1B0PA 3PR4A 3M2UB 3DDIA 2DGSA 1T8EA 3G96A 3L7UA 2C42A 2XZTB 1UW4A 3QSYB 2X1FA 5ETTA 3MUTP 2AYEA 2IMWP 4K4UA 5D4LA 1WDDA 2G6GA 2GAHC 2IJNA 3MMCB 2BKPA 2QLWA 3CD7A 1MG7A 3OFFA 1LEOA 5JMNA 3QIDA 1IKVA 5EWFA 2JLGA 1PJ6A 2HHHF 5IM0A 2X51A 3T6BA 3D68A 2BACA 2R2RA 2QYGA 2B43A 1X0FA 4WXOA 2I5JA 2DGWA 2YKNA 1Q5YA 1RCOB 3UQSA 3O3LA 1ZH5A 5A2QY 3OSPA 1RTZA 1ZAWA 3DI6B 2MSTA 1HPZA 3MM7B 2NZCA 2JOQA 3S7RA 5SUHA 5KFPA 3D66A 3TJAA 1S0OA 3GILA 3N28A 3M2VB 1LWEB 2VF3A 2VFVA 3QT5A 2FY8A 3R97A 4YFUA 1K0TA 4XPEA 4KPYA 4HT7A 2XMAA 4OJGA 4USKA 4H4MB 1K1SA 1XMOJ 3BB5A 3CT9A 2R7TA 1O51A 2BW2A 2CZ4A 3DOLA 4QW8A 3CJKB 2NYIA 3PO5A 2BRKA 3N79A 3IR6B 1Q7LB 2FHJD 4O23A 2Q6CA 2PFDA 5AXLA 3J80U 4NA2A 1EETB 2ZBCA 4OI3A 4EYIB 3UN3A 4ZPCA 3UW1A 3PZPA 3W64A 2R2TA 4QZVB 4QWBA 4DR3J 5ITHA 2RD2A 3VGVA 1XWLA 3SFUA 1HNIB 4DBQA 2DT9A 4DJBA 3PRVA 3JQKA 1MNEA 3NLCA 2BKNA 4NXMJ 4L6V3 2MKKA 4ELUA 4IG0B 2HZ7A 4LSZB 1M0SA 2Z30B 4A8OA 1X4BA 1EAYC 2B5JB 1F6TA 5L1JA 2EG2A 3K8WA 2IY5B 2CQ0A 2W2PP 5IXUA 5CYMB 3LWLA 3OR1A 4DSLA 4B02A 1T95A 2B9XA 2KJWA 2FVSA 3T41A 1KR4A 2LDYA 2E7XA 2NWAA 1FNMA 3KK1A 3R2DJ 3CWJA 3BJYA 1NB2A 3DLKA 1HYSA 1TUGB 1Q5VA 1NSAA 3DU5A 1SUQA 2F63A 3BR8A 1VIXA 2JL9A 1FI4A 4ZPWR 1U1MA 3FRYA 2BM0A 2HFVA 2MQNA 3B4MA 3MZIA 3PHEA 3ISND 3PACA 2NCKL 1M5SA 4Y2MA 2RT3A 2IJFA 4BC7A 1FE4A 4LF2A 2W7OA 3O44A 1Z2LA 1WUUA 2HFZA 2CJQA 5D0GA 4IFYA 4Q0BB 3H5YA 3KOAA 1U0HA 2CQ2A 3HZEA 5HJXA 2FHJA 4R8UB 1SJ1A 2E5HA 3FZ2A 3N0VA 2F7VA 4X84A 4DZ6A 3IM8A 4PCQA 1GXUA 4OYZA 1FJEB 1JLAA 1H0HB 1HNWJ 3LGNA 1KS2A 1JLQA 5BR8F 4PUOB 2QZ8A 1TVRA 4B3OB 3CCRS 3Q8UA 4PWDB 2P6SA 3R5AA 2CG4A 1RWPB 3NWGA 1S97A 2ZD1B 2OD6A 4LF5J 3KXDA 3MEDA 2EWHA 4KB7A 4EK2A 4TXSA 3QGGA 1TK0A 2F40A 3ONQA 4CI0B 2DKOB 2CRLA 1IWAA 1HWJA 2E5JA 1NMEB 2KL8A 4U9RA 3I0SB 4O0NA 1AZSB 2A2DA 4RUBA 4L72B 2ADCA 3JSMB 1QAJA 3V81B 3PW7A 2XM3A 4AT1B 1OQ6A 1FRMA 3MCNA 3NGRA 1X9WA 5J2QB 2H4YB 2IYGA 2A6OA 2B4PA 3DM2A 2MDAA 5HAOA 3PFOA 1Y11A 2ZZNA 1XMOF 2KT2A 3MD3A 1T03B 2ATCB 5BYSA 2QLFB 3K0JA 4DFKA 4YHHJ 2CADA 2AJ2A 3GZ7A 3C14A 1QAXA 1VQ7S 1CC8A 4ZVOB 1U0SA 5ETPA 1X31C 5KFHA 5F8GA 1NLKL 2I6WA 3P45B 3SQGB 3M8SA 1VHYA 4LQ3A 3OTEA 4KV8B 3PIOS 2UVRA 5C42B 4UQGA 4A8SA 1XBWA 4IH7A 4PXBA 4NXMF 2XS2A 4CTAB 1DFUP 1T0TV 2W4CA 3I55S 1KC8T 5FIIA 1VIOA 4A8WA 4DPOA 1ROFA 3HHLA 1FCAA 1JJHA 3UR3C 2N3OA 1QSYA 4ED6A 1HQUB 3W5YA 1VQYA 4WKYA 5KG7A 5I3UA 2QJ3A 4O3NA 2JEGA 1VQ4S 2HGNA 5D3GB 3JTOA 4OYWA 5A8RA 3ILLA 1GK8A 3KLIA 2DO0A 2V94A 3TZYA 2XCAA 4P7TA 2N7YA 1TL1B 3V4IA 1YSJA 1HI0P 2GQ2A 1XR5A 3GP9A 2JWNA 3NOGA 4UT4A 1H2VZ 4MH8A 1R6VA 2OEJA 5E41A 4XK8C 3VZIA 2H51B 2JEIA 3TA1A 2CPFA 2H65B 3T5HA 3H2LA 3TRGA 1Y5IB 4IYQA 2BR0A 3MCSA 2OJ3A 1AFJA 3VVUA 2MXYA 3RBDA 3BQ1A 2CUYA 2AHOB 1SC4B 1Q8BA 4Q45A 1IXKA 3KW2A 2ZOMA 3DXSX 4X66J 4NLXA 1S79A 4CO5A 1HNWF 4DR6J 3DXBA 1RBAA 3OJUA 1YLXA 4TQSA 5F0UA 4F02A 1MROB 2WW4A 5LOQA 4F0MA 4KO0A 1WKKA 4IR9A 1KDNA 1S9FA 5F0WA 3Q8YA 1XC9A 4KSEB 4PQUA 4LF5F 2EK6A 3WHIA 2HHWA 3NCRA 4A8KA 3AD9C 2RDJA 3GFYA 3UVJA 1ZZNA 4ZJQA 5EWGA 2BE2A 4B08A 3BS9A 4L75A 2AEFA 3OPKA 4UOHA 4DR7J 1NEEA 4EI2A 1UPMB 2UV8G 2BA9A 1OYEA 1LFPA 2Z2LA 4DPYA 2MQ8A 5ETLA 4ECQA 4WF9S 4NI2B 1IQTA 4HL9A 2PD1A 1RUSA 1CSJA 2HRUA 3R7SB 4PXDA 1QE1A 2YWWA 2YKOA 2XGQA 1YRXA 1VMBA 3DRRB 1UVKA 4CLZA 3DYAA 1EKRA 1JJCB 3C2PA 1IBMJ 4YHHF 3TP2A 4TLRA 4EO6A 1CJVB 4O4GA 2DHGA 3UCZP 3AD8C 4LRBA 2IC3B 2HS4A 1N32J 2KZZA 2VFSA 1OPIA 2DGQA 1VQ6S 2MLXA 2YX4A 3OD2A 2MKJA 2HG4A 5LM7E 3UE2A 1Q81T 3UNGC 3SIPB 3FCHA 3GE9A 3K5NA 4URSA 2BOPA 2H1YA 1WG4A 2N3LA 2KHCA 2HBZB 4IQMA 4ATNA 4EBCA 3CCQS 1F1BB 1RTJB 1NDLA 1IBCB 1UZDA 5G0RB 4FVMA 3GPAA 1WC4A 3LOUA 3ET6A 2IVFB 2W9AA 5HMXA 3M6WA 3OT9A 1GMWD 4DHVA 2HHQA 3M8PA 2R7UA 5DZ7A 4HI2A 4FDFA 1TAUA 3IGNA 5HL7Q 2DHSA 3UN2A 4OZNA 4FN5A 1EXDA 5IZNA 5KG4A 4UTGA 1RHRB 3Q8VA 4KC5A 3UNYA 2UU9J 1BLUA 1JLGB 1B7FA 3EM1A 4DR2J 3LP0B 2HIYA 5F3ZA 2ZBQA 3QGIA 3IFEA 2WW8A 4IO9S 5GAEW 1GEHA 4ER8A 1X60A 3IM9A 2DPIA 3FQLA 2LCWA 3QATA 5LL6d 2Z2ZA 3NGUA 2KZMA 1U25A 4LT6A 3CMQA 3MM8B 4YR2A 2F8HA 2YWFA 2CQIA 1OPZA 1SH3A 2FZGB 1HARA 4OLPA 2VOOA 4NLDA 4PWWA 2V8GA 1Q8IA 2QLBB 2GZOA 1S57A 4QIVA 5E2QA 1JLEB 4X66F 1HBMA 2LQJA 1RT5B 1OSDA 3RB4A 3A1YG 4DR6F 4GVBA 1U1NA 3MEKA 3BGOP 4PG8A 3W3SA 5DM6S 3EGWB 3OUYA 2LA6A 3MGJA 3OFEA 3VGSA 3FKBA 2DH7A 4DN9A 3M6VA 1N4LA 3U1MA 4G6VB 3IS9B 4FKYA 5H9EJ 2PI5A 1FFWB 2JDJA 3IBWA 3VALA 2QG9B 2DRBA 4WU2A 1GMWA 4DR7F 1U8SA 1S6QA 1IJFB 5E3CA 1PAUB 4MYTA 1LK7A 2YNHB 1FF2A 4W92B 2OO4A 1RHMB 2AYGA 1U09A 1HNZJ 1GAOA 5DLFA 4NZ7A 3K59A 1YJWS 3PR5B 4DZDA 2F4VF 2LFVA 1CS4A 4H3SA 3W9IA 3CC7S 3V6JA 3QZ7A 1RZMA 4M5NA 2FVRA 2MEWA 3GTYX 5L9XA 2NYHA 1IBMF 4RW7B 3BPDA 1O0BA 2AD9A 4WCES 4IFVB 1IWGA 3QAUA 5LJ5Y 4UW2A 3PHTA 1N32F 1NPKA 1X5TA 4ZCKA 5A8WB 5HROB 1LNQA 2MKIA 4IH5A 4PWUA 2B51A 1YRUA 1UZHA 4ZVFA 3O2IA 1Q8KA 3OJSA 5LXRA 4F3OA 2W1BA 2ZH2A 3Q8QB 3EX7B 1CVJA 3ZNJ1 2E5LF 3SZ2A 2RE1A 1SXLA 3ZZ0A 3QIPA 3OVSA 1YBTA 4P73A 1U4BA 2BQ3A 2CJKA 4C11B 4C2MA 1NJIT 4JP8A 1J2VA 3GMGA 3CIMA 4KHPF 3TAQA 2IM3A 5L39A 4Z2XA 2BVZA 3ILOA 2W9CB 4LRFA 4LMZA 1MU2B 3TYTA 4DV7J 1NZAA 3PFEA 4FKXA 1OIAA 3GONA 2HQ3A 2IMOA 4D3HA 5F9LA 1O5JA 4LBIA 3THPA 2DVIA 3MPWA 1BQNB 3IRXA 1RAIB 3ISZA 3JAMU 1UFWA 2GAEA 4YUDA 1HNVB 2AV5A 3ZNUA 4P2BA 3HD1A 2NXJA 1ZAXA 1YITS 3GQCA 1LWCB 1N48A 1NK5A 2FGCA 1ZPWX 2QN6B 3GLJA 1HQEB 1Q16B 3L7OA 2FJXA 2DITA 3OTDA 4EMDA 2C2ZB 2CWKA 3DGVA 1X4AA 1X9SA 5B0GA 1UVIA 2FUG9 2LQ8A 4NCGA 4RL1A 1RAJA 2W7AA 4J9VA 1RU2A 1DLOB 3HSDA 2V67A 2XB2D 2W4DA 2AX1A 4LF6F 5BYRA 1ACMB 1L5UA 2U2FA 3MM6A 4Y00A 2R2SA 2F65A 3M32A 2DY9A 5CYQB 4CNZA 5DM7S 4K2JA 2MHEA 4OI6A 3I0RA 4WFBS 1L3TA 3D1OA 2GMHA 2ROPA 3H5SA 2OLWA 1TKXB 2UXDJ 4ILMA 1TP7A 4LIWA 4JXXA 2H5EA 1S5ZA 4IDKA 1Y3JA 2RILA 5KFNA 4JI3J 2VPWB 4WWSA 5L1KA 3J81j 1H7WA 4BBYA 3CVKA 5A8KA 2VONA 1V5VA 4R5PA 4JOUA 4UOFA 2Z0GA 4DU7A 4DCPB 3BF4A 5A6WA 4XDCA 1X4CA 1LWXA 3LW5C 3S01A 2VDIA 2IHR1 1TTHB 2LXIA 5FDLB 3G8QA 4ED4A 5IT4A 1VQOS 2W2NP 5F9NA 3KLGB 3BN7A 4G1QA 3FSXA 1RWXB 2PGCA 1UA1A 1KLNA 2ZHBA 2WVEA 5C24A 4NLYA 4QPXA 2E29A 2VODA 1R6YA 3PW0A 1DJ0A 2DNKA 4LIRA 3DLGB 4EFAC 1YHQS 3OV7A 5LMUF 2DNNA 1YWXA 3PYFA 1ULRA 2ASYA 2WSCC 3TO8A 2IM1A 1SL1A 1RAFB 5K14A 3K5MA 1RLDA 4K4ZA 1UJ6A 2FVPA 4ZJLA 5IT9Y 1GTHA 3MEEB 4LVNP 4JI4F 3DMJA 3E8OA 4FYXB 4B3TJ 3ETMA 4C0OC 4QOTA 4NLTA 1U6ZA 3KLFB 2HZVA 4KAIA 4DX6A 4ILLA 1FDAA 2H3EB 5ETRA 3CGIA 2E1CA 4R0EA 1FE0A 1W2BR 2UUBJ 3N9UC 2R3VA 1RDRA 2CA9A 2KHDA 3H7HB 4O3SA 3NCPA 2OPRB 3OTBA 4DQSA 2Y1LB 4EO8A 1K47A 3CJQA 2DNLA 3VAHA 3EXYA 4LRAA 3J7Z5 3GV8B 2J8SA 4I7FB 4AD6A 1ITPA 3G4SS 2UP1A 1V6ZA 3U1LA 3X3UA 2VBYA 2CPDA 3NGDA 1JNRB 2CPYA 4UOGA 2OSQA 4K59A 4LR7A 2EVZA 1FKPB 1RWUA 2QA1A 3CCJS 3KFWX 2HSEB 2KFNA 4PYDA 4YR0A 3D7SB 3JSYA 1VRQC 1ZS6A 3SSRA 5KAKA 3KWMA 4M95A 1M5PC 1RT4A 4U67S 1SJFA 3D6FB 4K50A 4F4XA 3QSIA 4ED8A 3MPVA 3AA8A 3CZBA 1U6FA 2ZUGA 4MFBA 4CO0A 4NRUA 1F3FA 1WI8A 2B8PA 2FJAB 4HR2A 1IVZA 3DRSA 4AL6A 3MR3A 1C4CA 2C2KB 2PC6A 4I2PB 1VISA 1HWKA 4OMFG 3TQEA 2W2OP 3HSGA 1XK8A 3QFWA 1OWXA 3AJDA 4JI3F 1D8YA 4WF9Q 1TELA 1RP5A 2IFXA 1P9QC 5L1LA 4I69A 2OD4A 3GJRB 2OPPB 2VG6A 2HAIA 2HVHA 1RACB 5A0YB 1Q79A 2YNFA 3ZTRA 3AXKA 3BM7A 1S6UA 3FFIB 1IKWA 4Q7AA 1S7HA 3OHBA 4N76A 3VV2B 4ZVEA 2KYZA 2CZ9A 2AW0A 2FGOA 1OQ3A 3KJFB 4MTPA 1LWFA 2YKMA 1O8BA 3NEKA 2DCLA 1S72S 2Z2YB 3CCES 1FJCA 4OYOA 4HHJA 2H54B 2VG5A 4ANDA 3SSQA 4F50A 4C4WA 1RQ0A 3SCLE 3CE8A 4DCOB 5J2NA 1S9GA 2ZH9A 3BDEA 2IM2A 1M5VC 4QU7A 1G3OA 2ZZTA 4U7UK 1IKVB 2X3DA 2HHTA 3N5BA 3LGMA 2EKYA 5IM0B 1S1WA 2LU1A 3D6HB 2B56A 2ZH6A 4ELTA 3SBMA 3DOKA 3TA0A 3HJVA 2CQPA 2I5JB 3R5CA 2YKNB 1VJQA 2NPIA 4DQQA 1QAYA 4B3TF 1S1UA 1Y0HA 3MWBA 3GIJA 4USHA 1HPZB 2JFKA 4DQRA 3HT3A 4ILRA 1YJRA 1N5VA 1T9WA 3U7JA 3R8YA 4A8FA 2UUBF 4Q8EA 2HHXA 2COLA 1U1QA 4AXIA 2CJBA 2E1MC 4IO9Q 5F8LA 3CF5S 5GAHW 1FNOA 2WONA 3B82A 3CCTA 3HF5A 2JNJA 3MTKA 3EDRB 4RW6A 1HBNA 4LFAJ 2ADBA 3DOLB 2W4PA 3QQCD 5L1IA 2EFPA 1N56A 1HBOA 3Q8PB 5B0CA 1JLBA 2AP6A 4J91A 3CCWA 2ZKUA 2E66A 2QFIA 2VC0A 3HSZA 2ZC4A 1RK8A 4HHUA 1HI8A 4EBDA 4FBTA 1RT1A 4ANEA 2QMUB 1R89A 4R25A 5T7LA 1B7YB 5KT6A 2XMVA 3I9ZA 4O0IA 4DEZA 4JYAJ 4IUFA 5DM6Q 2V5HG 4WTOB 1UMJA 3IBFB 4OX6A 2GVZA 1UVNA 3CC2S 1REGX 4F8RA 3EMTA 3CCMS 4DL3A 3FBCA 3CJSA 4ZP7A 1C1BA 5L46A 4C6AA 3HHLC 1GT8A 3OR1B 4OHVA 1GMUA 3QGHA 4K4VA 3AT1B 4EU0A 1U2FA 3JXOA 4CH1A 2IA0A 3KK1B 3MR7A 4USVA 3K89A 5IZHA 2YX7A 5E3QA 3DLKB 1HYSB 3Q86A 1HBUA 2YQ3A 1SUQB 3QLHA 2W9BA 3I31A 4JV5F 2IDLA 4ZVPB 4M5LA 5LXYA 1YJTA 3I4HX 2RHQB 3QT7A 2XO7A 1RXOB 4ZHRA 2HHSA 1K0VA 1T02A 1QDUB 3T1HF 4DL5A 4PR6A 4YN3B 1PC5A 1F9EB 5GMDA 4J9KA 5DQIA 2M88A 2VH7A 2XSJA 4URGA 5IQQA 1R0CB 1VRTA 2APOA 2AWZA 4WFXA 1ZPVA 2DH8A 4Z7CA 1Q1KA 1RLCL 4IFYB 2K3KA 2AKWB 1N33J 4E2FB 1U0HB 1KHWA 4C8KA 1W2IA 2PT0A 1XEZA 3MAAA 4RO0A 4ZVUB 2W7PA 3KNAA 2A0FB 3HCXA 3LGHA 1VK3A 1ELOA 1R31A 2G0IA 1JLAB 4KTQA 2DEIA 2R7OA 1JLQB 1V3ZA 3DLLQ 2YKPA 1DY3A 3CD5A 1TVRB 4FS2A 4MK7A 2UVUA 4EUVA 4WPAA 3CCSS 3PIPS 3MUVP 5KFXA 1HWLA 1SBRA 1UVJA 2VU5A 4JI7F 2HQFA 2D3OR 1IKXB 3KK2A 2GJFA 3MEDB 3GU0A 1KKHA 1QM9A 2ZDOA 3T6JA 3D9BA 3IGVA 4ECWA 3QWPA 2QFJA 3KUEA 2G1HA 3TQ1A 4WYWA 4N8OA 3BO2A 3SYZA 5B0BA 4KIAA 1WC1A 5HLFA 1Y10A 3QNWB 3GFXA 2LEBA 7AT1B 1NPRA 2K06A 5LT5A 1LW0B 4DPXA 2Z4PA 1VQNS 3DM2B 4FYVB 4ZPVR 2YWGA 1S1XA 2RSQA 4LFBJ 3ULHA 1PYTA 4CLLA 4M5DA 4LFAF 1BQMA 2V2ZA 3AH6A 3HLUA 1Y4ZB 1N34J 3C14B 3GIKA 2D69A 5KFCA 2AJ1A 2RB7A 4EZ6A 4ZCIA 2HNZA 1RTDA 1CPZA 5E5NA 2YPYA 2B3TB 1VDHA 1R7IA 4RU9A 2RQKA 3MUMP 2WVCA 3HM9A 3A8EA 4CM2A 1TAQA 5ETKA 3SXLA 3CSKA 1Q0NA 4DR1J 3OL7A 4IQXA 1LQ9A 4N7TA 4NEYA 4JYAF 4JI2J 1OJ4A 3MEGA 4RNHA 2KRRA 1WOPA 2R9LA 1NDPA 2CQCA 2MKHA 4WFBQ 2FHOB 2G4BA 1B4SA 3FK4A 3UCUP 2M4MA 1KVKA 5KFVA 1RT2A 2QA4S 4X4UA 3DU6A 4J5OA 4ZIWA 3HHLB 5IQ6A 1S1VA 1KVJA 1WOOA 3IBCB 3NMRA 2IJRA 2C2MB 1KQKA 1R8HA 2AJFE 1F60B 1VOMA 3OR2B 3MI7X 2RQMA 1XMQJ 4CLYA 3GFZA 2D41A 4RPFA 5I3UB 1R43A 1SKRA 4OX7A 5DGAA 5GAHI 2DB1A 1N5QA 5ETNA 4JV0A 5K8MA 5A8RB 3KLIB 1CLFA 1DRZA 2MLYA 5KG5A 1PCAA 3V4IB 2DNOA 4CLWA 1NK7A 2VA2A 2Y8WA 3M2RA 2NXEA 3FJ2A 5HP1A 4ED0A 1NCLA 1TL4A 2HMIA 4LBHA 1ICEB 4OJHA 2GGPA 1ZA1B 2ZH4A 5DGBA 1PYOB 1QJHA 2G2OA 2MZ1A 2Q6BA 4DMZA 1EB0A 2FQQB 4CM0A 1N33F 1FNXH 3I87A 1FX4A 3BGFA 3PYDA 5EHHA 1FTCA 2WOMA 5CA5A 4YQWA 5GMEA 4OZ5A 1NAQA 2E9TA 4WFNQ 4QPTA 3DRYA 2CJ9A 4QYZJ 2WAQD 1C1CA 4K4SA 2CQDA 4RNMA 3Q8RB 2LQ9A 2ZH3A 4KO0B 3P6YC 1YJ9S 5LSOA 4PQUB 1X5PA 2DNMA 2PE8A 2LXUA 2WRMA 1T05A 6FDRA 4HYKA 4OZ3A 4K2XA 3AA9A 3EDQB 3UVJB 2UXBJ 2BE2B 4DG1A 2ASDA 2YH0A 1GH8A 2KVQE 1RT7A 1GQEA 3SCIE 2XNRA 2K1RA 3C15A 3T9NA 5HQLA 2ZFHA 1YK9A 1D1UA 2GV1A 4MIBA 4PPDA 2HYIB 3G6YA 2QE5A 2FD2A 2VBWA 4ETZA 1QE1B 1T11A 4LFBF 3FRZA 4ZPDA 3DYAB 3FCVA 3B4DA 3K2YA 3TNVA 1N34F 1VQLS 3MMJA 4O4GB 2GIRA 1H2TZ 5F8MA 5IWAJ 4DF8A 3D54A 2XMJA 3MPUB 2R8HA 1WC6A 1ZBTA 1FT8A 3KLHA 4Y2KA 3ITHA 2DNHA 2PA3A 2GVDA 2C3PA 3SV4A 3DRPA 3GIRA 2J0SD 3PM9A 4C8MA 3UDEA 2FZKB 1KD1T 1QSLA 4DR1F 4X64J 3HHEA 5CZVA 2XWXA 1K1QA 1JLFA 2OUGA 5KFSA 5JJBA 2G9OA 2NSCA 4JI2F 4DV3J 2R7WA 4QU6A 3MDFA 2MZQA 3FC9A 4NE9C 2QT7A 2L48A 4RUAA 1VRUA 1RGVA 3QBCA 3IN5A 5HVFA 3ET6B 3F0NA 4LFCJ 1EIYB 1H6KX 2KDOA 2HVDA 1BGXT 2CJYB 1B3TA 3WC0A 5AE2A 1HR0J 2VFRA 2B9YA 3MOJB 3C16A 2QA4G 3M8PB 4GKKF 2OHDA 3KLVA 4I0WA 2VJUA 4JI8J 1XNRF 3EYZA 2M5YA 2MQQA 2UUTA 3RAQA 1WNEA 2C2EA 1SCJB 3EPIA 2ZJRS 2P9EA 2HIQA 4C48A 4PABA 4C9DA 2M52A 2XWYA 4FS1A 2XS7A 3LTOA 2W2MP 4CLKA 4RNOA 1FJGJ 3FUYA 2L41A 3H90A 3T5KA 3TOQA 2FVCA 5JVGS 1FK9A 4JI1J 3PW5A 2XTJP 2CJXB 4Q8FA 1A6LA 2BXJA 3GR1A 4RW4A 1GTEA 4QIGA 4F4AA 4CLPA 5D4OA 1IBKF 4FNHA 2DNGA 3H42A 1KP6A 3ZZZA 1HBMB 4GVBB 3R5BA 5KG0A 1RA6A 1JK9B 4RW9A 3OTOF 2QSFA 3PV8A 3OUYB 4Q2MA 1NXZA 1E6YA 3EGNA 1QRTA 3HHNB 2H5IB 3BBFA 4DV2J 4F26A 3RW6A 2DR6A 1RHJB 1XR6A 2W01A 1T7PA 2A10A 4G65A 1PILA 2IRUA 3GR0A 1NK4A 3SQOP 4J9NA 2J9EA 2HURA 1WI6A 2E7WA 3QRQA 2C3UA 4V194 1BXNA 3KJVB 3VAIA 2HBYB 1S6QB 2I0XA 2VDHA 3C6TA 2D3UA 4LUBA 4OYMA 1DHMA 3Q23A 5D8HB 2BABA 4WP3A 3ZTPA 2EFQA 3SV3A 3UN5A 2VJVA 2UXCJ 2D1CA 4OYXA 4WJBA 3W8GA 1CS4B 2WSFC 1VBKA 2IVYA 4HH0A 3M1VA 5E33A 2WHOA 2HGMA 1B70B 1Y9OA 2XY6A 2XMTA 4CO2A 2VC1A 3PKYA 3GJSB 1AXQA 3M9OB 1H7XA 1FWLA 2PNWA 4ALZA 5GAGU 3R5GA 4PG7A 4WP8A 2XMMA 4TQRA 4N77A 1ZTTA 5MLCV 2VB6A 4L3NA 4WFAQ 3H59A 2RRNA 5KFWA 4ECRA 2BANA 4X64F 1NYLA 2RF2A 4K4TA 4LF1A 2ZH1A 4X4RA 2K7JA 1ZM2A 5M2UA 1VQ8S 2XULA 2HGLA 4CLTA 3Q24A 3QIPB 5IC6B 3J7YI 3CDBA 2CQHA 4QQBA 3UDLA 1L3SA 3UD4P 2GQCA 2GFFA 1UP1A 4NA3A 4EYHB 4DWIA 5DDOC 4LFCF 2YH1A 1FHTA 3MPYA 4DLGA 4A48A 1JJ4A 4PKDB 4MIAA 1BWEA 3GIIA 2VFUA 3CJ2A 2LYVA 1HL6A 1VHIA 3IRXB 1U45A 2ZH8A 1UW9A 4JB8B 1Z1ZA 1Q82T 2Q79A 5H9EK 3CJ5A 4KJIA 1TUWA 1NNDA 2HQIA 2XLIA 4I6YA 4USUA 4X62F 1KQSR 3BQ2A 1KLMA 4F36A 2I8EA 4E8BA 5LMNF 1FJGF 3H5XA 1T9YA 2CYYA 1EUYA 1S6PA 3VR1A 4QR2A 5ETQA 1HHSA 4IOCQ 2KG1A 2RRAA 3AD7C 4NLUA 2M9KA 1QVFR 1E6VA 3G82A 1I6JA 3G86A 1S59A 4IOAQ 3KDNA 2A18A 4WFYA 3KUGA 4F2RA 3RB6A 4NCGB 3GSIA 2KG0A 2NXCA 4YR3A 1AT1B 3A13A 3US5A 3FEZA 3NGKA 1LW2A 4X4SA 3HJFA 3MM6B 3M32B 3W9HA 1IBLJ 2MJNA 4DLEA 3I0RB 2V69A 4AYBD 2ZC3A 1UPPA 3U27A 4Q5VA 2HWHA 4DPUA 1TL5A 4FF4A 2JVRA 3OL8A 1S4EA 4ED7A 4USMA 3GV5B 3CD6S 4IDKB 2FDNA 2AE0X 3V6KA 2WK4A 2QTWA 2CNLB 5HMZA 3GYXB 1U48A 3LQVA 1MLAA 4RBUA
chains in the Genus database with same CATH topology
3Q2SC 3GMGA 5A8KB 3CIMA 1RT6A 4OZ1A 2VQEF 3TAQA 4KHPF 2WB1D 3RBEA 2IM3A 4R5PB 1U49A 2VD3A 3IWXA 5L39A 1SJ3P 3ENQA 1JLEA 4Z2XA 2ZH7A 1RT5A 1XN9A 2BVZA 2E1AA 4OHXA 1NRKA 2W9CB 4LMZA 1MU2B 3CDAA 1N6QA 3TYTA 5SZTA 2UXCF 1NZAA 1FDNA 3PFEA 4ES3A 3KLEB 1OIAA 2HLTA 2HQ3A 3OR2A 2IMOA 4RBTA 2YVSA 5M2PA 4D3HA 2B0GA 5F9LA 3MFHA 1O5JA 1MWZA 3THPA 4EGLA 2DVIA 3MPWA 3CB4A 1BQNB 3IRXA 2VPXB 3ISZA 2YWHA 4H4KC 2ZBIA 3E51A 1JWWA 1UFWA 2DNRA 4N8NA 5KFLA 5J1PA 2NPFA 2DGOA 3NBPA 3IA0A 4KHRA 4NLVA 3KHRA 1B0VA 1S1TA 2PMHA 1NKEA 2CQBA 4YUDA 1HNVB 2AV5A 4P2BA 2Q43A 4KBIA 2MPUA 2OPSA 3LANA 1NK6A 1Q4RA 3FNNA 1H38A 3IS9A 2PEHA 1C2PA 1ZAXA 4G1QB 1YITS 3GQCA 1MWYA 1LWCB 2ALZA 2IRXA 3TAMA 3S8SA 1N48A 1TKZA 1S9EA 1NK5A 2FGCA 1VGYA 3LO3A 2QO3A 2ERRA 1Q7YT 3MXHP 4DN0A 5C24B 2EPIA 2BYCA 3D0GE 4MKAA 1ZPWX 2XMKA 2XY7A 4DQIA 3G6VA 3M30B 2CPZA 4K5SA 2OAUA 4ZKAA 2W8KA 3GYNA 4OLOA 2AJQA 1HQEB 5T41A 1Q16B 5G4DA 2QA2A 3L7OA 2FJXA 2DITA 3ISNC 2DIUA 1JXEA 4RNFA 2YNHA 5AXNA 1RYSA 2ZNYA 3OTDA 4QIWD 3LP2A 2WTFA 1QLNA 3IC1A 3ZZOA 2VL1A 2ZHAA 2PMZD 1KRPA 4ECVA 1P8GA 4ZPTR 2J0QD 5AXKA 1DQ8A 4DDFA 1XR7A 1BC6A 5FLXY 4V19J 4M1KA 1X4AA 4TKTA 3F56A 1X9SA 2ASLA 2DO4A 1SJ4P 1RKIA 5K14B 2B7BB 1X7VA 5B0GA 4BDPA 1S0MA 2R7XA 1UVIA 2FUG9 5HI7A 2VUGA 4NCGA 1ZM9A 3K5LA 3PEJA 3HVWA 2YY3A 4WZQA 1RAJA 1X9MA 1X5OA 2B4UA 2W7AA 3DMJB 1NK8A 2G1DA 3CULA 2EFOA 4NCAA 4X4TA 3NNCA 4XIUA 3I5CA 1DLOB 5KFRA 4TU8A 4TY8A 2L9NA 4FVCA 2HS3A 1R8AA 1FD8A 2W4DA 2XB2D 4JI5F 2AX1A 2D9OA 1EP4B 3H8YA 4WK1A 3J7YU 2KTQA 2VQFF 1SJRA 2J7UA 2KH9A 4LF6F 2HLUA 5BYRA 4B9SA 3IAM9 2W25A 3V2UC 4QWEA 1L5UA 1IUJA 4IFVA 2U2FA 3GFHA 5HBMB 3H4DA 1WF1A 3MM6A 4Y00A 1M5KC 2R2SA 1FRXA 3M32A 2LQ5A 1XMQF 1WACA 5CYQB 4CNZA 5DM7S 4KKOB 3HX9A 5A8WA 5HROA 1VBYA 3UPFA 2NZ4A 4D3GA 2MHEA 4OI6A 4IRKA 2BQUA 2IRYA 3I0RA 2CVEA 5HO4A 1ZM3A 4WFBS 1L3TA 4RW8B 4ED2A 3QO9B 3BSAA 3D1OA 2EW9A 4QR0A 1BY9A 5B09A 2OSRA 2GMHA 4H4OA 2ROPA 2M7SA 4GKJF 3GG1A 3AQOA 3H5SA 1IKYA 4A46A 4ZCMA 1DBDA 2OLWA 4KV8A 3VAJA 1TKXB 4ILMA 1FESA 3AB2B 1TP7A 1G6BA 2FLLA 3HVTA 4KHMA 3PX4A 2B6AA 1B64A 1YVFA 3GV7B 3L95X 4LIWA 1HMVA 2NQPA 4JXXA 2H5EA 3DRXA 2HPUA 2YNGB 4ZCLA 4IDKA 1Y3JA 2LU2A 2RILA 2LDIA 3MMBA 5KFNA 4CH7A 2V8DA 2VPWB 4EWTA 3FGVA 2KM8B 1Q86T 3OLBA 2ZH5A 3SDEA 1WEXA 3ZFVA 4FF3A 4LF8F 3OVBA 1N0VC 3FSIA 5L1KA 2XLJA 1H7WA 3THTA 1VK8A 4C8LA 1UETA 1AW0A 2MYFA 3CJ3A 4BBYA 4GO7X 4WU3A 4ZDNA 2M70A 3CVKA 5A8KA 4Y2IA 4TN2A 1K9MT 4Y6IA 2VONA 4GO5X 2N7CA 3LP1B 4R5PA 4JOUA 2W9CA 2Z0GA 2XBPA 1MU2A 4ZP8A 5ADZA 4CZCA 2MY8A 3CO9A 2RJZA 5KG2A 3BF4A 5I3QA 5A6WA 3SSSA 2DRAA 3OHAA 1D6KA 3GSDA 4XDCA 1X4CA 4G1PA 4NYPA 3LW5C 2CZVC 5B0EA 4UUWA 5KFJA 4DF4A 3CJ0A 3NAHA 1BQNA 2XG8A 4X2BA 2J9CA 3S01A 2L08A 1VQPS 3BGUA 1A9NB 3R3TA 4WCEQ 2GIQA 4DQPA 1H3DA 2IHR1 2BV3A 2DK2A 2LXIA 3CTRA 3G8QA 5FDLB 5IT4A 1UFLA 1VQOS 1HNVA 2ZJQS 2O1PA 3KK3B 1F0XA 1HD0A 1W25A 2VG7B 4IG3B 4OFZA 4XPCA 5F9NA 2Y1IA 3KLGB 3BN7A 3VQSA 2CPEA 4I6WA 2LECA 4G1QA 4DSIA 1RT4B 1LWCA 3FMBA 3V6HA 1KN6A 2ROEA 1TFWA 2MJUA 3FSXA 2K3IA 5K8PA 2PGCA 4U7CA 1UA1A 1KLNA 1Z4UA 4NPOA 2ZHBA 1IBLF 5A6PA 5C24A 4F4ZA 2P6TA 5B0AA 4NLYA 4QPXA 3FVYA 3VAKA 1M5HA 1ZAVA 2FJBB 4LJMA 3M30A 2E29A 2O67A 4MFBB 2VODA 1R6YA 4A47A 1HQEA 4PQAA 3RAMA 1V3RA 1R8BA 2MZJA 3M9NB 3PW0A 4RWWA 1DJ0A 1IJEB 2DNKA 5JVHQ 4CT9A 4LIRA 3DLGB 3TVZA 4EFAC 5KFOA 1U24A 3W2WB 3DRSB 4BCAA 2QYCA 1YHQS 3G6ES 4WE1B 3OV7A 3O5TB 5LMUF 2DNNA 1FVQA 2HNDB 2J5AA 2R2UA 1TQLA 3DLJA 5CYJA 1WD6A 5EX3A 1GXTA 1REVB 4A8QA 1YWXA 1R0AB 5D4NA 2CPXA 2KI2A 1ULRA 2ASYA 2WSCC 1JXLA 3TO8A 4I1TA 5KFFA 2IM1A 2Q1LA 1WEZA 2UXBF 1SL1A 1YBAA 5K14A 4JI6F 4A8YA 2X1BA 3K5MA 2Q3PA 4K4ZA 1UJ6A 2FVPA 4WK3A 2VZ9A 3R5DA 5C25B 5J2PB 5IT9Y 4B9VA 3T9ZA 1GTHA 4TU9A 2R7VA 1LV5A 4C8YA 3UR0A 3MEEB 4LVNP 4JUZA 3TUIC 4DFJA 4C3MA 4JI4F 3DMJA 3E8OA 3N01A 2X1AA 4NWBA 1YJNS 2RQ4A 2J8AA 2VG6B 2MMYA 3ICLA 4JI0F 3ZZTA 1DLOA 4OI1A 2W8LA 1P1LA 1EP4A 4C0OC 4QOTA 2XCPA 5E0OA 4YMEA 2YNFB 3MURP 3MM5B 2R8GA 5F41A 3E3XA 3KYLA 4J9SA 2MKSA 1X4EA 4NLTA 2OH2A 3F44A 1U6ZA 3HP6A 1RYRA 1X4HA 1D9AA 5EN1A 5HBMA 2B9WA 3H5UA 4FP9A 3KLFB 4AL5A 2DGVA 4KAIA 1IKWB 2DBBA 4ILLA 1FDAA 5CYQA 5B0DA 4KKOA 4CNYA 3CGIA 2E1CA 4I2QB 2CQ4A 5KFKA 4R0EA 2JC0A 4RW8A 1FE0A 1W2BR 2QRRA 2J6UA 3N9UC 1VFJA 4RZRA 5J1EB 4N41A 3V6DB 4MYUA 4RBVA 1RDRA 4BWJA 3BQ0A 2KHDA 2OMOA 1LWFB 4O3SA 1NJYA 1KQGB 1KTVA 2YKMB 4B3RF 3NCPA 4QWAA 4MK8A 3Q22A 1TKXA 1RTHB 4E8UA 5IWAF 2V9KA 2OPRB 4OZ0A 4B17A 2VG5B 1L3UA 5KFBA 3OTBA 4DQSA 2NUUG 3OBIA 2V4RA 1QY7A 4FXDA 7FD1A 4O44B 2YNGA 1DURA 5DRKA 3D2WA 4NYOA 4RKUC 5JUMA 3LPYA 1YIJS 4ZMMA 5LSRA 5L8RC 3IG1B 3LAMA 4JBCA 5J2NB 4EO8A 1S9GB 2HFOA 4TLQA 5BJRA 3RZAA 1MMNA 3VWSA 1QAIA 5L38A 1FRHA 5F8JA 2ZM6F 4F3MA 5DO2A 3R27A 1VBXA 4Y2AA 2DNLA 3RRKA 4E0DA 2RS2A 4NLQA 4YDDB 1FRJA 3MHYA 3VAHA 2D7SA 3EXYA 5AE1A 1TK5A 4V19X 3LP1A 4NZ0A 4JV2A 2HNYB 3J7Z5 4P7VA 3GV8B 1TL3B 1R8PA 2ZZMA 3RR7A 2Z2MA 4I7FB 2DR9A 5GADI 2QIFA 2B7CB 1S1WB 4DV3F 3JSRA 3D1QA 3G4SS 2ASJA 2XLKA 1NHUA 4ERDA 2UP1A 3KKFA 2KYXA 1N52B 3U1LA 2L3MA 1TKTB 3X3UA 2VBYA 2CPDA 2DCUB 5F8IA 3DOKB 3NGDA 1LXNA 1JNRB 2CPYA 4MK9A 4KGMA 3TARA 1FD2A 2BJEA 2OSQA 3BR9A 4K59A 2RNEA 2W24A 4KFBB 3BREA 2LMIA 2EVZA 1FKPB 2A3JA 4DV4F 2E5GA 1RWUA 3K5OA 5J2MB 2QA1A 3GIMA 3CCJS 3W2VB 3KFWX 4I56A 1S1UB 2CPJA 3FDSA 1ZETA 2KFNA 3DHXA 4YR0A 5FDLA 4F25A 1TV6B 3JSYA 1VBZA 3KK3A 5DM7Q 1VI7A 2VG7A 3D5MA 4IO1A 4IG3A 3SSRA 5KAKA 1VC6A 4DG1B 3U02A 4HLBA 3KWMA 4M95A 1M5PC 5IS2A 1QSSA 2DTJA 1HR0F 2AYMA 1RT4A 4U67S 1SJFA 2UVRA 1GX5A 2JLEA 2KU7A 1UDXA 3QAEA 1AUDA 2AU0A 4K50A 4LSNB 4F4XA 1Y5LB 1Z2ZA 4ED8A 1D0EA 3PRBA 3MPVA 3AA8A 2I2YA 1DZ5A 4JI8F 2FB0A 1LFWA 1U6FA 2ZUGA 4MFBA 4CO0A 4A8XA 3DNCA 2QEXS 1TZ0A 3QYYA 4HI1A 2A2CA 4NRUA 2FVQA 1KVIA 1IR0A 1WI8A 4TYAA 3DLGA 2RQCA 3BDPA 3AAWB 1YJVA 4UY85 1VQKS 2R7SA 2FJAB 5KFZA 5KOXA 3W2WA 2OIHA 3DRSA 2N82B 2DR8A 4AL6A 5K9FA 2O01C 4WE1A 2HW3A 2HNDA 3NKYA 3MR3A 3QJPA 2WONB 1REVA 2QMXA 1C4CA 2PC6A 3K7RA 1R0AA 4I2PB 1N88A 4DV0F 3T5LA 2YTCA 1HWKA 4OMFG 2HRYA 1XK8A 4RW6B 5D4PA 2EI5A 1HBNB 4QWDA 1OWXA 1SKSA 4JI3F 3T19A 3KJVA 3ZZUA 1D8YA 2PFFB 4WF9Q 5J2PA 5C25A 5HMWA 1RP5A 1UEUA 1NK0A 3DCAA 5DDRC 2IFXA 1Q78A 1P9QC 5L1LA 3MEEA 3DLHA 1U7LA 4I69A 3RB3A 3DLBA 2OD4A 3PKMA 2RUGA 4F4KA 1HBOB 1KOHA 2OPPB 3KG4A 2VG6A 5MAOA 4Y34A 2V4QA 3EGZA 2HAIA 1JLBB 2QSWA 4HEA9 5CQGA 3TA2A 2HVHA 4JI1F 1NH8A 2J0XA 3R1HA 2F8EX 3FZBA 1RISA 5A0YB 4Y0FA 1Q79A 2YNFA 3MM5A 3ZC4A 4DV5F 1T3NA 3I5BA 4OIXA 2PA8D 5GAEU 2HWTA 4BHQA 3NG8A 2ZOFA 3DDNA 3BM7A 3DOMA 1WWHA 3KLFA 4KRWA 1S6UA 2M2BA 2DPJA 1RT1B 3FFIB 1IKWA 3S1TA 2VPYB 4ZP9A 4AE5A 2ZJQQ 4Q7AA 1S7HA 1KEKA 3GWCA 3OHBA 4N76A 2B4OA 5H1SV 4I2QA 3JB9k 5T7LB 2EFGA 4H4KA 4ZVEA 1VC0A 2KYZA 4XDDA 2AW0A 2FGOA 1UL3A 3K5PA 4LF7F 5J1EA 3V6DA 1OQ3A 4PPZA 4DSJA 2K2PA 4MTPA 4BC9A 1LWFA 2YKMA 1O8BA 4HDGA 2LLZA 2WB4A 3KG1A 3LP0A 4OV1A 2LXFA 4ZVGA 3IAS9 4DUYF 4F4WA 2DCLA 1RTHA 3OFHA 1S72S 1K8AT 1FJCA 3CCES 1U1PA 2OPRA 4HHJA 2AYBA 2VG5A 2D3ZA 1QRUA 5B7WA 3MAHA 3SSQA 2AJ0A 2WCXA 4F50A 3MTJA 2HWIA 4O44A 3H4BA 4C4WA 1C1BB 3THVA 3AJ1A 1RQ0A 1NU4A 5H9FJ 2C28A 4WXWA 4X4VA 5CHCB 3SCLE 3CE8A 3NCQA 1ZZFA 3IG1A 5J2NA 3O1LA 4C7QA 2GX8A 3SMZA 1S9GA 4Q44A 1D3WA 4DV2F 1LXJA 3DDKA 2CQ1A 2XI2A 3BDEA 3I32A 2IM2A 3H25A 2ZH9A 1M5VC 4FBUA 2EC0A 4QU7A 3N6LA 1G3OA 2QLXA 2DIVA 3I9V9 4U7UK 2MSSA 3RW7A 4Q2LA 1IKVB 5KT2A 2DD8S 2HHTA 2VBZA 3N5BA 3LGMA 2HNYA 2MQLA 2AX0A 1K73T 1TL3A 2EKYA 1DTTB 5IM0B 2R8JA 1S0NA 4WZMA 4I7FA 4ECZA 1S1WA 3UCGA 2LU1A 2VOPA 2VV5A 3PNIA 1HNXF 3DLLS 4C3LA 2B56A 2V4JB 1TKTA 2ZH6A 4ELTA 2DNYA 4TYBA 3DOKA 2V9WA 2BZ2A 2VASA 4N5SA 3TA0A 4B9NA 1HBUB 2KFZA 2BQRA 3QLHB 2CQPA 2W9BB 3EUNA 4KFBA 5BYQA 2I5JB 1JB0C 1FKPA 2X1GA 2YKNB 3R5CA 2MQPA 5J2MA 1FEEA 1G1XA 2NPIA 3W2VA 4DQQA 1QAYA 4HTIA 4J9OA 4B3TF 1S1UA 5F3TA 1Y0HA 4UY8T 5U47A 3MMAB 4DSEA 3MWBA 4OL8A 3PJWA 3GIJA 1CQMA 1TV6A 4YB1P 2LVWA 3ENVA 1YGYA 2KKHA 4USHA 4ECUA 1UJ4A 3MOZA 4HTJA 1WHYA 1HPZB 2ZVSA 4ZHRB 1NJZA 2JFKA 4MAKA 1U1RA 4AFFA 4KGKA 3X1LB 4DQRA 3HT3A 3NMAA 4Y2CA 2ZKTA 2DR5A 4J37A 4C8ZA 4LSNA 1ZTWA 1Y5NB 1XTZA 1UAWA 3I4PA 4IR1A 4ILRA 1N54B 2F8MA 2CIMA 3I82A 1YJRA 1N5VA 2YNIB 2XSJB 1V3SA 3DFEA 1AFIA 2FJWA 3AY0A