3X1LB

Crystal structure of the crispr-cas rna silencing cmr complex bound to a target analog
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
319
Chain Sequence
MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLSREKKVVEEGMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the CRISPR-Cas RNA Silencing Cmr Complex Bound to a Target Analog
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Rna binding protein/rna/dna
molecule keywords CRISPR system Cmr subunit Cmr2
total genus 64
structure length 319
sequence length 322
ec nomenclature
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3x1lB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3x1lB03
3W2WB 3W2VB 3X1LB 4H4KA
chains in the Genus database with same CATH superfamily
2YNGA 1QUPA 2HNDA 1PYTA 3D6HB 1F5BA 4K7QA 4B9VA 2O5DA 4H4MA 4QWAA 3CULA 3AD8C 4H4KC 1HMVA 1RT2A 5T41A 3K58A 2RQ4A 1KKHA 1RBAA 3TA1A 1S12A 1HNVA 2B4UA 3GG0A 1MG7A 2AJFE 2HWHA 2QL7B 1N0VC 5D4NA 1S10A 3BN7A 2WVEA 2CJQA 1L3SA 1K9MT 1RT3B 3UO0A 3NKYA 2E66A 3G9CA 1Q4RA 3PV8A 5EWFA 1HQ2A 4HHJA 1AZSA 2UZAA 5HROA 3FBFA 3OPKA 1WWHA 4JBCA 2CPJA 5ETNA 4EO8A 2X1AA 2H51B 3M8YA 1F2GA 5KOWA 2V2VA 3TOQA 1NZAA 4R0EA 4O0NA 1BQXA 5IT4A 5L9NA 4PXDA 2WB4A 2HMIA 4JV2A 2R7XA 1VQ8S 4LF9J 3PKYA 3R5CA 2GAGC 5M2PA 3OVSA 3V6DB 1OY8A 3GFYA 2X1FA 1CBKA 1NH8A 5JVGQ 1FK9B 1R8AA 1VQ9S 4RW7B 5LXYA 1JK9B 1CQMA 1N48A 1WI6A 1RB0A 1WOOA 1UWAA 4B3OB 3AJDA 1SIZA 2BJ9A 2OD6A 4K59A 3FEXB 3I5BA 1B99A 4M5MA 1X4CA 1K8AT 1IKYA 3GONA 2B43A 1GFWB 2F63A 1LEOA 3M8PA 1U2FA 2ZBCA 3MR7A 4M5NA 4C48A 5LMNJ 2LKZA 3TARA 3CEDA 3MM8B 1LWXA 3DOKA 1VJQA 3M8WA 3NWGA 2HKEA 3QYYA 1QDUB 1S57A 3HI9A 1QD1A 3Q86A 4KY3A 5HMXA 3FDSA 2K06A 2K3IA 2ALZA 1VGYA 2KJVA 5A8KB 1DURA 2QSFA 2A3JA 1WC1A 2MLYA 4Q8EA 2KT2A 2CNKB 2YWFA 3C8YA 1W7WA 2R3VA 3MEDA 2C3YA 3MEKA 2HZVA 5KFYA 4A8YA 4LF4F 1NAQA 2KG1A 3GG1A 4WFXA 3UD3P 1KNZA 1TKZA 3FFIB 3GSDA 2ZHBA 4GC6A 2G6GA 3CJRA 1EX8A 3CUNA 3HK2A 3BREA 5HBMA 2GX8A 1HBMA 3PO5A 1URNA 2UUBJ 3G6XA 3KLVA 5DM7S 2Z0GA 2VQFF 4J9KA 5HQ8A 1R8BA 4WYWA 8AT1B 4ZVOB 3D1HA 2ASDA 2QG9B 5LOQA 1T3NA 3DC2A 4RJVA 2HFSA 2JZ5A 3DI6A 2CPZA 2DGOA 3QGGA 3C6UB 2G0IA 4DUZF 3L4BC 1M5PC 2HQDA 4KO0B 1W2BR 1H38A 1TL1B 2V6AA 2Q6CA 3SFUA 3RGIA 1QAYA 3AOAA 3R6GB 3ZTOA 2W1BA 4C8YA 4K4XA 2XQCA 3H5SA 4C8MA 3G8TA 5KT2A 2VPWB 1KHWA 1Z4UA 4NYPA 1HWLA 2C2EA 2E5LJ 5F8GA 5J2NB 4JI1F 2FHMA 4ED7A 1HI0P 2WAQD 3ZZ0A 4UTGA 2EBEA 3PRBA 3KDNA 3RAMA 3R7BB 1SUQA 4IFVA 5B0EA 2DR7A 4IOCS 4F3QA 2MZ1A 2HBYB 5EX0A 4J9VA 3GZ7A 1VR6A 4PABA 3EVOA 1O6XA 2AKWB 1Y9OA 1VQKS 4K4ZA 1RZMA 2RT3A 3C16B 4Y2CA 1U45A 3G86A 1Y3JA 3IRXB 3ICLA 3MEDB 2VKZG 3X3UA 4C3LA 2FLPA 1IBKJ 5KFFA 1RA7A 3F0NA 3LGHA 4A48A 2VICA 5KT3A 3AA9A 2DH8A 4ECXA 4ED0A 4C8LA 2DH9A 3AJ1A 3KFWX 3WX4A 4DMZA 4P10A 2XMMA 3NAIA 4ATNA 5EDWA 3HO1A 1LWFA 4ZVRB 1JLAB 2W4PA 3BEGB 5A6WA 3EZ5A 3GV5B 1M90T 2CQGA 1XMBA 3LP0B 5IFMA 2HYIB 2GJIA 2HRUA 4GKJF 4WKRA 2ASJA 3SYZA 1FWKA 2W4CA 2XMUA 4DFPA 4NCGB 2VV5A 5HP1A 1HNWJ 4N56A 1DFDA 1Y5LB 2CJBA 3G4SS 2YNFA 1FK9A 1SI9A 2GVDA 2XSJB 3I82A 4FXVA 3I56S 1I94J 3BR8A 2LQBA 4KO0A 5GAHU 2AZ1A 1JLFB 2R7OA 4U8YA 3NGRA 3KK3A 2UVUA 2EC0A 4AL5A 4FXWA 1YKWA 3AB2B 2BKPA 2F65A 2XBPA 5EGYA 3KHRA 4OHWA 2VASA 3CCVS 4CLSA 3KG4A 1IKWB 3MM9B 1MROA 3DRSA 2JC0A 2I0XA 3CTRA 4MH8A 2LEBA 5J2NA 4RW9A 4IO9Q 2OPRB 4NE9C 1NDLA 4P2SA 2XNRA 4X84A 2YQ0A 2W8LA 3TZZA 2MKHA 3QATA 2K3KA 3MD3A 3RR8A 4R8UB 1ZM3A 2H5EA 2HWTA 4LJMA 3JYTA 4LF8J 4YHHJ 2PICA 5A8KA 3D4JA 2BOAA 2XZTB 4GO5X 5KFRA 4F3MA 1NH7A 1UP1A 4H4MB 5HQMA 1SKRA 2DVIA 1OPIA 2XO6A 2G4BA 2VG7A 1M5KC 3WHIA 2LECA 3IBWA 1QSYA 1TAUA 1NPKA 4LR9A 1NPRA 5A6PA 3I9V9 3MPVA 1HW8A 2J9DA 1RT7B 2EK1A 3MOZA 5AXLA 2WHOA 5IOLA 1IQZA 2IMOA 3HXMA 3SZ2A 1YG0A 4FDFA 4USKA 2Z2MA 1Q0NA 3M2VB 1KEKA 1QVFR 3GU0A 4IYQA 4DFMA 5LSRA 4DV3J 1HNZJ 2WK4A 1S6QB 1BHNA 4LF4J 4OZ0A 2E44A 2ZH5A 1P8GA 4BWMA 1SJRA 1BXNA 3OFEA 4IG3A 1CJKB 3Q0AA 5KG4A 1HBNB 1HNIA 4ED8A 2FVPA 4KPYA 2BW2A 5KG6A 5DDRC 1U09A 4K4WA 4ILLA 1YRTA 4HT5A 4JI6J 2MKIA 5KFHA 2HWIA 2E5LF 4OZ1A 4ZVPB 1RWMB 4DN9A 3KJVB 2GGPA 2YBVA 4YDDB 3FRZA 1SPBP 2E5JA 2AJQA 2NXEA 4EI2A 2MZRA 3CJTA 3KLIA 2M5YA 2D1CA 2ZOMA 2VFTA 1YBTA 3QIDA 4DJBA 2ZUGA 5FLXU 4X65F 3H5XA 1FVQA 2HQGA 1VQSA 1ZJWA 3OJSA 3MM9A 2LLZA 4ZPTR 4LF9F 5GAGW 3BQ0A 4PG6A 1C0UB 3D28A 2J7WA 5KFXA 3IAS9 2CA9A 2D7SA 3CIMA 5HI7A 4Q45A 3HHKA 3H25A 2VL1A 3JB9k 2DGTA 5IT0A 5IWAJ 3MMJA 1GXTA 3QSIA 3TX0A 2D41A 2HURA 1H0HB 1WHVA 1JX4A 2HVEA 2XMKA 4RL1A 4YB6A 4CYUB 2AEMA 2AF6A 2PD1A 4QPXA 3KG0A 4TVAB 4DXLA 1FJEB 1KDNA 3GWCA 4RBVA 4ANEA 2YH1A 3AT1B 3W66A 5LJ3Y 2VC1A 1S97A 2FJDB 2M2BA 3QBCA 3BV8A 4DV2F 4F25A 2BJ3A 2PDAA 3MMBA 5AE2A 3M2RA 1YJRA 2CPYA 4DX5A 1M1HA 3RUBL 4DUYF 2DGXA 3NG8A 4IFYB 3R5JB 4C0OC 1GTHA 4UOGA 5KT7A 3B82A 2WONA 1OIAA 2LQ5A 4MKAA 1D9AA 5KOXA 2QT7A 1LWFB 1UL3A 1N34J 1B7FA 2IDLA 5DDOC 4ZITA 2GIRA 5FDLB 2W8KA 5DETA 3FNNA 3CCMS 3BPDA 2DR9A 4Z37A 4P9SA 2JVRA 1U24A 4NYZA 3DDKA 2AWZA 4KE5A 4JI8F 3E8OA 4CM0A 1BQMA 1GT8A 4R25A 3C6UA 4NCGA 4EZ6A 5IS2A 1YJWS 3MECB 1SVDA 3OTDA 2R4FA 1JLGB 4QIWD 1R6YA 4QOTA 1HHSA 3MUMP 4O3SA 3FSXA 2HHHF 1O8BA 3EGWB 4IDKA 2RB7A 1DJ0A 4WIQA 2RU3A 2XHWA 2GGPB 2LVWA 1U1QA 1G2EA 4X64J 4A8OA 4PUOB 2VB6A 5DLFA 4RWXA 3X1LB 1IKVB 4NI2B 1S5ZA 3THPA 2CX8A 4DX7A 2ZC3A 3DNCA 4JP8A 4ER8A 5CABA 1MROB 4F50A 3B6BA 5C25B 1T03B 3KLGB 2OPRA 2CZVC 1Q8BA 5KG0A 4B9MA 2ZFHA 1OY9A 4OMFG 5AXMA 4EZ9A 1C0UA 2J0WA 4DUZJ 4EYHB 2C2RA 4FYYB 4U8VA 4A4JA 2BE7D 3B8HA 2OSQA 1RT4A 2CJAA 1CEZA 1EB0A 4CLKA 3IC1A 2ZEJA 3T1YF 3EVMA 4RKUC 3F44A 3H7HB 5HO4A 3M6WA 4E8UA 4ES1A 3FRYA 5D0GA 4L76A 8RUCA 3MUVP 1TL3B 3M8QA 3BF4A 3UD5A 2DR6A 4PWUA 2Q79A 4ECYA 4XDDA 2EFVA 2VOOA 3K5NA 4W90B 4DSIA 2HAIA 2MYFA 5KFPA 4QYRA 2ZM6F 5ETMA 3OLAA 2WONB 4FNHA 3EPIA 2AW0A 1U48A 1JLQA 2DNGA 2YH0A 2NPFA 1FXLA 4NLTA 4TKTA 4QIEA 1VRTB 4BCAA 2B4OA 4OLOA 5D0EA 1AFJA 3C15A 1ZBTA 4ZVEA 4NA3A 3PJ9A 1TV6A 1MMDA 2RQCA 3T5KA 4DUTA 4DX8H 1HPZB 2OPPA 5C24A 2E9RX 2HW3A 4C2MA 3MF5A 2YKQA 3ELHA 2VQEF 3UFCX 3MPDA 2R8JA 2BMBA 4IDKB 2BQRA 2BA9A 4DEZA 4UZCA 1AB8A 1KS2A 2YKPA 3M4XA 1RXOB 1RAOA 2IRYA 3H2LA 1EP4A 2VQFJ 3HVAA 3MDFA 5GAHW 1WSRA 5AXNA 1RYSA 4RO0A 3LP1A 3QSYB 2MHEA 5IZHA 4CI0B 5C25A 1T03A 1PJ7A 4ZIVA 2C2KB 1IR0A 1LWEB 4AT1B 4K5RA 5CD4A 1VBXA 1K0TA 2V8GA 1H7XA 3OSPA 3T5HA 2DRAA 1SBRA 4ELUA 2O66A 2DNKA 2QSWA 1NRKA 2XI3A 2AZ3A 1JQGA 2EEYA 3QGHA 4G1QA 3ZZRA 4DL2A 2J9CA 1WI8A 3OTBA 4HI1A 4B9LA 2W7PA 2V8PA 1RAJA 4Y2IA 2UU9J 1GTSA 1R0BG 4E8BA 3CJ0A 3N01A 4USTA 1B0TA 2F1FA 4D3GA 2E5GA 3J7A1 1FDDA 2DCUB 3C6TA 2CFXA 2JH3A 1V5IB 2MLZA 3MEGB 2VJUA 3SSSA 4WFYA 3M8RA 4CH0S 2MKJA 3CCTA 3EWGA 3EX7B 2G2YA 4NRTA 4PXCA 5LT5A 2Z2YB 1FJCA 1HD0A 1FT8A 3U7JA 1T95A 2LMIA 3I4HX 1NKEA 4LF7F 3DLKA 1Q8IA 3HDSA 2OELA 2YWKA 3W8GA 4B3SJ 4O0IA 2UUCJ 5U47A 2O1PA 1N5SA 1F9FA 2MTLA 4ZDNA 5BJRA 2IYGA 3V4IB 1B0VA 5CQGA 3A8JA 5LMUF 4UOCA 4X62J 1S72S 4CLWA 4ZPVR 5F8MA 2B3TB 1N34F 2CQ4A 4ECUA 4RU2A 3K2YA 4CWBA 2MKKA 2VBZA 1TL7B 1RWPB 2EK6A 4IO1A 3V81A 4WFAS 2XYGB 1JWWA 2OEJA 1WDTA 1EZZB 3B4DA 4KHRA 5E7OB 2OMLA 5DS7A 2D74B 2MB0B 4USVA 1HNXJ 3RRGA 2RDDA 2HRTA 2LXFA 3PR4A 2CDRB 2POKA 1F60B 4KB7A 5EX3A 1G7CB 3TVZA 2IIHA 3EGVA 3KUHA 3GTYX 5DM6S 2DT9A 3SCKE 4CP5A 4DF4A 1N56A 2EBGA 4ZN3A 2YNHA 4TYBA 5DRKA 2R8IA 2F40A 1AUDA 1CLFA 5HL7S 2J0XA 1TKXB 5H9EJ 1CQNA 3FZBA 1O0PA 3ISZA 2XY6A 2Y8WA 3TA0A 4ED3A 4Q5VA 2OAUA 2BKNA 4PQUB 3GE9A 4RW4B 3EVWA 4HVZA 5KFNA 5B0CA 3PX6A 4DSKA 2AEJA 1H2UX 4W98A 1IWGA 1SL0A 2GMJA 7AT1B 1QAJA 3L7UA 4MKYA 1NJXA 1UVJA 3MEEB 1DAXA 1S59A 2H4WB 1VQ4S 4DR4J 4NZ0A 4PPDA 5GVQA 2IC3B 1SJ1A 1A7GE 3OFHA 2EW9A 3LA0A 4WK1A 4ES3A 4LMZA 2WVDA 2ZVIA 1HA1A 4M5LA 2PMWA 2DK2A 3I87A 2SXLA 3BBCA 1X5OA 1NSAA 2GMHA 4NZ7A 2HFUA 3IAM9 1CJUA 2PN6A 3LW5C 3A3NB 3GSIA 3R5BA 3D6FB 2O01C 4Q44A 1MW7A 3NBPB 4DFKA 2DHGA 2Z0YA 1J5OB 4ZJLA 4WE1B 4NEZA 1S7IA 2CUYA 1R8PA 4LBHA 1VRUA 1ZAXA 1GMUA 1TU0B 4O3PA 4ZVGA 5LXRA 4K4TA 1TK5A 4OX9J 4I4BA 3H8YA 2G13A 3U27A 1T9TA 4AFFA 4F02A 2IYIA 1RWNB 4MKVA 1REVB 1NB2A 1NNDA 3LQVA 4ZCLA 5GMKa 4DV1J 2CQDA 5H9EK 2IVFB 1RTDB 5B0GA 4I64A 2NXUA 4TQRA 1GTEA 1EKSA 4DCOB 2YX7A 3UWTA 3JQJA 3GFHA 3W65A 5J2MB 4UY88 1Q8KA 1UTAA 5B08A 2QMWA 3OHBA 5L1LA 3RB6A 4PRFA 1VIOA 1F3VA 4DI6A 3EJMA 4GVBB 3RAXA 1NK6A 4BDPA 1UJ4A 3AXMA 4DQPA 2DRDA 3PEHA 2UUTA 3C66A 4JI6F 2HVIA 4WF9Q 1U0HB 1P9YA 1BE4A 2R9LA 3QT7A 4DG1B 5LM7E 2G2ZA 1SQFA 2B6AA 2C2DA 4CO3A 5BYSA 3TO8A 1ZPVA 3RRHA 2HQFA 3TZYA 1UWBB 2RDJA 3H40A 1RU2A 1R31A 1Y5NB 3OFFA 4YR2A 1ICEB 1W2IA 1NUEA 3MURP 2KXHA 1U8SA 5J2QB 2OD4A 2UUCF 2VA3A 1UVMA 1V3ZA 5KFUA 2LU1A 4UUXA 4F4KA 2QGFB 2Y3YA 2FB0A 2W4DA 2YY3A 1CJVB 3W60A 3N5BA 1TMJA 4X62F 3ZTQA 4AE5A 4JV5F 2GW8A 1WDDA 3Q89A 1JLAA 1SH0A 4HT7A 2KFNA 1CJUB 4J9MA 4IOBA 2V4RA 2FHOB 4OJGA 5DJBA 3N9UC 1EQ0A 1XJWB 4WCES 1RT1A 2NLWA 3KUGA 3RJMB 3O44A 1WOPA 4ZPBA 4U96A 4J7CA 1S1XA 2FQQB 3TANA 1VRUB 1UFWA 4W92B 3S7RA 5B7WA 4TYAA 3QFWA 1NYLA 4JXZA 2RUGA 2BJ7A 3QO9A 1S77D 2J0SD 3Q2SC 2VFVA 4IO9S 4NLDA 1REVA 4PEOA 3I0RB 1CJTB 3US5A 3DYAA 4IKAA 3CCJS 3MUTP 1AT1B 3PM9A 3H5UA 1SKSA 4ZP9A 3PFEA 4FPIA 1QSLA 2MY8A 2ZBIA 2LQJA 3H2UB 1PG5B 5GAGI 2LA4A 2RKIA 4WK3A 4WP8A 1NEEA 2CPHA 3TAMA 3VVUA 4Z7YA 3JAMY 1RABB 2YNHB 2WSCC 2UP1A 4LRDA 1KBRA 1UPMB 1BQNA 1QAXA 3JTNA 5DDPC 4PCQA 5DZ6A 3QJJA 2CG8A 5IT9U 4KHMA 5I4MA 3U1NA 3FUYA 3R3TA 2GHVC 3RZAA 5E2QA 3NGDA 2PIIA 3WBZA 1N88A 3IR7B 4I56A 2DEJA 3ILIA 5C7PA 1B3TA 2F4VF 2IMWP 1D9FA 1FEUA 1X31C 1JIHA 1HWUA 2HBQB 3TP2A 5GAEI 3O5TB 5J1PA 3J80U 3MOJB 1PAEX 4S0MA 5E3AA 2QO3A 3VGSA 4K50A 1RBLA 4GO7X 3UDLA 1A6LA 2OTLS 4DPXA 1HWIA 4XIUA 5I3UA 1RWVB 2W25A 3DLKB 2ABYA 2A18A 4C6AA 4DR1F 1FRJA 2J6SA 4DQSA 3QJLA 1GAOA 5HMYA 2OI2A 1UA0A 3ETMA 4IG0A 2GCFA 3BYRA 4FNIA 4IG3B 1CJKA 2ASLA 4CLLA 4DFJA 1YI2S 3AH6A 1HBOB 3S1TA 3W9HA 3AY0A 3DDNA 5D8HB 4J9OA 1HARA 1FO1A 2QRRA 3IG1A 4HL9A 4KGVB 4JI0F 1HI1A 1X5TA 2FHJD 2NR0A 3CGIA 3ILOA 2ZUAA 5CA5A 1M0SA 4N47A 2NYIA 5KG2A 4NA1A 3IO1A 3M8SA 2FZKB 3G6ES 3LGMA 1KQSR 3FMWA 1YJNS 2GIFA 2VBXA 4L3KA 4RNOA 4X66J 3PYFA 2VFUA 3GYGA 2XLJA 1KVIA 1Q95G 3ZZTA 5MAOA 2QA1A 2DGSA 3DOMA 1MLAA 3MFHA 2I1RA 1QM9A 4OI3A 3P49B 4OX6A 2X7IA 2F9DA 1SQGA 2CDQA 2RKIB 2V94A 3TAMB 3KLEB 2JLGA 2ZJRS 3F56A 3L09A 4ELTA 1U0SA 2E7VA 3BSOA 4ZVSB 2HFNA 2XG8A 2IA0A 1BQNB 5E3CA 1C0TA 1RTIA 2QLJB 3KJNB 4X4UA 3EICA 1S4EA 2BJDA 2UUAJ 2ZJQQ 3MCSA 2IJRA 4PQUA 2W9CA 3AB4B 4CO0A 1B0PA 1WEYA 2B6AB 2OMOA 1GX5A 4OYOA 4WP3A 3M6XA 2FLOA 4ZVUB 2XM3A 2AQ4A 4ANDA 2CADA 4MT1A 2VFSA 2VH7A 2DPJA 4KGMA 2RVJA 3CDEA 3KLHA 1EETA 4K4UA 1KOHA 1HBUA 1W26A 1T02A 2AV5A 1C4CA 2DHXA 4TY8B 3TR5A 3MR6A 2M8HA 4LSNA 1Q86T 4QCLA 5F8JA 2DY9A 2BQUA 2Q1LA 4FKXA 4LR8A 4CO1A 3JXOA 2FHJA 2AGPA 4RW6B 1NLKL 2VDIA 2Z8QA 4K2JA 4ZVTB 2BRLA 2GFFA 2B0GA 2L9WA 1Z2LA 2RU9A 1WEZA 1Y3KA 2MQMA 3CJQA 3NBPA 2W9BB 2GVZB 2E1CA 1FRIA 1M5SA 1ZAVA 1ZM2A 4A8KA 3ETOA 2XMTA 1F9EB 5AXKA 4PR6A 3TEGA 1V9OA 2KHCA 2X3DA 1NJYA 2BANB 1RT5B 1SC4B 2KRRA 4ZPWR 1NK8A 4K0KJ 3EYZA 4JV5J 2P9GA 3JQMA 1Y4ZB 1L3UA 4ZVQB 1HKAA 1DZ5A 2P9CA 2AJ1A 3DLLS 3O6QA 2KM8B 1U1MA 1C2PA 1FVSA 3N4WA 3SSRA 1WHYA 5IM0A 3VAIA 1IBLF 2KDOA 3FEYB 1RTDA 3BS9A 1VOMA 2NSCA 5A8WB 4OYXA 3PYDA 4OV1A 5A2QU 1Y11A 1AROP 3W62A 1HD1A 1AA1B 2ZE2A 4WFNS 2F8EX 3HHLB 2K1RA 2XY5A 2QYGA 2D3UA 3DXSX 4X2BA 3TEHB 1T3OA 1TR0A 4A46A 3DU6A 1QLNA 3QLHB 3T41A 3HJFA 2CQBA 3WC2A 4C4WA 2NS1B 2ZDPA 2ZH3A 1T94A 2V69A 4Y2KA 2W9CB 2B5JA 2V4JA 4K4YA 2OKQA 1AUSL 3EGNA 4LRCA 1YBAA 4V1Ak 2Q43A 3VAKA 4F4ZA 1SKUB 1WKLA 2X1GA 4QIGA 1U8WA 1S9FA 2UXBF 1L3KA 2HNYB 1VRQC 3UQSA 2FZGB 3NOCA 2V8DA 4M1KA 4NYOA 3Q8VA 4RPFA 5I3QA 2DNOA 3D6TB 3M8QB 1WUUA 2B7BB 4TY8A 5K8OA 2DR5A 2R8GA 2PJJA 3ITHB 2UXDF 3CWJA 1IJFB 4NLUA 3DM2B 3KK2A 1Q81T 1NBEB 4I2QA 2V4QA 2DITA 4ZLPA 1SC6A 5L1IA 1X9WA 3A13A 3NCQA 2FY1A 4M5DA 3D67A 1JLCA 4IG0B 3QGIA 3E01B 1JLEA 4QJVA 3LWMA 1SJ3P 2DHHA 1NJIT 4JOUA 4MFBA 1R0AA 1HBOA 4F2RA 3PACA 4YB5A 2XLIA 3H5YA 3JSRA 3H4DA 1CS4A 2C2MB 2G1DA 3N5FA 4O44A 3DGPA 3P3DA 3ZZUA 4U9RA 5KFOA 3DRYA 2KO1A 3C46A 3TUPA 4DPWA 2HHQA 2CQ0A 2CWXA 3RYLA 1SJ4P 1NDKA 1F9HA 3OXLA 4J9PA 1XR5A 3M05A 4DV5J 4QYZK 2DHSA 4DPYA 1TFYA 1YQHA 3SQGB 2UXCJ 1BUXA 5CYJA 4Q2MA 2HHVA 1SQEA 3I4PA 1XMQJ 2XMVA 2JRSA 1JNZB 2LU2A 3A8IA 1TL4A 3PZPA 2PI5A 4GKKJ 5K8MA 3UCGA 4OYWA 1VQ5S 1FDNA 1RCOB 2IPOB 3VZIA 2HHWA 2V9KA 1IKXB 3PW2A 1QTNB 4G65A 1MWQA 3HFKA 3KXDA 1ZZFA 2VKRA 3WDOA 5A0YB 2ZHAA 1G4CA 2IAJA 2FJXA 1P1LA 1NO8A 4LF6F 1N6QB 3G71S 2B4VA 2V0NA 2RAQA 2R7VA 3UN2A 5C2GA 3DRXA 1D8ZA 2XS7A 3BGOP 1RU1A 5F8IA 1VC6A 2PE8A 1N33F 3M30B 3CJSA 2GNKA 2EC2A 2OO4A 1ZAWA 3BBFA 3TYTA 2IVYA 3CD5A 1S1VB 4P7TA 5A8RB 4XTTA 1FRMA 1SC1B 3BKUA 5E5NA 4XO0A 5C42B 2YKMB 3MAQA 3CC2S 2V68A 3P6YC 2IRUA 3VV2B 2MZTA 2A2CA 4RUBA 2WSFC 2XS5A 3ENWA 4I2QB 4Q2LA 2XI2A 4KC5A 9RUBA 1RWUA 1Q82T 5KG3A 2ZH6A 1LOUA 1YGYA 2XCPA 3HHNB 1RE1B 2Z58B 3DDIA 3T6BA 3U1LA 5IV3A 3GIKA 4B3TJ 1LK5A 3OQ2A 4YN3B 1U6BA 2D3ZA 2YKNA 4FF2A 2RNEA 3M6UA 3E2EA 1IBKF 2YWHA 3AJ2A 4BS2A 2JL9A 1NXIA 2DKOB 2RHQB 2C42A 2Y0SD 3IG1B 3P8BB 4OYIA 3SQOP 4FYDA 1CULB 2JDJA 2N7YA 3IR5B 2QL9B 3PIPQ 2CQIA 4DL5A 4TQSA 2AU0A 1KFDA 1KLNA 1ULRA 1FEHA 2R7QA 3DLEA 5CAAA 2HHPA 1DFUP 1R0CB 2HQCA 3THTA 3VVTA 4Y65A 5CYMB 3OXGA 3FCWA 4ID5A 4KIAA 4DR1J 1JXLA 3HHDA 3MMAA 4FVMA 1VI7A 4J91A 5K20B 2OPSA 6AT1B 2GO9A 5J1NA 3KHGA 3KLEA 3L7OA 5CXTA 1P6TA 4XAKA 4ED4A 3MR3A 1RISA 1C1CB 3H42A 4EK2A 4ED1A 3D54A 1D6KA 2BV3A 3QLHA 4USJC 2P2CB 3AXKA 4M5JA 2F4FA 3D0IE 5AT1B 1HHQA 2V50A 1QE1B 4ITSA 5G0RA 2IDEA 3W5XA 5GADI 4DL6A 3EPGA 1S0OA 4E0DA 4JI3F 4HYKA 1GNKA 1JLBB 3R5DA 3VAMA 2AX1A 1RAIB 3FMBA 5HBMB 2HHUA 4KAIA 1KRPA 2V4JB 2J9EA 1CG2A 1ROFA 2BX6A 3D6MB 4X66F 4RUCA 4EBCA 3KLFB 1IM6A 1JB0C 2CZ4A 3O3LA 1Q8LA 3IBFB 3SIPB 1FKPA 2DISA 1F6TA 4K8RA 2BQ3A 3MMCB 4RNMA 3CB4A 3V6DA 1RQ0A 3H0PA 3ITHA 5CH7B 2QZ8A 1E6YB 5F41A 5J1EA 3D2WA 4DR3J 4KR0B 4JI7J 2N3LA 3CCUS 1TL1A 5HN0A 1TTHB 1S49A 2FLNA 4OYPA 3HZGA 1C1BA 2H9ZA 1BWVA 2LDIA 3A12A 2AD9A 4P2MA 2WZ1A 1NXZA 2DNRA 2H1YA 2UXDJ 3NMRA 1UJ6A 3HHLD 3QNWB 2GJFA 2P9EA 1PJ5A 5GMDA 4Y0FA 4IOCQ 4IR9A 3JSYA 1D09B 3TQEA 3Q8RB 3M8PB 1OMSA 1WKJA 1DARA 2BE2B 1OSDA 4ERDA 2FVSA 4TU7A 5THWA 1YHQS 1RK8A 3UVJB 1VBZA 1WC3A 4DCPB 3K7RA 5D4OA 2FDNA 3Q22A 1S9GB 2KU7A 2ZBRA 1NU4A 2JLEA 3C14A 2NZCA 4M5GA 2VBYA 1NDPA 2BEFA 2DNYA 2RS8A 4NLQA 4WU2A 5CCMA 2YX4A 5AE1A 3J81U 1PBAA 2JEFA 5D3GA 1S0VA 2HNZB 5DGAA 2V9WA 4OZ5A 4UUWA 3J81j 3GR1A 4ZPAA 1IWAA 2ZHOA 1YRXA 1G1XA 3BH7B 3DRPB 1FD8A 3CF5S 3DMJA 4LT6A 1U0HA 4U7UD 4C3KA 5G0RB 4A8QA 1VHFA 2CQPA 4DR6J 2UVWA 2YPYA 5GAEW 4GKKF 5DM7Q 4IRCA 1DHMA 1K1QA 1FFSB 3QAEA 2IBOA 1NMEB 2QMUB 4YEAA 4DPOA 1T11A 2QA2A 4NZ6A 1RT6A 1WORA 3GR0A 3PDNA 2C3UA 3QIPB 4OZ3A 3AHPA 3K57A 3CC4S 4JI4J 3Q8QB 2R2TA 4NXMF 2RRBA 5CCLA 1Q16B 2VG5A 4CTAB 4WFNQ 4CIOA 2D9OA 4ED6A 1UJ5A 4Y34A 2BM1A 2OP5A 2N4DA 3OTOJ 3MPYA 3T5JA 2AMCB 1GEHA 5HP1B 3OXFA 2C3OA 2KYXA 2ZH1A 4RNNA 4J9LA 1R6VA 4DBQA 3J80Y 3JTPA 4USIA 1Q53A 1I5OB 3CT9A 1JLCB 1MU2A 2I9SA 3G6YA 3PHTA 1PKUA 2DXDA 2LQ8A 3ISND 2QL5B 2B51A 2C2OB 2ROEA 2XWYA 4OLPA 4OI1A 2YKNB 2BYCA 2H48B 1UETA 2LQ9A 4DOZA 3PW4A 1VK3A 1EARA 1BC6A 5ETLA 2XC9A 2BE9B 4UQGA 1F0XA 5KFAA 2Z4PA 3NEKA 4ZN1A 4JI2J 1CULA 4B02A 3A3OB 5KFSA 4B9NA 1AW0A 2CQ3A 5HK4A 3PIOS 1U1RA 4X4QA 2C3PA 3AD7C 3GIJA 3GFZA 3ILLA 2PT0A 3QWPA 2NXJA 2MXYA 2DIUA 2RQMA 4DL0C 5F8HA 2F8HA 1DTQB 2F7VA 3VQTA 4A8SA 1U49A 1RJJA 2FJAB 4HDGA 4JXXA 1VCTA 2XMWA 2J8SA 4L6V3 1UCNA 1X8DA 3FBCA 4L72B 1TKTB 4NLPA 2WTFA 2ZH4A 4EBEA 1IKXA 3RB4A 3BBBA 2JFDA 5IC6B 1NKCA 1OSCA 1UEKA 4OX8A 2BR0A 2R2SA 2HS0A 3EM1A 3MM5B 2CNOB 2ILYA 4PZVA 5ETKA 1BLUA 4Y6IA 1EXDA 1EIYB 4I6YA 4NPOA 1RAGB 3O8WA 4NOHA 4WJBA 5F0WA 4H4KA 2JSXA 3HZEA 3M9NB 3DLBA 1GH8A 4MIWA 5HVFA 3KG1A 1VISA 1YTYA 2I2YA 2CXEA 1TK8A 2MKSA 4MJKA 4KGKA 5H9FJ 1S1UB 2HLTA 3HFZB 3QAUA 5LSLA 2YKMA 2L48A 4F0KA 2QJ3A 1BD6A 2YNFB 3BKTA 2AJ0A 4RWWA 3Q8SB 4LF5F 5B0AA 1UVLA 2DNPA 3G82A 1Q7LB 1NHVA 2DO4A 4RW8B 5HANA 1JXVA 1X4AA 3KJVA 2HPUA 1C1BB 4RW7A 3LGNA 3HSJA 1FE4A 5ITHA 5HATA 5B09A 1R8CA 2YNIB 3FEZA 4DL4A 4WPAA 2JEGA 1Y10A 4F0MA 1XC9A 2UV8A 2MSSA 1VQOS 2PC6A 5D78A 1I51B 4J37A 1IKYB 4OFZA 2CRLA 2BXJA 3I55S 2ZWPA 2YWWA 1FX2A 1QJHA 2CJXB 3K5PA 3SSQA 2XZWA 3Q23A 4ECRA 2DNMA 1ZPWX 3QT5A 7FD1A 3K8VA 3FSIA 3TUZC 1NKBA 4B3TF 3RU0A 1PSDA 2EG1A 3NGUA 4G1PA 3UNGC 3W64A 3TAQA 2G0JA 5EN1A 2DEIA 4FN5A 1FDBA 3UI3A 1LWCB 4J9NA 4KTQA 1UVIA 1FD2A 3DRPA 1RYRA 3ADAC 2RE1A 3QPIA 5KFCA 2E9ZA 1TFWA 1RUSA 2HSEB 2KI2A 4WTOB 5KG5A 1D9DA 4NXMJ 3W7BA 3BSCA 2DCLA 4UW2A 1RHMB 5IXUA 2VQEJ 1FKOB 1XMOF 3IS9B 3PXGa 4BC9A 2H5IB 1SL1A 3ZZOA 4UT4A 3PO4A 4P74A 4LRFA 2CQ2A 4IOAQ 1FKPB 2HBRB 2QX0A 2UXBJ 2ZKTA 3AQPA 2FVQA 2IM0A 4OJ1A 3TAPA 5J1EB 4FF3A 4CZCA 4LFCJ 4NXNJ 2RDIA 3MECA 2DH7A 2WBRA 4USUA 3TZWA 4DS4A 3W5ZA 4U7CA 2JLFA 3CCSS 2HGNA 3AODA 1MMLA 2HQ3A 3BYPA 1G6BA 1Z85A 3M8ZA 4RW8A 4N41A 3BQ1A 1NK9A 2B4PA 3OL9A 5BR8F 3LWLA 1IKVA 4NI2A 3R9LA 3CMES 4F4YA 5FLXY 3BO4A 2NQPA 2HHTA 3BGRA 2EFNA 1RGVA 3MI7X 3N0VA 3RBXA 3ZZPA 1HI8A 4F04B 3KLGA 4ECVA 1C4AA 1ZS6A 2A0FB 1L3TA 3I96A 1FE0A 4TNOA 2QN6B 4ENOA 3GP9A 2RHSB 4ICLB 1NSKL 1S6UA 4L75A 5FJ4A 2XHCA 4RNHA 4DR3F 4WFBQ 3GFXA 4AUKA 5IZNA 2OTJS 3P96A 2CQCA 2K7JA 3I6PA 2KM8C 3MCNA 1KQKA 1H72C 5ETQA 4JI2F 3TA2A 4KQZA 3GIIA 2MQLA 2HS4A 4ECSA 2OJ3A 4M95A 2HHXA 2QMXA 2KT5A 4NLWA 2I38A 4C0BA 3UW1A 3MMBB 3Q8YA 1CVJA 4YQWA 2BKOA 1OYEA 1RLCL 1SV5A 2RF2A 4C8KA 1N4LA 1LWCA 2ROPA 4I2PB 2HZ7A 3SV4A 1GXUA 1I94F 1OS5A 1W25A 3PYGA 4IH5A 2MJNA 2Y1RI 4TLQA 4C8NA 2HRYA 3MAAB 4DV0J 4O4GA 4HACA 3BN4A 2ADCA 2EKNA 3T1HJ 1KD1T 3RW7A 4B9SA 2DNNA 3MAHA 1B70B 3GJSB 3SI8A 2ZZMA 2FC8A 2ZBQA 2NSBA 3KOAA 1DLOA 5M2UA 4NLRA 1S1UA 1FNMA 1UVNA 5HMWA 3IM8A 1KWMA 1UZDA 2QLFB 3DHWC 2DXFA 3DI6B 4OZJA 2HFOA 3DM2A 4PAAA 1IBCB 4XPEA 4PWDB 4N5SA 3QWUA 1HW9A 1LW2B 3ONQA 1KLMA 4XK8C 2RD5C 4YHHF 1ZM4A 3HKWA 3CCRS 1N32F 3NCRA 2WVFA 4KH0B 2KFYA 4NLGA 4KJIA 1JLFA 2A6MA 1VQYA 2KJWA 4JB8B 3HP6A 3HVWA 3TNVA 3CD7A 3IBCB 4DL3A 4DS5A 3E01A 3V2UC 4LVOP 1I3OB 3M9OB 1XNRF 3T9NA 1OPZA 4U6PA 2YVSA 4OI6A 4ZA1A 2DB1A 3HHLC 3PVXA 5IQ6A 2E1MC 2CQHA 3QT6A 1DTTA 3V5RA 3PW5A 5IT9Y 5BYQA 2ZJQS 4JV1A 1HWJA 2OUGA 3VTIA 3R7SB 4UOHA 2X51A 1Y7PA 2MQ8A 4QU7A 3SCIE 3KK1A 3HMJG 4G1QB 4X4RA 3J7AN 3ZC4A 1WTFA 1WKKA 3DGVA 1BY9A 3GJRB 4RX6A 1DQ9A 2JWNA 4DU8A 1CPZA 2DNLA 4L3NA 2U1AA 2AJ2A 4HTIA 3ZNJ1 4YMEA 3CXCR 1HR0F 4NA2A 3F73A 1FFWB 2C22A 4AD6A 1H2VZ 1SV5B 2XTJP 3PX4A 5L8RC 1T7PA 1KQGB 2DNQA 4RBTA 2J8AA 2BRKA 1WF0A 1P27B 2CG4A 3H2VE 3PJXA 3WX8A 4FYWB 4Q43A 5B0DA 3G87A 4FS1A 4UY85 3I5CA 1PYSB 4ZVFA 3HM9A 4X65J 1S0MA 3TWZA 4YOEA 3GCXP 1VRTA 5JVHQ 3JSMA 4B3MJ 4H3SA 1R43A 1YJUA 3AD9C 3I0SB 1KONA 5GAEU 4Y3CA 4I6WA 2M88A 1HBNA 4DV7F 1T9XA 1QSSA 4F26A 4GVLA 1VQNS 2FZCB 1T9UA 4OHZA 4F36A 2KH9A 1NK7A 3J7Z5 4ZHRA 1D0EA 1EHWA 3FBBA 3KK3B 3HLUA 2RILA 3KHHA 3JQKA 2KHDA 4WTYA 2MZSA 3EDRB 3OHAA 2E1AA 4PG4A 1WHXA 2KXNB 2DBBA 1J27A 2KKHA 2WRMA 1X4GA 3PIPS 3N6NA 5CYQB 2ZD1B 3SDEA 4HLBA 3R8YA 2APOA 1FXDA 2KVQE 2M3DA 4RW9B 3FQKA 5ETRA 3W8PA 3AQOA 5BR8J 3OTOF 2G5DA 2P6SA 1RA6A 1OWXA 3RB3A 3RAQA 4IQXA 4P71A 2NYHA 4LF5J 4Q8FA 1WF2A 2BM0A 4IQMA 2PEBA 4A8WA 1F5CA 3NLCA 2UVRA 4AQYF 1FERA 2L41A 1X60A 1NCLA 2KT3A 3SCLE 4CDIA 4CYUA 3QJPA 3H59A 3NRBA 3TQ1A 3T3FA 2M7SA 1RACB 4CNZA 4D3HA 1PGZA 3T1HF 2RF2B 1VBYA 1PC4A 2CNNB 3ENAA 4LVNP 5J2PB 3TJAA 5JVHS 2KG0A 1QE1A 1NM2A 3FGVA 2YQ1A 1ZTWA 4GRSA 2RIJA 2V8HA 1VQ6S 3M2VA 4YDXA 5L1JA 2XB2D 1JLBA 5D4PA 3CDBA 3SMZA 4X64F 3FK4A 2XNQA 4WKYA 3NS7B 3RBZA 1FESA 2LFVA 5DG9A 3RB0A 3RBEA 1XTZA 3CJKA 1PCAA 1BGXT 3J7ZV 4F7VA 2M9KA 3W9JA 1M1KT 2XWXA 1FXRA 1HNIB 4TU8A 2F9JA 3HVTB 4OHYA 2ZITA 1U26A 2M52A 2B9YA 5CZVA 5L9XA 3W1YC 1HNZF 2DY1A 1RTZA 3NOGA 1RLDA 3IGVA 2A10A 2MQPA 2CPIA 3HSZA 4ZLNA 1IBMF 2YXLA 2M8DB 2KZZA 1V6HA 2HFZA 2JC1A 2BJEA 3EZUA 1PC5A 2IM3A 4DDFA 2RRAA 2QLWA 5KG1A 1XEZA 3T1YJ 1IM4A 1NPPA 4J9RA 4NWBA 2WCXA 2UUBF 1P1TA 1Y0HA 1S9EB 3BO3A 3CO9A 2NZ4A 1H2TZ 3BR9A 5IWAF 2E5IA 2HGMA 2ILZA 4EMDA 1N32J 4B9TA 3CMAS 1U2RA 4Q7AA 1DTTB 1RWKB 1S48A 1VHKA 3UN5A 2AIRB 4RR5A 4IR1A 3BKFA 2PI4A 4IRKA 3CO0P 4CNYA 3JYTB 2R2UA 4DV2J 3DCAA 4GMKA 3KK1B 5T14A 1KQFB 2Y1JA 4WU3A 1OO0B 1H7WA 3EZOA 3P45B 3VAGA 1UWBA 3OL6A 2CPEA 4ETXA 5HJYA 2ZZNA 1RTHA 3T9ZA 1RADB 1GK8A 4EU0A 2HZCA 1XERA 1NK0A 2ALYB 2EKYA 2MPUA 4CCHA 4DN0A 3M2RB 1ZETA 2IBKA 3NXZA 4C7QA 1I6JA 1IR1A 1G3OA 5ETSA 5J2PA 4DWIA 5GAGU 4Y00A 1HFEL 1XQIA 3MAAA 3CIZA 4O4GB 2W24A 1WD6A 2F8MA 1S1TA 1FEEA 2AYEA 4N8OA 4R0JA 1S0NA 3CJ4A 4WFBS 2ATCB 3LP0A 2HFVA 1UW4A 3M32B 2K7KA 4MTPA 5FDLA 1MMNA 3DKDA 3R2CJ 3OR1B 1ZOTA 1F1BB 4HEA9 4LFAF 4QIFA 2JEJA 1RKIA 2HMIB 1V3SA 2OPQB 5GAHI 2EGVA 3RRKA 3GV7B 1OQ6A 3ZTRA 1JJHA 2FJEB 1SKWA 1SH2A 2EI5A 3HVTA 2XSJA 4OI2A 4LRBA 5K8PA 3GJTB 1WHWA 3N28A 4KKOB 1NSQA 5AJ3F 1LW2A 4KHPJ 4AYBD 4IUFA 2KZMA 5E33A 2G1HA 3LAKA 2VZ9A 2OPPB 3S8SA 3UR0A 1ITPA 5F3TA 2UU9F 1WJ9A 1M1GA 1UEVA 2P8IA 5BNZA 2PGCA 1ZM9A 3BGUA 4CT9A 2B9EA 5KFKA 4ECTA 1IKWA 1RTJB 2MEWA 1X9SA 4DSLA 2ADBA 2FGOA 4PG7A 2BOPA 3OTCA 3PYEA 2BVZA 4JI5F 1KTVA 3ZFVA 2ZD1A 3SDEB 4B3RJ 2D9PA 1VC0A 1VYAA 1IN0A 1ZH5A 4C11B 3WC0A 4X4VA 3ET6A 1YDLA 1YZ6A 2UVVA 3C3LA 2ZDOA 3LAMA 2VJVA 3FCHA 3FJ2A 1LWEA 3OUYA 2W7AA 2FD2A 4B3SF 3OJUA 2KL8A 4U7UK 2LDYA 3CCWA 3CMQA 5ETTA 3FKBA 1EAYC 1WOSA 2VIHA 2YNGB 2MQQA 2L3MA 3TX8A 2I5JB 2J0QD 1K73T 1XNRJ 2RQKA 5D77A 4N77A 3I31A 3GLJA 2NXCA 4KRWA 1K0VA 3MEGA 3NNHA 4AQYJ 4HH0A 1RWXB 3D7SB 3W63A 1WG1A 1K44A 4QPTA 3L3CA 4CLYA 4ZIWA 1HNXF 1UDXA 1S1TB 5HVGA 1KVJA 4Q0BA 2ZH2A 3OSNA 3VAHA 1H74A 1JLQB 2HHHJ 2HVZA 2RUSA 4CM2A 3PIOQ 3OR1A 3R97A 3HHEA 1S1XB 1HNWF 1N5YA 3NY0A 2HS3A 1F2HA 1RAEB 4MMOA 1JLGA 4O3RA 3IMQJ 5JMNA 4DV4J 4DR5F 1HPZA 2ASYA 4FBUA 5C24B 2O3DA 3NL0A 4J9UE 3U1MA 5EWEA 4JI8J 3PG9A 3V81B 2N4CA 1VQLS 3K8WA 4UOFA 4DV3F 1S76D 4F4XA 2KTQA 1UFLA 2CKWA 1TL5A 2CYYA 1Q5YA 2X1BA 3BGFA 4USHA 4CLUA 3G8SA 3POTA 3DXBA 4K5SA 4YY3F 2WOMB 5CYQA 4J9SA 2J5AA 3ZTPA 4EYIB 1WEXA 2DNZA 2BJ1A 3D1QA 4I7FB 1F3FA 4YR3A 4B3MF 1SL2A 1UAWA 2NUUG 4QW8A 1PJ6A 1U1NA 3LO3A 2FGCA 4DZDA 2XS2A 1TVRA 2H65B 3OUYB 5A2QY 2GQCA 4DLEA 2BZ2A 1LXNA 3VQSA 3KHLA 2XGPA 3R2DJ 3BO2A 1NSPA 3SBMA 4H54A 3G6VA 3CSKA 1B4SA 2RSQA 3GV8B 1P9QC 1RTHB 2LA6A 2VBWA 3HJVA 3JS9A 1EETB 2AJ4A 1TL3A 4X4SA 4IFYA 3EMTA 1VK8A 1U4BA 1VQPS 3HT3A 2DIVA 2XULA 2R7WA 4WP9A 2AGQA 1QAIA 4OJ3A 4LFAJ 5F8LA 2FC9A 1TMMA 2VA2A 3CE8A 5A76A 1WACA 4ZP6A 4L73A 2HEKA 1X4DA 4OZLA 1JJCB 4LFBF 1RCXB 5CHCB 4O4RA 2K8GA 4WZQA 2OGUA 4ZCIA 1YVFA 3Q8UA 4LFBJ 5DM6Q 2IA6A 3KNAA 4A8XA 1FA0A 1TV6B 2GJ2A 3C19A 3IR6B 3NCPA 4P2FA 2MGZB 1T8EA 2VPXB 1V3RA 4LREA 2GQQA 1N5QA 1O5JA 4DUYJ 1MWYA 1VDHA 1HLWA 1S6OA 2ATLA 2JHEA 1FTCA 1FRHA 3HKZD 2HBZB 2OFHX 5MLCV 5C2CA 2AYGA 4PUOA 1EUQA 3HD2A 3LF0A 3PRDA 4PYDA 3EXYA 4G6VB 4FF4A 1DQAA 1RTJA 5AJ3J 4I68A 3R6LB 5J2MA 4I6AA 3POTB 1YX2A 3CZBA 3LP1B 3BGRB 3MPUB 3W9IA 1XR7A 3H90A 2GAEA 1UEUA 3GYNA 4NLSA 4DV7J 2WVCA 3KDOA 4RNFA 4ZCMA 4IFVB 2QEXS 5HLFB 2EVZA 3K89A 1IUJA 5K9FA 5LL6d 2XCAA 1KN6A 4CLTA 1IBMJ 2GAHC 2GZOA 4R8UA 4JYZA 3UR3C 4JI5J 4QR1A 4Z2XA 3LANA 5H9FK 1OY6A 1GXLA 1RI7A 2WW4A 3TZXA 1H73A 4O3OA 3ZNUA 1N54B 1J2VA 4O23A 2QV6A 3IRXA 4OV6A 3D9BA 2XEXA 2DGUA 3C6TB 3EUNA 2MHNA 3J7YI 1IJEB 2VG7B 3N6LA 4MKBA 3KLHB 3BSNA 2BDPA 3MM6A 4W4MA 4AL7A 3HF5A 1VQ7S 3BZQA 2E5HA 2BACA 2NWAA 4KGZB 3TJ9A 4I2PA 5L46A 3KMSA 2R7SA 1Y00A 2JFKA 1NHKL 4LF1A 1DRZA 3NWRA 1AFIA 3I5AA 4KGXB 3TVKA 5I42B 4C3MA 1I1GA 6FD1A 4PXBA 4LSZB 3M32A 2V2QA 2JJ4D 4JV0A 5T7LB 5KFIA 3UDEA 4DR4F 1RHJB 3PW0A 2RE8A 1YK9A 2QTWA 3DOLB 5HJXA 3K5OA 5ETVA 4DV1F 4B3RF 1J5OA 2XSFA 4P75A 3SCJE 2B8PA 1JLEB 5D0HA 4BHQA 1YJ9S 1JMTA 3QMQA 3TVYA 4OZNA 2R8HA 1X4BA 4KKOA 1NJWA 1SIWB 2NXNA 4E2FB 4O44B 4ZCKA 2MGZA 1TL7A 2VUGA 4P2BA 3VWSA 1RAAB 4ALZA 1KOOA 2FYXA 4JI3J 4WZMA 1URRA 1KVKA 2COLA 1IVZA 1VHYA 2MSTA 2EPIA 5JUMA 2QFIA 2ZM6J 3VCDA 1U1OA 1K47A 1WG4A 3KLIB 2R7TA 3HCXA 1FI4A 4ILRA 1MN7A 5ADZA 4AXIA 4OJHA 3S01A 2DHAA 3CDAA 3QFHA 5ETPA 8ATCB 3BSAA 1RHQB 4QR0A 3HFVA 2RMLA 3ET6B 1D3WA 2LCWA 1XWLA 5K14A 4PXEA 1PAUB 4IH6A 4NL5A 1FTRA 3U02A 5A0YA 5KT6A 3T5LA 2PFFB 1S7HA 1TVRB 2ZNYA 2XMJA 4B08A 4V19J 3TI0A 3BGLA 3MFIA 1B75A 3JAMU 2I5JA 4NASA 5CZXA 2EFOA 4LIRA 4IRDA 4WBFA 3MEEA 3UN3A 3QRQA 1UVKA 2VFRA 1X5SA 1N5TA 4FYXB 2OSRA 2NCKL 4MK9A 4QIVA 4U67Q 1RT7A 3OFGA 4YB1P 3D0HE 5KFMA 1PO6A 3RW6A 1HIYA 4PG5A 2QLBB 1X4FA 3VGUA 1IR2A 5KAKA 2M0GB 1XNQF 1FNOA 3DN9A 4YS2A 4PPZA 4BWJA 3FQLA 4KBIA 3IXQA 4M5DB 4ZP8A 5KG7A 4WWSA 2FJVA 4Q0BB 1IQTA 5KFTA 2H5JB 3KUEA 2IJNA 1N52B 4EEYA 3CJ2A 4Y28C 1SB6A 2R42A 4PYAA 1U1PA 3A3PB 3G96A 5K8NA 1X0PA 1RT1B 2EFPA 2IHR1 3MCMA 2NREA 1YWXA 1YZ7A 1Q78A 3BM7A 1E6VB 3D66A 3NAHA 5DG7A 1CS4B 4UY8T 3B78A 1H98A 3GQCA 4CT8A 5E41A 4R5PA 3K17A 1PILA 4DV6F 1O51A 3OW2R 4WIIA 3G8QA 4ZMMA 4A8MP 4QU6A 4FYVB 2W2MP 1HWKA 2MMYA 3AOCA 3I0RA 4WXOA 3DYAB 2FVCA 1FJGF 2GHWA 3KYLA 4LF7J 1U6FA 5HAOA 2D3O1 5LJ5Y 3BPSP 3MM7A 2JOQA 4IH7A 4I7FA 4USWA 5D15A 1QY7A 5LMUJ 5KFZA 1Q7YT 2YWGA 4EWTA 4NLXA 5AE3A 1JJ2R 3UD4P 4HR2A 5K14B 1YJTA 1MNEA 1N6QA 4CLFA 4DR5J 1WELA 3H4BA 1TUWA 4TY9A 4QR2A 2XLKA 3QRRA 4QWBA 2WSEC 1TKDA 1FF2A 2AX0A 5DLGA 2VPYB 5F9LA 1LV5A 1X4HA 1RT4B 2X3GA 2RD2A 2Z2LA 2RS2A 2E1RA 4J5OA 3DRRA 5KT4A 2IC3A 5J2QA 2VONA 4OQJA 2B9WA 4YY3J 1WC0A 2ZBPA 3GJQB 3MM6B 5C5JA 3CF5Q 4DSJA 1TUGB 2DTJA 4TLRA 4ZPDA 3THVA 3PNIA 2QFJA 3LH2S 3FZ2A 3LOUA 3J81Y 2XYHB 3EDQB 4FXDA 4H4OB 4OHVA 5F8NA 5IC4B 3Q2TC 3IWLA 3OD2A 3N6MA 5T7LA 3TRGA 2MLXA 2PO4A 2E7WA 3PFOA 4HHUA 3ENQA 4I0WA 2FVRA 1X5PA 4JI0J 3O2IA 3CD6S 3WZ0A 1IXKA 2ERRA 2FUG9 3IFEA 2W01A 3DLLQ 1BQMB 3CJ5A 3SFGA 1HQUA 3MXHP 3CVKA 4LSLA 4ES2A 4V194 2EWHA 2WBMA 3T6JA 4BBYA 3G2XA 3IWNC 1TELA 4R5PB 3MD1A 1CJTA 5E3PA 4OZ2A 1A9NB 4DLGA 1AYEA 1MN9A 2CPXA 4JYAJ 2DGQA 3A8EA 3FCVA 2YTCA 2ZC4A 1VQMS 3SXLA 3HULA 1NK4A 2HGLA 1R3NA 4CO5A 1S9EA 2W2QP 5JXSA 3WQPA 3PCOB 2HNZA 3VR1A 3D5MA 1RAHB 2KYZA 2ZE2B 3AOBA 3MGJA 3MM7B 4QZVB 3CCLS 2IJFA 4CLZA 4OYMA 4NX9A 5LSOA 2F4VJ 1FRLA 1XIQA 2P6TA 4O3QA 1XK8A 2VPZB 1X7VA 1QRSA 2H3EB 5HLFA 3A1YG 2R7UA 4DV4F 3R1HA 1C0TB 1RTIB 2FJBB 2ZOFA 2ZH8A 3BH6B 4BLGA 4WF9S 4URQU 5DDQC 3L95X 1FKAF 3ZTSA 4RU9A 1VMBA 4FBTA 2V2KA 2YPZA 2PNWA 2CPDA 2VF3A 2DJWA 3CCZA 2B5JB 4ECQA 1RT6B 2QC3A 3MCOA 2GS8A 2AT1B 1AXQA 1LKZA 1U1LA 3CCES 1O0BA 2PA3A 2QYCA 4J90A 4TU9A 4UQTA 2MZJA 2XO7A 2XY7A 3BDPA 2O67A 1EJ7L 5I42A 2YWEA 4RW6A 2DXEA 1NB7A 2IVMA 4I69A 4H4OA 1RDRA 4K0KF 3NGTA 4HI2A 2OFGX 3DOLA 4G1IA 1Q79A 4FKYA 2W9BA 1XMQF 2M4MA 2N3OA 1XN9A 2HK3A 3T19A 1U2CA 4CQ1A 2Z56B 1T05A 2BJ8A 3RTVA 3VAFA 4HHHA 1XNQJ 4OHXA 1UFKA 2OPQA 2AP6A 2XYPB 4TXSA 5IQQA 3ZXWA 4F4AA 1LW0A 1HL6A 3M7VA 4OIXA 1GTRA 5BYRA 1JKHB 2W2PP 2PMZD 4N76A 2ZKUA 2VDHA 4FF1A 4NLVA 1S9GA 3C14B 4WYLA 5DQIA 3R7NB 5HMZA 5KFQA 5F0UA 1KHVA 4J3CA 4DZ6A 2PEHA 2EGWA 5DQGA 5JVGS 3M6VA 2FPHX 1QRUA 3KWMA 3LP2A 4DX6A 4ZP7A 1UZHA 2ACMA 2LXUA 4LRAA 3TUJC 2AGOA 1U1KA 1IBLJ 4F2SA 3LUYA 2J6UA 1MSWD 1GMVA 3P5BP 1HQEA 1S6PA 4FPRA 5GMEA 3FSYA 3TJ8A 3V4MA 1FJGJ 2JVOA 4K2XA 4I67A 3UDVA 4C11A 3D68A 4P73A 2E9TA 2RH3A 1RAFB 2ACYA 1TKXA 3HVRA 3DLHA 1N36F 1Y5IB 3BDEA 2OEKA 2P5VA 3MWBA 3CC7S 4ZLLA 1YJVA 4KV8B 1CC8A 4RW4A 2E1PA 4CO2A 1ZTTA 5KFDA 4U95A 4KSEB 4MYTA 4JUZA 3MR2A 1BMQB 3K5LA 1M5VC 4MIBA 1N5VA 1WG5A 2UUAF 1HBUB 1N0UA 5E3RA 2ZJRQ 4ZJQA 1TP7A 1REGX 2CPFA 3D3CJ 4ZPCA 4DSFA 2CWKA 2D3OR 1UW9A 3IA0A 4LF2A 4YP3A 3W2WB 3ZZYA 4RUHA 1YRUA 5F9NA 2L9NA 1FX4A 5L38A 2R7RA 3CCQS 4ZS6A 3MTKA 4X4PA 1DBDA 3SEOA 1KFSA 3HSDA 4M5HA 5EHHA 2GVZA 2VODA 1SJFA 4P2XA 4FP9A 3QZ7A 1T0TV 4DR7J 3UCUP 3EGZA 1SCJB 3V4IA 4B3OA 1VBKA 4M5KA 3RG6A 2BANA 7FDRA 3GB0A 1VFJA 2KRBA 1KR4A 3M1VA 1E6VA 4WE1A 1Z2ZA 3ISNC 2LXIA 4UF4A 2FJWA 4DPTA 1N5YB 2DGWA 2CNLB 5M2RA 3TW0A 2J7KA 2C28A 5SZTA 1ZYQA 2E7XA 3GILA 4DHVA 1M5OC 1GX6A 4QBUA 3AA8A 4WCEQ 4ED5A 5GADW 2VC0A 3DU5A 1LFWA 2IY5B 1EQMA 2J7UA 2VG6A 3J7YU 4DV0F 3IWXA 4F67A 3CDUA 2MQOA 1D8YA 1A0OB 2Q6BA 2MDAA 5CYMA 1RWOB 4U67S 1FRXA 3W3SA 3VHQA 2QE5A 3HHLA 2WOMA 1GMWD 5D0RA 3MZIA 1TKTA 5KT5A 4ED2A 2AYMA 4KYZA 1L3VA 4F3OA 3BB5A 3FC9A 1LNQA 2A1BA 1LFPA 1FNXH 2HK2A 2WB1D 2BBEA 3DFEA 3MM5A 2VHGA 4ZJOA 2KN4A 2Y9HA 5EWGA 3D1OA 3KJFB 4JI7F 4DV6J 1TKZB 4QW9A 3FFIA 2YX1A 1VLOA 2IAJB 4KFBB 4KPCA 3OVAA 2KB2A 4ECZA 3W2VB 1HBMB 4EGLA 4KV8A 3KMQA 1WTBA 1T9YA 3P5TL 4M94A 4EFAC 2NUHA 4KH1B 1HYSB 1QTQA 2MKCA 1GQEA 4OI0A 2Y1LB 1ZA2B 3WIVA 2B7CB 1V6ZA 1WC4A 2OHDA 3N79A 3R1LA 1VIXA 2F3JA 3M2UA 1TQLA 3O1LA 5KFVA 2FY8A 2K2PA 4X4NA 3R5AA 3W2WA 3KK2B 2FHKA 5B0FA 4PG8A 1S4FA 2RRNA 3NS6A 3ULHA 4X4OA 1E6YA 5KTQA 2C1EB 4MYUA 5KFBA 3L7PA 4N7TA 2PMHA 2Q3PA 2XZDB 5HVHA 2KFZA 3CJ8A 3V6JA 1LXJA 1T05B 2QLXA 2HLUA 1FWPA 1XR6A 1VC5A 3KW2A 1HQUB 2H4YB 4PKDB 1Q1KA 2R8KA 2UXCF 3PJWA 4AL6A 1U47A 1LW0B 4OYBA 3DGPB 5IM0B 3DLGB 2EFQA 3QO9B 2HG4A 2MKYA 2GA7A 1ACMB 2BE2A 4QWCA 1S79A 4NLYA 3IGNA 1TK0A 3TUIC 4ICLA 1PYOB 2YQ3A 4OL8A 3LPYA 1LQ9A 2Z57B 4OI4A 3SQGA 2V8VA 1JXEA 4MK8A 1ZZNA 2K1RB 1WNEA 2ZH9A 4GVBA 1N36J 3C16A 2Q66A 2OPSB 2V5HG 5JJBA 2C2ZB 4QQBA 1R89A 4JYAF 1FJ7A 1Q5VA 4URSA 5L39A 1K1SA 3CNQP 1YJ7A 4ANCA 4DF8A 1X0FA 1UKUA 1KP6A 1C1CA 1RP5A 3NGSA 1T9VA 1N33J 3QGPA 1VHIA 5I3PA 3KTQA 4DR2J 3VGTA 4Y2MA 4DG1A 3EE3A 2HIQA 2MJUA 2L08A 2H54B 2KXFA 2FTRA 1S99A 5DO2A 4YUDA 5CD4H 2OEMA 4UZBA 1EKRA 2A6OA 2U2FA 4HTJA 4M5IA 4X4TA 4DQIA 2HNYA 3AAWB 3M30A 4Y2AA 3A4TA 5D4LA 3NP5A 4MAKA 2XMAA 4HKQA 3C2PA 3KLFA 4LF6J 2LYVA 4PQAA 5HL7Q 4C8ZA 2VOPA 1S1VA 4P52A 5A8RA 1BWEA 2ZWOA 1YLXA 1DLOB 3MHYA 2M70A 2G9OA 4N8NA 2VU5A 2J6TA 5H1SV 4NEYA 4M8LA 1CJVA 3HPOA 3M2UB 2ZJPQ 1YBUA 2JX2A 5I3UB 4OX7A 5BXIA 2QA4G 2DYAA 2BUNA 4I1TA 1RBOB 4XPCA 2CAJA 1KLMB 3ILJA 5DQHA 3HT0A 4FS2A 3QT8A 2HVHA 2C2NA 2V2ZA 5KFWA 1R8HA 5E3QA 4A47A 4AXJA 3PRVA 4OYAA 3M1VB 1S1WA 3GMGA 3KNGA 3DRSB 1NDCA 2DNHA 5G4DA 1TUVA 2E29A 4DU7A 4Z7CA 4C8OA 2DO0A 2LP4A 3NGKA 5KFEA 4P72A 1YSJA 4PWWA 3QRPA 4NCAA 5E0OA 1WC6A 4RZRA 3KJQB 4ILMA 1SXLA 2DR8A 1VS3A 2CJYB 3S6EA 4P7VA 1U6ZA 2Y1IA 1U02A 4B17A 2GIQA 3DOMB 1HQEB 1S6PB 5ETOA 3QZ8A 3F41A 2W2OP 1QVGR 1YIJS 4ID8A 4LBPA 4OX9F 2N7CA 4C9DA 1HMVB 1RT2B 2FIUA 1FHTA 2AE0X 4A8FA 3GIRA 1HNVB 3DHXA 2JEIA 3PKMA 2ZZTA 2OIHA 3OBIA 3PTWA 4ELVA 2W9AA 3L9ZA 1H6KX 1CSJA 2PFDA 2PSZA 4LQ3A 4DV5F 4HACB 3P4UB 3W2VA 4YR0A 2B56A 1U25A 1S6QA 3LALA 3Q8PB 1RKJA 2I6WA 5HROB 3IN5A 3GPAA 2ZJPS 1HYSA 2IRXA 4DPUA 1NZ8A 1RHRB 3OR2B 3BJYA 3GIMA 2UV8G 4LUBA 2EFGA 5C42A 1UMJA 2B8QA 1FFGB 3MMCA 2BW7A 3H98A 1H3DA 3I0SA 5K5MA 3A8KA 2IM1A 1O0CA 2KVIA 3W61A 4E98A 1TAQA 3PR5B 4DSEA 2DRBA 3HSGA 1X9MA 5HSPA 1FRKA 2IM2A 4URGA 3CDWA 4TN2A 4DQRA 4ETZA 1NJZA 2V63A 2I8EA 3PHEA 4ZKAA 2CZ9A 4QWDA 3MTJA 1VLYA 2EG2A 1DQ8A 1UPPA 1PIEA 3OTEA 2MY7A 2Y0BB 5RUBA 1OQ3A 2J76E 3B4MA 4WXWA 5B0BA 4FVCA 3CPWR 4EBDA 3NNCA 1V5VA 2WW8A 2HAFA 2GMLA 1RHKB 3GCWP 3I9ZA 4LBIA 1NHUA 4V19X 1L5UA 2VD3A 2V67A 1TZ0A 2EXUA 3PEJA 2MQNA 4ZK7M 2HQIA 3DLGA 3UVJA 3OLBA 4BC7A 2HVDA 1WC5A 2VG6B 2NPIA 3Q83A 4NRUA 3UCZP 1XMOJ 2QA4S 5L1KA 3MMAB 2CVEA 2C3MA 4K4SA 3I32A 4C0HA 1R7IA 4WFAQ 2HNDB 4LR7A 4DL7A 1HHTP 2ZNZA 5GADU 1PBUA 4DR7F 1B64A 3K5MA 2GO8A 4B9UA 1J5EJ 4EUVA 3E51A 2A2DA 3W5YA 3T1AA 2CVIA 2J9DE 1N8RT 1RHUB 1JNRB 4M63A 4NMLA 4NLOA 2OH2A 3M9MB 2CQ1A 4LQ9A 3V6HA 3SV3A 1R27B 4KHPF 4USMA 4KFBA 4L74A 4CLPA 1RT3A 2Z30B 3IM9A 4K4VA 1CC7A 4ZOSA 3E3XA 3OT9A 2BABA 3OL8A 2Z2ZA 3QQCD 5DGBA 3K59A 4IOAS 1AZSB 3IS9A 3ENVA 3GYXB 1JJ4A 3QIPA 4CO4A 3NS5A 3DRRB 3AIIA 3CJKB 4ZVHA 4XDCA 3JSMB 4DR2F 1D1UA 1QRTA 3LPEA 3VGVA 4HH1A 3OR2A 4LSNB 3ZO7A 2YKOA 4DR6F 3DLJA 3WIUA 2V34A 2YKAA 1XBWA 2CJKA 3NNAA 3JTOA 4NCBA 4DQQA 3D3BJ 5KFGA 1RSCA 5DG8A 2D69A 3OL7A 4CRJA 4RBUA 4JI4F 4ZHRB 1SC3B 1ELOA 4HDHA 2DD8S 2OLWA 5F3ZA 5LMNF 4YFUA 3MR5A 1KTQA 3CJ3A 3OVBA 2F5GA 2ROGA 2G0CA 2GC8A 5IV4A 2Y8YA 2YNIA 2XGQA 1EUYA 4EO6A 4CH1A 1RT5A 1DY3A 1FDAA 1S1WB 1M5HA 2PA8D 3H20A 2ZH7A 2L9DA 4MFBB 1R0AB 4KT0C 5DZ7A 5EUHA 4LSLB 4RUAA 5D6GA 1SH3A 1OYDA 9ATCB 3DOKB 1APSA 2GHPA 4WFZA 2W2NP 4ECWA 4F8RA 2CIMA 1WF1A 3FVYA 5A8WA 4QWEA 4LIWA 5D3GB 1QTMA 3UE2A 4ZLJA 4GKJJ 4FZVA 4F4WA 3J7ZT 2ZOGA 4C97A 1J5EF 2N82B 3NMAA 3RR7A 1F5AA 1X4EA 2UUWA 3BQ2A 1YITS 5SUHA 3D0GE 3DMJB 3IRWP 2ZVSA 3V6KA 2R2RA 2DPIA 2CJ9A 1ZA1B 2LEAA 3LTOA 3Q24A 2QIFA 3UDCA 2HHSA 3R5GA 1FKOA 1FWLA 2GV1A 2JNJA 4NMXA 3PX0A 1VJWA 2HIYA 4LFCF 4NXNF 6FDRA 4GC7A 2AEFA 4YB7A 4O3NA 3HD1A 2VG5B 4CTAA 3PW7A 3MPWA 3VF0B 3IP0A 2FLLA 2G2OA 1FCAA 3C15B 3HX9A 2MZQA 3JSBA 1Z1ZA 1QUVA 1T9WA 5KFLA 2HZAA 1LK7A 3UPFA 4P6QA 3G82B 3VAJA 1MU2B 3R27A 4JI1J 3PY8A 4LF8F 2GVDB 2LEPA 3ZZZA 4F0HA 4J9QA 4PWDA 2DGVA 2GQ2A 2RJZA 3VALA 1KC8T 4CH7A 3K0JA 4MK7A 4C98A 1EP4B 2AYBA 3UNYA 3EXCX 3KKFA 1U7LA 5FD1A 1HR0J 5KFJA 3OV7A 3RBDA 4QYZJ 3FBEA 4G3IA 1MWZA 2PI8A 1WSVA 2B9XA 3CW2C 3MM8A 1JKHA 1KSPA 2WVBA 1UA1A 1SUQB 3CD0A 4DCJB 3DLEB 1NK5A 5HQLA 4RLEA 3AFGA 3B54A 3VZHA 1SJQA 2W7OA 1DTQA 5FIIA 4OYZA 4L69A 4MIAA 1GMWA 1B7YB 4ID5B 1RWWB 1OJ4A 2AHOB 3LP2B 2IFXA
chains in the Genus database with same CATH topology
2YNGA 1QUPA 2HNDA 4B9VA 3CULA 1F5BA 2O5DA 4H4MA 4QWAA 4H4KC 1HMVA 1RT2A 5T41A 3K58A 2RQ4A 3TA1A 1HNVA 2B4UA 3GG0A 2AJFE 2HWHA 1N0VC 5D4NA 1S10A 3BN7A 2CJQA 1L3SA 1K9MT 1RT3B 3NKYA 2E66A 3G9CA 1Q4RA 3PV8A 5EWFA 4HHJA 2UZAA 5HROA 4JBCA 3OPKA 1WWHA 4EO8A 2CPJA 2X1AA 1F2GA 5KOWA 3TOQA 1NZAA 4R0EA 5IT4A 1BQXA 2HMIA 5L9NA 4PXDA 2WB4A 4JV2A 2R7XA 1VQ8S 3PKYA 3R5CA 5M2PA 3OVSA 3V6DB 3GFYA 2X1FA 1NH8A 5JVGQ 1FK9B 1R8AA 1VQ9S 4RW7B 5LXYA 1JK9B 1CQMA 1N48A 1WI6A 4B3OB 1SIZA 2OD6A 4K59A 3FEXB 3I5BA 1X4CA 1K8AT 1IKYA 5G4DA 2B43A 3TARA 3M8PA 1U2FA 2ZBCA 2LKZA 3CEDA 3MM8B 3DOKA 3QYYA 3NWGA 3HI9A 5HMXA 3FDSA 2K3IA 2ALZA 1VGYA 2KJVA 5A8KB 1DURA 2QSFA 2A3JA 4Q8EA 2KT2A 2YWFA 3C8YA 3MEDA 2C3YA 3MEKA 5KFYA 4A8YA 4LF4F 1NAQA 2KG1A 3GG1A 4WFXA 3UD3P 1KNZA 1TKZA 3FFIB 3GSDA 2ZHBA 4GC6A 3HK2A 3CUNA 3BREA 5HBMA 2GX8A 1HBMA 3PO5A 3G6XA 3KLVA 5DM7S 2Z0GA 2VQFF 4J9KA 5HQ8A 1R8BA 4WYWA 3D1HA 2ASDA 1T3NA 3DC2A 2JZ5A 3DI6A 2CPZA 2DGOA 3QGGA 3C6UB 4DUZF 1M5PC 1H38A 4KO0B 1W2BR 1TL1B 2Q6CA 3SFUA 1QAYA 4C8YA 4K4XA 3H5SA 4C8MA 3G8TA 5KT2A 2VPWB 1KHWA 1Z4UA 4NYPA 1HWLA 2C2EA 5F8GA 5J2NB 4JI1F 2FHMA 4ED7A 1HI0P 2WAQD 3ZZ0A 3RAMA 2EBEA 3PRBA 4IFVA 1SUQA 5B0EA 2DR7A 4IOCS 4F3QA 2MZ1A 5EX0A 3GZ7A 1Y9OA 1VQKS 4K4ZA 2RT3A 1U45A 4Y2CA 3G86A 1Y3JA 3IRXB 3ICLA 3MEDB 2VKZG 3X3UA 4C3LA 2FLPA 5KFFA 1RA7A 4A48A 5KT3A 3AA9A 2DH8A 4ECXA 4ED0A 4C8LA 2DH9A 3AJ1A 3KFWX 3WX4A 4DMZA 2XMMA 3NAIA 4ATNA 3HO1A 1LWFA 1JLAB 2W4PA 3BEGB 5A6WA 3EZ5A 3GV5B 1M90T 2CQGA 1XMBA 3LP0B 5IFMA 2HYIB 2GJIA 2HRUA 4GKJF 4WKRA 2ASJA 3SYZA 2W4CA 2XMUA 4DFPA 4NCGB 2VV5A 5HP1A 4N56A 1DFDA 1Y5LB 2CJBA 3G4SS 2YNFA 1FK9A 1SI9A 2XSJB 3I82A 4FXVA 3I56S 3BR8A 2LQBA 4KO0A 5GAHU 2R7OA 1JLFB 3KK3A 2UVUA 2EC0A 4AL5A 4FXWA 3AB2B 5EGYA 2XBPA 3KHRA 4OHWA 2VASA 3CCVS 3KG4A 1IKWB 3MM9B 1MROA 3DRSA 2JC0A 2I0XA 3CTRA 4MH8A 2LEBA 5J2NA 4RW9A 4IO9Q 2OPRB 4P2SA 2XNRA 4X84A 2W8LA 2MKHA 2K3KA 3MD3A 3RR8A 4R8UB 1ZM3A 2H5EA 2HWTA 4LJMA 3JYTA 5A8KA 4GO5X 5KFRA 4F3MA 1NH7A 1UP1A 4H4MB 1SKRA 2DVIA 1OPIA 2G4BA 2VG7A 1M5KC 2LECA 3IBWA 1QSYA 1TAUA 5A6PA 3I9V9 3MPVA 1HW8A 2J9DA 1RT7B 2EK1A 3MOZA 5AXLA 2WHOA 1IQZA 2IMOA 3HXMA 3SZ2A 1YG0A 2Z2MA 3M2VB 1QVFR 1KEKA 4DFMA 4IYQA 5LSRA 2WK4A 1S6QB 4OZ0A 2E44A 2ZH5A 1P8GA 4BWMA 1SJRA 3OFEA 4IG3A 3Q0AA 2FVPA 4KPYA 5KG4A 1HBNB 1HNIA 4ED8A 2BW2A 5KG6A 5DDRC 1U09A 4K4WA 4ILLA 1YRTA 4HT5A 2MKIA 5KFHA 2HWIA 2E5LF 4OZ1A 4DN9A 3KJVB 2GGPA 4YDDB 3FRZA 2E5JA 2AJQA 2MZRA 3KLIA 2M5YA 2D1CA 2ZOMA 2VFTA 3QIDA 4DJBA 2ZUGA 4X65F 3H5XA 1FVQA 1VQSA 1ZJWA 3OJSA 3MM9A 2LLZA 4ZPTR 4LF9F 5GAGW 3BQ0A 4PG6A 1C0UB 3D28A 2J7WA 5KFXA 3IAS9 2D7SA 3CIMA 5HI7A 4Q45A 3HHKA 3H25A 2VL1A 3JB9k 2DGTA 5IT0A 3MMJA 1GXTA 2D41A 1H0HB 1WHVA 1JX4A 2XMKA 4YB6A 4B3RF 2AF6A 2PD1A 4QPXA 3KG0A 1FJEB 3GWCA 4RBVA 2YH1A 5LJ3Y 1S97A 2VC1A 2FJDB 2M2BA 4DV2F 4F25A 2PDAA 3MMBA 5AE2A 3M2RA 1YJRA 2CPYA 4DUYF 2DGXA 3NG8A 4IFYB 4C0OC 1GTHA 5KT7A 3B82A 2WONA 1OIAA 2LQ5A 4MKAA 1D9AA 5KOXA 2QT7A 1LWFB 1UL3A 1B7FA 2GIRA 5FDLB 2W8KA 5DETA 3FNNA 3CCMS 2DR9A 4Z37A 2JVRA 1U24A 4NYZA 3DDKA 2AWZA 4KE5A 4JI8F 3E8OA 1BQMA 1GT8A 4R25A 3C6UA 4NCGA 4EZ6A 5IS2A 1YJWS 3MECB 4QIWD 3OTDA 2R4FA 1JLGB 1R6YA 4QOTA 1HHSA 3MUMP 4O3SA 3FSXA 2HHHF 1O8BA 3EGWB 4IDKA 2RB7A 1DJ0A 2RU3A 2XHWA 2GGPB 2LVWA 1U1QA 1G2EA 4A8OA 4PUOB 2VB6A 5DLFA 4RWXA 3X1LB 1IKVB 3THPA 2ZC3A 3DNCA 1MROB 4F50A 5C25B 1T03B 3KLGB 2OPRA 2CZVC 1Q8BA 5KG0A 4B9MA 2ZFHA 4OMFG 5AXMA 4EZ9A 1C0UA 2J0WA 4EYHB 2C2RA 4A4JA 3B8HA 2OSQA 1RT4A 2CJAA 1CEZA 3IC1A 3T1YF 4RKUC 3F44A 5HO4A 3M6WA 4E8UA 4ES1A 3FRYA 1TL3B 3M8QA 3BF4A 4PWUA 2Q79A 4ECYA 4XDDA 2EFVA 2VOOA 3K5NA 4W90B 4DSIA 2HAIA 2MYFA 5KFPA 4QYRA 2ZM6F 3OLAA 2WONB 4FNHA 3EPIA 2AW0A 1U48A 1JLQA 2DNGA 2YH0A 2NPFA 1FXLA 4NLTA 4TKTA 4QIEA 1VRTB 4BCAA 2B4OA 4OLOA 1AFJA 1ZBTA 4ZVEA 4NA3A 1TV6A 1MMDA 2RQCA 3T5KA 4DX8H 1HPZB 2OPPA 5C24A 2E9RX 2HW3A 4C2MA 3MF5A 2YKQA 2VQEF 3UFCX 2R8JA 4IDKB 2BQRA 2BA9A 4DEZA 2YKPA 1KS2A 3M4XA 2IRYA 3H2LA 1EP4A 3HVAA 3MDFA 5GAHW 1RYSA 3LP1A 2MHEA 5IZHA 4CI0B 5C25A 1T03A 1IR0A 1LWEB 1VBXA 4K5RA 1K0TA 2V8GA 1H7XA 3OSPA 3T5HA 2DRAA 1SBRA 4ELUA 2O66A 2DNKA 2QSWA 1NRKA 2XI3A 3QGHA 4Z2XA 4DL2A 1ZTTA 4G1QA 3ZZRA 4B9LA 2J9CA 1WI8A 3OTBA 4HI1A 2W7PA 1RAJA 4Y2IA 1GTSA 4D3GA 3CJ0A 3N01A 3J7A1 1B0TA 2F1FA 2E5GA 1FDDA 2DCUB 3C6TA 2CFXA 2JH3A 3MEGB 3SSSA 4WFYA 3M8RA 4CH0S 2MKJA 3CCTA 3EX7B 4NRTA 4PXCA 5LT5A 1FJCA 1HD0A 1FT8A 3U7JA 1T95A 2LMIA 3I4HX 1NKEA 4LF7F 3DLKA 1Q8IA 3HDSA 2YWKA 4O0IA 5U47A 2O1PA 1N5SA 1F9FA 4ZDNA 5BJRA 2IYGA 3V4IB 1B0VA 5CQGA 5LMUF 4UOCA 1S72S 4ZPVR 5F8MA 2B3TB 1N34F 2CQ4A 4ECUA 4RU2A 3K2YA 2MKKA 2VBZA 4IO1A 3V81A 2EK6A 1JWWA 4WFAS 4KHRA 3B4DA 5E7OB 2OMLA 5DS7A 2D74B 2MB0B 3RRGA 2LXFA 3PR4A 2POKA 1F60B 4KB7A 5EX3A 1G7CB 3TVZA 4DF4A 3SCKE 5DM6S 2DT9A 1N56A 2EBGA 2YNHA 4TYBA 5DRKA 2R8IA 2F40A 1AUDA 1CLFA 5HL7S 2J0XA 1TKXB 5H9EJ 1CQNA 3FZBA 1O0PA 3ISZA 2XY6A 3TA0A 4ED3A 4Q5VA 2OAUA 4PQUB 3GE9A 4RW4B 4HVZA 5KFNA 5B0CA 3PX6A 4DSKA 1H2UX 1SL0A 2GMJA 1QAJA 4MKYA 1UVJA 1NJXA 3MEEB 1DAXA 1VQ4S 4NZ0A 4PPDA 5GVQA 2IC3B 1SJ1A 1A7GE 3OFHA 2EW9A 4WK1A 4ES3A 4LMZA 1HA1A 2DK2A 3I87A 2SXLA 1X5OA 2GMHA 4NZ7A 3IAM9 2PN6A 3LW5C 3R5BA 2O01C 4Q44A 1MW7A 3NBPB 4DFKA 2DHGA 1J5OB 4WE1B 1R8PA 1VRUA 1ZAXA 4O3PA 1TK5A 4ZVGA 5LXRA 4K4TA 4I4BA 3H8YA 2G13A 3U27A 4AFFA 4F02A 2IYIA 1REVB 3LQVA 1NNDA 5GMKa 4ZCLA 2CQDA 2IVFB 1RTDB 5B0GA 4I64A 2NXUA 4TQRA 1GTEA 2YX7A 3UWTA 3GFHA 5J2MB 3RB6A 4UY88 5B08A 2QMWA 3OHBA 5L1LA 4PRFA 1VIOA 3RAXA 1NK6A 4BDPA 1UJ4A 4DQPA 3PEHA 2UUTA 3C66A 4JI6F 2HVIA 4WF9Q 2R9LA 4DG1B 2B6AA 2C2DA 4CO3A 5BYSA 3TO8A 1ZPVA 3RRHA 1UWBB 2RDJA 3H40A 1R31A 1Y5NB 3OFFA 4YR2A 1W2IA 3MURP 2KXHA 1U8SA 5J2QB 2OD4A 2UUCF 2VA3A 1UVMA 1V3ZA 5KFUA 2LU1A 4UUXA 4F4KA 2FB0A 2W4DA 2YY3A 3N5BA 4X62F 4AE5A 4JV5F 2GW8A 1JLAA 1SH0A 4HT7A 2KFNA 4IOBA 2V4RA 2FHOB 4OJGA 5DJBA 3N9UC 4WCES 1RT1A 2NLWA 3O44A 4ZPBA 1S1XA 3TANA 1VRUB 1UFWA 4W92B 3S7RA 5B7WA 4TYAA 3QO9A 1NYLA 4JXZA 2RUGA 1S77D 2J0SD 3Q2SC 2VFVA 4IO9S 4NLDA 1REVA 3US5A 3I0RB 4J9PA 3DYAA 4IKAA 3CCJS 3MUTP 3PM9A 3H5UA 1SKSA 4ZP9A 3PFEA 1QSLA 2MY8A 2ZBIA 2LQJA 3H2UB 5GAGI 2LA4A 2RKIA 3TAMA 1NEEA 2CPHA 3JAMY 2YNHB 2WSCC 2UP1A 1BQNA 1QAXA 3JTNA 5DDPC 4PCQA 3QJJA 4KHMA 5I4MA 3U1NA 2GHVC 3RZAA 5E2QA 3NGDA 2PIIA 3WBZA 1N88A 3IR7B 4I56A 2F4VF 2IMWP 1D9FA 1FEUA 5F8JA 1JIHA 1HWUA 3TP2A 5GAEI 5J1PA 3O5TB 3MOJB 5E3AA 2QO3A 4K50A 4GO7X 3UDLA 1A6LA 2OTLS 1HWIA 4XIUA 5I3UA 2W25A 3DLKB 2ABYA 2A18A 4DR1F 2J6SA 1FRJA 3QJLA 4DQSA 1GAOA 5HMYA 1UA0A 4IG0A 2GCFA 4IG3B 4FNIA 2ASLA 4DFJA 1YI2S 3AH6A 1HBOB 3S1TA 5D8HB 3AY0A 3DDNA 4J9OA 1HARA 1FO1A 2QRRA 3IG1A 4HL9A 4JI0F 1HI1A 1X5TA 2FHJD 2NR0A 3CGIA 5CA5A 5KG2A 4A8SA 1M0SA 4N47A 2NYIA 3M8SA 4NA1A 3IO1A 1KQSR 3G6ES 3LGMA 3FMWA 1YJNS 2VBXA 4RNOA 2VFUA 2XLJA 1KVIA 3ZZTA 5MAOA 2QA1A 2DGSA 3DOMA 3MFHA 2I1RA 1QM9A 4OI3A 3P49B 4OX6A 2F9DA 2RKIB 2CDQA 2V94A 3TAMB 3KLEB 2JLGA 2ZJRS 3F56A 3L09A 4ELTA 3BSOA 2HFNA 2XG8A 2IA0A 1BQNB 5E3CA 1C0TA 1RTIA 4X4UA 4PQUA 2BJDA 2ZJQQ 3MCSA 2W9CA 3AB4B 4CO0A 1B0PA 1WEYA 2B6AB 2OMOA 1GX5A 3M6XA 2FLOA 2AQ4A 2VFSA 2VH7A 2DPJA 4KGMA 2RVJA 3CDEA 3KLHA 1EETA 4K4UA 1KOHA 1HBUA 2DHXA 1T02A 2AV5A 1C4CA 4TY8B 3TR5A 3MR6A 2M8HA 4LSNA 1Q86T 4QCLA 2BQUA 2Q1LA 4CO1A 2FHJA 2AGPA 4RW6B 2Z8QA 2BRLA 2GFFA 2B0GA 2L9WA 1Z2LA 2RU9A 1WEZA 1Y3KA 2MQMA 3NBPA 2E1CA 2W9BB 1FRIA 1M5SA 1ZAVA 1ZM2A 4A8KA 3ETOA 2XMTA 5AXKA 4PR6A 1V9OA 2KHCA 1NJYA 2BANB 1RT5B 2KRRA 4ZPWR 1NK8A 3EYZA 2P9GA 1Y4ZB 1L3UA 1DZ5A 2P9CA 2AJ1A 3DLLS 3O6QA 2KM8B 1U1MA 1C2PA 1FVSA 3N4WA 3SSRA 1WHYA 5IM0A 3VAIA 1IBLF 2KDOA 3FEYB 1RTDA 3BS9A 1VOMA 2NSCA 5A8WB 4OV1A 1AROP 1HD1A 2ZE2A 4WFNS 2F8EX 3HHLB 2K1RA 2XY5A 2D3UA 3DXSX 4X2BA 1T3OA 1TR0A 4A46A 3DU6A 1QLNA 3QLHB 3HJFA 2CQBA 3WC2A 4C4WA 2NS1B 2ZDPA 2ZH3A 1T94A 4Y2KA 2W9CB 2B5JA 2V4JA 4K4YA 2OKQA 3EGNA 1YBAA 3VAKA 2Q43A 4F4ZA 2UXBF 2X1GA 1S9FA 4QIGA 1L3KA 2HNYB 3UQSA 4J9MA 2V8DA 4M1KA 4NYOA 5I3QA 1VC0A 2R8GA 2DNOA 3M8QB 5K8OA 2B7BB 2DR5A 4TY8A 3ITHB 2UXDF 3CWJA 1IJFB 4NLUA 3DM2B 3KK2A 1Q81T 4I2QA 2V4QA 2DITA 4ZLPA 1SC6A 5L1IA 1X9WA 3NCQA 2FY1A 4M5DA 1JLCA 4IG0B 3QGIA 3E01B 1JLEA 4QJVA 3LWMA 1SJ3P 1NJIT 4JOUA 4MFBA 1R0A