3X1LB

Crystal structure of the crispr-cas rna silencing cmr complex bound to a target analog
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
322
structure length
319
Chain Sequence
MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLSREKKVVEEGMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the CRISPR-Cas RNA Silencing Cmr Complex Bound to a Target Analog
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Rna binding protein/rna/dna
molecule keywords CRISPR system Cmr subunit Cmr2
total genus 64
structure length 319
sequence length 322
ec nomenclature
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3x1lB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3x1lB03
4H4KA 3W2WB 3W2VB 3X1LB
chains in the Genus database with same CATH superfamily
3C46A 2R7SA 2DKOB 2J6UA 2YPZA 3AQOA 2GMHA 4C8MA 4FZVA 4W92B 4H54A 3R8YA 5DDPC 3L09A 4I4BA 1SUQA 4LRCA 2PMWA 4A8XA 4QBUA 1QAIA 3P6YC 1F60B 1WC5A 2BJEA 2V94A 5HL7Q 2RQCA 3RAXA 2LXIA 2FVPA 1HYSA 2RAQA 4K2JA 3R5CA 4ZVQB 1SJ4P 1QUPA 2DR8A 1T11A 1MROA 2HEKA 1NPKA 4NZ0A 2ZBIA 2HBZB 5BYRA 2MQOA 1ZETA 2VOOA 1L5UA 2BDPA 1RA7A 2E5IA 3D1OA 2CPXA 3V6HA 1V3RA 2G2OA 4ITSA 2FDNA 2CX8A 2N7CA 4ZVFA 1KR4A 2BA9A 4L75A 4QWBA 3OJSA 3A3NB 4KJIA 2HIQA 2HHSA 4DPUA 2AJFE 4DXLA 3OFEA 4M5JA 1VS3A 4ANEA 4ZMMA 3QLHA 2FQQB 3F73A 4DV3J 1IWGA 3B82A 4KRWA 4NZ7A 1MW7A 1L3SA 3T1YJ 1RBOB 2MHEA 4JB8B 2KHDA 4NLRA 3OW2R 2VA3A 2X1FA 1GTHA 4K4VA 2J9DA 1HW9A 3TZYA 4MYUA 3TVZA 5GAHI 5ETVA 5D15A 4MKVA 1K0TA 2K1RB 3EDRB 1QLNA 3I0RA 2FZKB 4FPIA 4C0OC 1T9XA 1CJKA 2V8PA 2KFNA 1S97A 2CNOB 3ZZOA 4IOCQ 2FLLA 2XWXA 3D3CJ 5MLCV 3EE3A 1AT1B 1VQ5S 2LA4A 2LVWA 2YKMB 2ZKTA 1Z1ZA 3NBPB 4A8KA 1F2HA 3U02A 2FHMA 3PIOS 1ZA2B 2CZ9A 4USMA 1X8DA 4EO8A 4O3SA 3JQMA 3TJ9A 4YDXA 3MR5A 3TARA 1Q8IA 3QQCD 3QIPA 1X0FA 4IOAQ 2EGVA 1VQSA 1X9WA 1RGVA 2DH7A 1MG7A 4Y3CA 5A8KA 1S6QB 4WFXA 5B0GA 5M2PA 2XGPA 3MFIA 3JSMB 1M1KT 4KHPJ 4M5DA 5G0RA 2JLGA 4M5LA 4MFBA 4C7QA 5ITHA 1LK5A 3M6WA 1HW8A 1LWFB 2BJ3A 3G82B 1TZ0A 3EM1A 3CJQA 3GR0A 4I1TA 5AE3A 2C2OB 1JJCB 2AEFA 2Z30B 3M9NB 2VC0A 4MFBB 1VRTB 3BKUA 3BYPA 1B70B 4KGZB 4B9TA 3W9IA 3FBBA 3JAMU 1E6VA 3DRSB 3FMWA 1HIYA 3CDAA 4LRFA 4USJC 4WKYA 4U95A 2FZGB 4LREA 1A0OB 4CO3A 4W90B 4OZ2A 2Y1JA 4I64A 3U27A 1NJYA 1O5JA 5F41A 2E5LJ 4CNYA 2Z56B 1REGX 2GAEA 1E6YA 4DV6J 5HMYA 2ZH3A 3BDPA 3OVBA 3G87A 3MCMA 5AXNA 3QGIA 3SYZA 2X1GA 2DEJA 4IG3A 3D2WA 1U0SA 1FKPA 1UFWA 3I87A 2E44A 3QJJA 2DHHA 3L7PA 4ID5B 3QGGA 3RJMB 5L8RC 3OVAA 2KG1A 4FBTA 1R0AA 1I3OB 4RL1A 3T1YF 2ZH7A 4LVNP 1TUWA 2HGNA 2Z57B 1BQMB 2GIQA 3GLJA 3I5CA 4I56A 4OYBA 3PRVA 2YH1A 2GX8A 1Y00A 1ZPVA 2J0XA 4L6V3 2CNKB 3FJ2A 1TUGB 2H4WB 1R8HA 2KZZA 2J7WA 3CJKB 4YR3A 3TUJC 3A3OB 5IOLA 3W64A 1EAYC 1SH0A 4I67A 2HZAA 1BY9A 1UEUA 1DTQB 4G1QA 2BQUA 2KT3A 1QSLA 4P52A 4FXWA 5K9FA 1KQGB 1JJHA 3M8PB 2LA6A 2CPDA 2JVRA 2JZ5A 2KHCA 4XAKA 1M5HA 2XQCA 1SIZA 2KXNB 4UTGA 2Y9HA 3PIPQ 1URRA 5L1JA 3M8WA 2EFQA 4DL4A 1E6YB 4OZ3A 1U6ZA 2W7AA 1RHKB 2F7VA 2YNFB 3PXGa 3VTIA 2E29A 1AROP 2XMUA 2GVDA 3EUNA 5GMEA 2HQDA 4ALZA 2L9WA 3M9MB 1AB8A 1Z2LA 3LAMA 3LA0A 2E1PA 4G6VB 4WBFA 2HHUA 2KXHA 1GTSA 5HMZA 1M1GA 4B17A 5LSOA 2DXDA 2JC1A 2VG6A 4WWSA 2CNLB 1H72C 2OP5A 3GV5B 3TJAA 1U1RA 4LFCJ 3AJ1A 3CDBA 4DV0J 1CC8A 4ZN1A 5GAGI 4YFUA 3UCUP 1FDAA 1S1UB 1X4HA 3U1MA 2NREA 2HWTA 2P5VA 4JYAJ 1PBUA 1ZPWX 1SC4B 4K8RA 5BYQA 4ED0A 4ZVGA 1JLAA 2NSBA 3IG1A 4KBIA 5HJXA 2V9WA 4DV5J 3RB4A 3QLHB 2VKRA 4FXDA 5JXSA 1C1BA 2PD1A 5A2QU 1KOOA 3QT5A 1OSCA 3FQKA 3S7RA 4DLEA 4A8WA 2GHPA 4RW7A 1PJ7A 2W4PA 2YKNB 3H2LA 5AXMA 5KFXA 4IG0B 3THTA 4DCPB 1VRUB 3MURP 1XMOF 4WFAQ 3OTBA 5B0CA 4LBIA 2HBQB 4HI1A 1TK0A 1M90T 4JI0J 3GPAA 3N5FA 2HHQA 4N8NA 4DQSA 2ZH2A 4RW6B 4PPZA 2DNLA 3ADAC 3TVYA 4CM0A 3MM5B 4BC7A 4CCHA 1MSWD 3CULA 3DYAA 1RQ0A 1J5OA 3GFZA 1YJTA 2FIUA 2WBRA 4NCAA 1ICEB 1RU1A 2C2KB 2H1YA 2JVOA 2HG4A 2KYZA 4X4NA 4C8ZA 4B3SF 1GMWD 2IHR1 4ZIWA 5F0WA 2QRRA 2MEWA 1QDUB 3TVKA 5F8NA 1BMQB 4KPYA 3Q8QB 4OQJA 1NZAA 5IT9Y 3DLHA 4WK3A 4R25A 2V4RA 4WCEQ 1JXEA 1OY9A 3IGNA 2XLKA 3NGRA 4NMLA 3MMBA 3UFCX 3OL8A 3TAMB 2A2DA 4WXWA 1JLAB 2BE7D 4A8MP 1IWAA 4ZCIA 4QW9A 2FJAB 2W9CB 1WEYA 2ZE2B 2RRAA 2XI2A 4C0HA 1BQMA 4EK2A 4FNHA 1BE4A 1XR5A 4QU6A 3E2EA 4LUBA 3J7A1 1NB7A 3OSPA 3HHLA 5KG2A 1F9HA 4JI7F 2I5JB 2UUTA 3BGRA 4LSZB 4OJHA 4OYIA 4U8VA 2J9EA 3MAAB 4PYDA 4LFAJ 2EC2A 2FGOA 3AH6A 4CLUA 3GYXB 2YVSA 4RW7B 3ZTQA 1RHRB 1RAJA 2E1AA 3HSDA 5C25A 4GKJF 1S6PB 3C6UA 4PUOA 4L3KA 2RT3A 1EQMA 3HX9A 4Y28C 3GV7B 3RBEA 2CIMA 4F4ZA 5HROA 4QCLA 4G1PA 3PJXA 2QFJA 2KKHA 2WVEA 1OWXA 2ZHBA 4FXVA 3TQEA 1S99A 1FK9B 5B09A 4QPXA 4J7CA 3KLFB 3IAS9 1EUQA 2MSSA 4U8YA 3NL0A 2M7SA 3CCMS 3V4IB 1NK8A 1RAIB 3CTRA 4ZCLA 4OHZA 5CXTA 1EKSA 4CLWA 4CLYA 1YJUA 2HBRB 3EVWA 4WPAA 2X1AA 4KT0C 2V34A 2GZOA 1VCTA 3M8QA 1N36J 4FPRA 1X4BA 4K5SA 3N01A 2XY7A 5KG6A 2VH7A 2G5DA 1TL4A 3QJPA 1B0PA 4USTA 1RLCL 1UWBA 1U45A 2HMIB 1YK9A 2ZUGA 4CTAA 3HM9A 1H7XA 1UPMB 1R43A 2ZD1A 4G65A 4H4MB 2FLOA 4OX8A 1H98A 1LK7A 3ZZ0A 3RAQA 2LQ9A 2MZQA 4LT6A 3BSNA 2WVDA 1CJKB 1ZZNA 2EBGA 3C3LA 3G96A 1KLNA 1F0XA 2DRDA 3C2PA 3SXLA 4J9OA 1IJEB 1BD6A 1R7IA 2JNJA 2K1RA 4KHMA 4DR2J 2B9YA 3Q83A 4ZCKA 2IJRA 2W01A 2DGTA 3A8EA 2M88A 2FC8A 4TU9A 4RNHA 1FE0A 2KH9A 5DO2A 2UV8G 4YB7A 5IXUA 3PKMA 2DGOA 4I2PB 1DLOB 1NSQA 1JLQA 3NOGA 3MUMP 1RZMA 2D3ZA 1NB2A 2QLWA 3C6UB 4PUOB 2JSXA 3DXBA 4K4XA 1RADB 2DRBA 3MPVA 1Y3KA 2ATCB 4ZPBA 1NKEA 2QA4S 2XTJP 2JHEA 4Y2KA 4NYOA 2XM3A 2YH0A 3MEGA 1F6TA 5JUMA 4DPYA 4F4XA 3T1HF 2HQ3A 3ISZA 3M2UA 4LQ9A 1O0PA 3DMJB 4X62F 2Z0GA 2ZH4A 5ETTA 2C42A 4IG3B 5HBMA 5IFMA 3QIPB 3MM6B 4CTAB 4ZJLA 3VALA 4IR1A 3HHNB 4WFNS 4KY3A 4OYAA 1S1TB 3Q8YA 3PW5A 4YDDB 1IKWB 2XSJA 4NE9C 3LF0A 4QJVA 4UOGA 1NM2A 4UZBA 1DJ0A 4DV4F 4PQUA 3RB3A 2UZAA 1S1XB 1J2VA 4IOCS 2I2YA 1VRTA 2HAFA 2YKAA 3IR7B 2NUHA 4M5GA 4LF5F 4ETZA 1RSCA 4EMDA 4ZVHA 3DHWC 2PI5A 1DTTA 2DXEA 1EARA 2MZTA 1X4FA 4F3QA 3DM2B 3KK2B 4M94A 3IMQJ 2UXCF 2V67A 4F2SA 2BKOA 2FTRA 4QYRA 3DOMB 4HEA9 1I1GA 2RU9A 1WHXA 2CKWA 3W2WA 5EHHA 5DGAA 1HNVA 1N0VC 4CNZA 1WF2A 4BWMA 5B0BA 3MEEA 4DUZF 2VICA 3W63A 1M5VC 4A8FA 1IKVA 1YVFA 2QIFA 2WAQD 3ETOA 3KDOA 3MM7A 1WDDA 1HI8A 2GMJA 3KUGA 4O3NA 2B8PA 4KGKA 4N47A 1U09A 5F8HA 2EG2A 3A13A 3DKDA 3ISND 3NG8A 5I4MA 4XTTA 2DNKA 4UW2A 1LWCB 2OPSB 4WIIA 3BEGB 1U1NA 2B7BB 2LQ5A 2ZVIA 4RW9A 2G0JA 4YOEA 4OL8A 2C3YA 3CCTA 1TKXA 2IM0A 1V3SA 2RSQA 2QLBB 3NP5A 1MU2B 5LXYA 4FN5A 2ROPA 4OZ1A 4P73A 5A8WB 3ZC4A 3QZ8A 4DV2J 3HF5A 1N5YA 1JJ2R 1S1UA 2EPIA 2O1PA 3PHTA 5KFWA 2NXEA 3UR0A 2YNIA 3ET6A 1FXDA 1ZJWA 2WVCA 4OYWA 1T9TA 4OI1A 4C48A 2V0NA 1UEKA 1UZDA 1S1XA 3QATA 2B7CB 4ZVUB 5IV4A 3RG6A 4NLDA 2CVIA 2BXJA 2HRTA 4N41A 3CD0A 1ZM3A 3MECB 2XCAA 3E01B 3HKZD 2CQ3A 5BJRA 2WVFA 5IWAJ 1Y5LB 5GMKa 1AW0A 2OPQB 1U2RA 2VU5A 1T9WA 2RJZA 4YY3F 2NXJA 4B9MA 3K5NA 2H5IB 1F5CA 5MAOA 4F7VA 2VG5B 1TL3B 5LJ3Y 2EFNA 3CIMA 1Q8LA 3TA0A 2V5HG 4KFBA 4Q44A 2QE5A 5HO4A 4DL7A 4Q2LA 1C4CA 2HHWA 4N5SA 1D9FA 2Y8WA 5ETLA 2HFSA 1UA1A 3B6BA 1WC3A 2CPEA 3NLCA 1HR0F 2FPHX 1X4EA 1V6HA 5C42A 1TKZB 4MIWA 1G1XA 3UD5A 4ES2A 6FD1A 1RAOA 3K58A 5EN1A 4MTPA 1T9YA 1HQUB 1VIOA 1VLOA 2GFFA 3GP9A 3I0SA 5ETSA 1D6KA 5GMDA 5A6PA 5B7WA 1LFPA 1S6UA 5JVHQ 1KDNA 3EZUA 2CPIA 2V2KA 4RR5A 4DX6A 3M8SA 1VQOS 1NJIT 4DV5F 2RIJA 3G82A 4J9NA 4H4OA 3MZIA 2HNYB 2GJIA 2N4CA 3O3LA 1RAFB 2DPIA 1FCAA 1OPIA 3BV8A 3OXGA 2W2MP 4QYZJ 4ECRA 2ZD1B 5JVGS 1W26A 1RWUA 4UQTA 1TL7A 2DR7A 2VG7A 2IIHA 1TVRB 3M2VB 4IFYA 5BR8J 2DY9A 4LFCF 2ZH8A 1WUUA 3OTEA 4F25A 3JTNA 1TKTA 3KG4A 3GTYX 1RWVB 2VFRA 2H48B 3B54A 1WG5A 1JB0C 2AW0A 1PC5A 2CQ0A 4NLVA 5LOQA 5IC6B 2MLYA 3TANA 3K8VA 3ZNJ1 2MQLA 4LF7J 1WHWA 2CG8A 4G3IA 2MKYA 2WHOA 1FRHA 3QIDA 4ZHRA 4EUVA 3I0RB 4DR1J 2O01C 1TFYA 2ZJPS 3VR1A 1QE1B 1LWFA 3AD7C 3MUVP 1SJFA 1S5ZA 3A1YG 2EBEA 3DNCA 3I4PA 4DV6F 4U7CA 2C2EA 2IBOA 3CMAS 2HWIA 2LQ8A 3T19A 2HS3A 5KAKA 1JXLA 2GO9A 2DT9A 3QNWB 3G8QA 1RU2A 4W98A 1U6FA 3GR1A 2A18A 2DGVA 1S9GB 3CF5Q 3H5YA 3GIJA 2GV1A 1C0TA 2XNQA 2CPJA 3EICA 3K5PA 1H6KX 4YEAA 1VK3A 2OI2A 4Y2AA 1G4CA 4FF4A 4AQYF 2HVIA 3HMJG 3I5AA 1AZSA 4TQSA 1IBLF 1TKDA 1U25A 2HK2A 4C0BA 4C8NA 1RWWB 1WC1A 2XEXA 4I7FB 2KL8A 4LF4F 1BGXT 3RR8A 2W9AA 3OLAA 1X5PA 1S7HA 5GAGW 1P1LA 2KT2A 1CS4B 1XMBA 1WTFA 4RKUC 3HD1A 4LSLB 2AEMA 4JV1A 3PR5B 1GH8A 1NMEB 3IRXB 3S1TA 4CO0A 4MKBA 2BANB 3KFWX 1RTIB 2XS7A 1AFIA 1JLBB 3CSKA 1D3WA 2DNRA 3CCRS 4OZLA 3KHHA 1M5PC 1IM4A 1HPZB 2CWXA 4DPXA 3K0JA 1BQNA 2DK2A 1NXIA 1Q16B 3DRYA 4RW6A 1S6QA 3D0GE 1EETB 2CQPA 4NLTA 5F8MA 3RZAA 1RTJB 4OI4A 4WU3A 2Z8QA 4A8YA 1ZYQA 1RTDB 2MQPA 4FF1A 3DLLS 1ULRA 3HK2A 3I31A 1UP1A 1DHMA 3HZEA 3KG1A 3EGZA 1T03A 2V63A 2MPUA 4N76A 3NBPA 1YHQS 5K8MA 5CCMA 3L95X 3FCWA 7FD1A 2SXLA 4IG0A 4QWAA 4DR2F 4B3TF 5DQGA 4WTOB 1CJUA 2RILA 5D3GA 4GKJJ 2WOMB 1BC6A 1OJ4A 2XYHB 3MMCA 4ECZA 2VODA 1RWPB 3NXZA 2EW9A 2H5JB 4FF2A 4KKOB 1RT4A 2GIFA 2XBPA 2OPSA 1FJEB 5BYSA 4C8OA 3BGOP 4DHVA 3BQ1A 1ZAVA 1RTHB 2JH3A 3J80U 3MXHP 3HVWA 2MDAA 2QN6B 2GJ2A 3CCSS 2ZEJA 1ZZFA 5T41A 4LF8J 1IKXA 1SC1B 2VBWA 2VF3A 4UZCA 1KQFB 3G71S 4DSEA 3SI8A 2AT1B 5CA5A 1S1TA 5B08A 4I6YA 4F4WA 2M8DB 2OKQA 3GJTB 1TL1A 4IRDA 2KM8C 1TMMA 1X60A 3BJYA 2W7OA 1XQIA 3EPIA 4PWUA 2GA7A 3IN5A 3K57A 3F0NA 3SCIE 3V4MA 2R7TA 4RW8A 1HPZA 3RU0A 3G8SA 2CQIA 3LALA 3CJ5A 3H4DA 2EGWA 1SL0A 3I32A 1YJ7A 2LLZA 3WHIA 5DM6S 3MPWA 1DTQA 3IXQA 4LF6F 3MPYA 2ZNZA 3BQ0A 3PCOB 4K4SA 3HKWA 3I0SB 3PDNA 4YR2A 1XNRF 3PG9A 4KV8A 3DI6A 2MKHA 3V5RA 5DQHA 1H3DA 4LR7A 2RDIA 3X3UA 5D77A 5IM0B 4V19J 4HDGA 3AOAA 2C3PA 3I82A 2QC3A 4QU7A 2PNWA 2DH9A 2E5GA 3ITHB 4OZJA 3I9V9 1FE4A 5HBMB 1RBAA 2IAJA 3DOLA 3FGVA 4LRAA 1F9FA 3B8HA 2W7PA 4I6AA 4CO1A 4QR0A 4O4RA 1FEUA 4TU7A 2CQBA 2J8SA 2KM8B 4O0IA 4X84A 4M1KA 1Y9OA 2E1RA 1S72S 1Q82T 2ZBPA 2GIRA 1FJ7A 1ELOA 3AXKA 3TW0A 2HS4A 2R3VA 4UY88 2MQMA 3D1HA 1TVRA 3EVMA 2RE1A 2ZC3A 8AT1B 1N88A 4X4SA 5HN0A 3LWLA 3ILIA 2XI3A 4DG1B 4D3GA 2ZJRS 4J9KA 4P2XA 1TAQA 3ZTOA 4KTQA 1X4GA 2VBZA 1HNXF 2VUGA 4LF7F 4ZPCA 4ZK7M 1U1MA 2MMYA 3KLIB 3DHXA 3BH7B 5K8NA 1VQKS 3OFFA 4IRCA 2W2QP 2KJWA 3GU0A 1FTRA 5KFYA 3P5BP 4X4OA 4ED2A 3CJ2A 1PKUA 3DXSX 3K89A 4W4MA 2O3DA 3G9CA 1YRXA 2BJDA 2V8GA 8RUCA 1U6BA 3WQPA 5ETMA 3K17A 3NY0A 1FO1A 4BWJA 5C42B 3DDNA 3MFHA 4J5OA 1L3KA 1GMVA 1PYSB 4F0HA 5A8KB 4ANCA 3DU6A 2ZOMA 2KG0A 2YKMA 1RB0A 1VFJA 3KJVB 1Q0NA 4ILRA 4RUBA 1UZHA 4ED1A 1B0TA 3LUYA 1O0BA 1BLUA 2AYMA 1VQPS 4CI0B 1YRTA 2KYXA 4Q45A 2UUAJ 1DBDA 2OPRA 2VG5A 1QTMA 2W4DA 4LF1A 3LO3A 1JQGA 2CJXB 3W61A 1WC0A 2E7XA 4O23A 4CT9A 3M6XA 3OPKA 4NRTA 2H5EA 2ILYA 4F0MA 4Q5VA 3TA1A 4QIWD 2GHWA 2W25A 2UUBF 2ZWOA 3VGTA 3R2CJ 4IFVB 5IT9U 3D0IE 3R7NB 1YI2S 3RYLA 1RHQB 2AJ4A 2L41A 2Q6BA 1T05A 1QVGR 3CVKA 5A8RA 2XMKA 3HO1A 1KN6A 1MN7A 4GO7X 4NLPA 3GJSB 1YTYA 4K4TA 3W66A 4O44B 3IAM9 5F3ZA 1UL3A 3BGRB 5EUHA 5JVHS 2U1AA 1J27A 2DISA 1HWIA 1VGYA 2MY7A 4DX5A 4WKRA 1F3FA 3SMZA 1GXLA 2V9KA 4JUZA 5J2NB 3BO3A 5K14B 1XMQF 2XG8A 1YBAA 2YNGA 5D0GA 1U1OA 2BM0A 2HGLA 3CGIA 2MSTA 1DQ8A 4AD6A 4YUDA 1HBMB 2OAUA 2OMOA 1LW2A 3KHLA 1XWLA 1SL1A 2YWFA 3PEHA 3JQKA 4H4KA 4QIEA 4TU8A 2R2RA 4WE1A 3NGSA 1I94F 4JI5J 3OUYA 1R0CB 2KI2A 3HJVA 4RNMA 4Z2XA 3MEEB 3VVTA 1WWHA 3HHDA 2PN6A 3DN9A 2OSQA 1S9GA 4DF8A 1XK8A 4LF5J 5LMNJ 1JLQB 1NPRA 2MJNA 3EZ5A 4DX7A 3FZ2A 3HSZA 1KONA 3CCWA 2WSEC 4NOHA 2ASDA 2OEKA 1FFSB 2MKJA 2G6GA 1FX2A 1N0UA 4DV1F 2BOPA 2RQKA 2DVIA 1NO8A 4ECVA 2VHGA 2EI5A 2D3OR 1NSAA 4V1Ak 3K5LA 1N5TA 2GQCA 2HQCA 4HHJA 3Q2SC 4JBCA 3VAIA 1NK0A 2VASA 3V6DB 1ZS6A 2XNRA 2J7KA 3KUHA 3MTJA 5HK4A 4DF4A 3JAMY 2QV6A 4DSJA 3RBDA 4PQUB 3TAQA 2J0SD 4LBPA 4B3OA 3NNHA 2OPRB 2M2BA 5DZ6A 3EXYA 2UXDF 1YZ7A 2JWNA 2ZOFA 1T7PA 3L9ZA 3ENVA 1XR6A 4K59A 3W5YA 4CWBA 2MXYA 3HHLC 1F1BB 3JS9A 1RYRA 3LH2S 1JKHB 1RT6B 3N4WA 5F8LA 4JV2A 2AMCB 3HT0A 2RS2A 2AE0X 4ZJQA 2OJ3A 3OLBA 1LKZA 2FHOB 1NCLA 1RCXB 4X2BA 2VFVA 2V6AA 4P7TA 5IC4B 2BBEA 1SCJB 1JLGA 2W2PP 1AUDA 4WCES 3CC4S 1JIHA 1MLAA 1VOMA 3N6LA 4ED4A 4LQ3A 4AYBD 1NAQA 2F63A 1M5SA 2RB7A 3R3TA 4RU2A 2AYEA 2L08A 1WG4A 2XGQA 3H0PA 3OT9A 4O3QA 2QA4G 2CQCA 3KLVA 5DETA 4YB1P 4KSEB 2G0CA 1M1HA 2MKKA 4MIAA 1HI0P 1DRZA 3D68A 3AB4B 4I2PA 1S6PA 1GMUA 3ILOA 2B8QA 4PXDA 4USKA 4LMZA 4L69A 2ZC4A 3I6PA 3LANA 2KJVA 4PZVA 2FHJA 3CCZA 4I7FA 2FY8A 3BGFA 3QAEA 2XCPA 3CCVS 2IRYA 1S1VB 3C19A 4RZRA 2ZWPA 3UD3P 2QO3A 5DQIA 5KFOA 2BJ9A 4UQGA 2FC9A 3FK4A 2BEFA 2L9NA 4F67A 1V6ZA 4ECTA 3BS9A 1L3UA 2HLUA 3F44A 4JOUA 1A7GE 2ACMA 2CQGA 4EFAC 1PGZA 4KR0B 1G7CB 2BJ1A 2D7SA 4WFNQ 2ACYA 2ALZA 2UVWA 1UFLA 3J7YU 5L1LA 2AQ4A 5AE1A 1I94J 2RHQB 5CAAA 1KVKA 5KFIA 3PX4A 4JI5F 2DNOA 4P9SA 3JSRA 3LP2A 3K7RA 3TAMA 3OHBA 2DHAA 4ZP9A 3V81A 3E51A 3HI9A 3OL9A 2BVZA 1RWNB 3W2VA 1TQLA 3EYZA 3T5HA 1T94A 1U26A 3N5BA 3POTB 4NLYA 3J7Z5 3NWGA 3TQ1A 4TLRA 3VZIA 3KLEB 1AFJA 3CDWA 1Y0HA 4TLQA 2WCXA 1KFSA 4UY85 3H5UA 4E98A 1W2BR 2DHSA 2RF2B 4OI2A 2YWKA 1RI7A 3PRBA 2Y3YA 2Z2ZA 1F5BA 2D3UA 2R7OA 2VDHA 3BGLA 3FFIB 3GIRA 3BM7A 3CCES 3MWBA 3WX4A 2CQHA 5I3UB 5JMNA 4RW9B 2CQ1A 3N79A 1HWUA 3NCRA 2FVQA 2NYHA 2NPFA 3BQ2A 5HANA 2OO4A 2ZDOA 1FEEA 1H0HB 2RU3A 4NXMJ 4ED3A 2IC3A 2CJKA 3PY8A 4Q8FA 3B4DA 4CLZA 2UVVA 1JMTA 1N5QA 5AJ3J 3AY0A 2CPHA 2Z2LA 4L76A 2NYIA 2YKPA 4M5KA 2DGSA 1ZH5A 2B5JA 5BXIA 3J81j 4EBDA 2KU7A 3EVOA 2R7UA 2RRNA 1M5KC 1WORA 4J91A 4F3MA 3VAFA 1KWMA 1UCNA 2IMWP 2JFKA 1R6YA 2P8IA 3HSGA 4FP9A 1UVIA 4DR6F 1UVJA 1FF2A 1ZAXA 3GCXP 1NDKA 1T02A 2DH8A 4FYYB 5D0HA 4R5PB 4DUYF 4ECYA 4D3HA 2C28A 1J5EF 2E9ZA 2XC9A 1HNWJ 4P2BA 1GT8A 2X51A 4NEZA 4PG5A 4RUAA 3W62A 3KYLA 1QJHA 1JLFA 2XZDB 1EIYB 3VZHA 3RB6A 3R7BB 3SQGB 4DEZA 4ECXA 4IH6A 3AB2B 4OYPA 1QSYA 3J7YI 1YX2A 3MM9A 1S1WB 3VWSA 1GEHA 5JJBA 1YKWA 3PW0A 2G1DA 1VBZA 5D78A 3KKFA 4DLGA 4OJ1A 5C5JA 3ZXWA 1S79A 4QR2A 1VI7A 2RKIA 4PG7A 3D6FB 4WJBA 4ZP8A 5J2MA 2CPFA 2XY6A 2F8HA 4DV4J 1IBCB 1NRKA 2FY1A 2R7QA 4P75A 2G9OA 1WOPA 2RQMA 4PWDB 1SUQB 2HFZA 2I38A 4PPDA 3WBZA 3FVYA 4PXBA 5H9EK 1JLEA 2CXEA 3LQVA 1Y7PA 3LW5C 1FRMA 1GNKA 5D4LA 5C24A 3RBZA 2BE2B 2C1EB 3VF0B 5IS2A 2MZRA 2V4QA 1WTBA 4LF6J 4LF9F 2FUG9 3UPFA 2R7XA 3G6ES 2VZ9A 2G0IA 4NI2A 1IKYB 4L74A 4P10A 3FDSA 2PMHA 3US5A 2BACA 4J9UE 1SKRA 2DNYA 2MGZA 2GNKA 4HACA 1HLWA 2D69A 3BYRA 3CO9A 1HWKA 4OV6A 4P2FA 3ZTSA 2Y8YA 2FB0A 2UXCJ 1YJNS 4B9SA 5KFCA 4DR4J 3QBCA 5K5MA 1Q7YT 1K73T 2UV8A 3MGJA 2HGMA 3UDEA 3W8GA 5HVGA 1FJCA 4WP9A 4Y2CA 4X65F 3DLKB 3OHAA 3NMRA 2HZ7A 2VG6B 1S1WA 4OIXA 5KG5A 2DNZA 3UN5A 2ADBA 1S57A 1Y11A 3NAHA 2GAGC 2LCWA 2V8HA 3KK1B 5KFKA 1RT2A 4CO4A 5H1SV 2PFFB 4M63A 2NZ4A 2XULA 3HSJA 1B0VA 3AOCA 3QT7A 1NEEA 3FSYA 4DJBA 1NJXA 2C3MA 2POKA 3H2UB 4BS2A 3DOMA 2RDDA 1VQNS 4MK8A 4CT8A 4PXEA 3AODA 3H7HB 4HTIA 1YBUA 3EDQB 2HBYB 2QLXA 1RDRA 4ELUA 3N0VA 3F41A 3JSBA 2LEBA 2NXUA 1FNXH 4JI1F 4NXMF 4AUKA 1YQHA 2RHSB 3KLIA 1PYOB 2R4FA 3B78A 4MT1A 1KTQA 1JLCB 1XTZA 1S59A 5CZVA 2F65A 3G6XA 3BR9A 2C2NA 2PI8A 3BN7A 3DRRA 4L3NA 5EWFA 1EP4B 2BRLA 3IGVA 3C16A 3HFKA 3QO9A 2AZ3A 1ZBTA 5KFUA 5KG3A 1NJWA 3MM6A 1NBEB 2HHPA 3WC0A 2W9BB 3PRDA 2AU0A 1YJ9S 2KN4A 1Q8KA 3ZFVA 1F5AA 4KIAA 4N8OA 2IMOA 2GVZB 2R2UA 1VISA 4ID5A 4KH0B 3TJ8A 1CC7A 3GFXA 3MD3A 2GHVC 1RLDA 1KD1T 5I3PA 3BF4A 2HHVA 3T1AA 3MD1A 1UVKA 4IDKB 2QFIA 4Q43A 1MMDA 3IWLA 3FSIA 3UDLA 3I56S 1HYSB 3MI7X 1WACA 2LKZA 2VPYB 2YX7A 2X3GA 4DFMA 3DI6B 3DLBA 4K50A 4AQYJ 1WKLA 4ZJOA 2K2PA 4EBEA 1VQ7S 2PIIA 4QQBA 2L48A 2IA6A 3RW6A 2QZ8A 1JNRB 3BO4A 4TXSA 1FRXA 2N82B 2LP4A 3EMTA 4DV7J 4ICLB 1RT1B 5M2UA 3MAAA 4C8LA 1OIAA 2NS1B 3R2DJ 1Y4ZB 4KFBB 5DLGA 1FRJA 2EFPA 2IM1A 2OD6A 3GMGA 1MWYA 3JQJA 4M5MA 2M5YA 2VPWB 2YNHB 1IN0A 5KFDA 1MROB 2ZH9A 4DL5A 4NYZA 4WIQA 3JSMA 3C14B 3K5OA 2E1CA 1U0HB 4WFAS 5BNZA 4UUXA 3HCXA 4K0KF 1P9QC 1RHMB 3NGDA 2H65B 3UN2A 1X9MA 1G6BA 1S0NA 3OBIA 3SDEB 2JEJA 4C98A 2MGZB 4CM2A 4OYOA 3D67A 3KLGA 1FRKA 1WOSA 2RVJA 2GJFA 3DRSA 4RBTA 2ERRA 4JI7J 2AJQA 2QEXS 2CJYB 3AOBA 4DMZA 4KYZA 3NS6A 3GZ7A 4WFZA 4ZPWR 4AE5A 1U1LA 2VKZG 3QZ7A 3AD8C 4R8UA 1T9VA 2EFOA 4NLGA 4I6WA 2AGQA 3SFGA 1KLMB 4ZLPA 2JFDA 1WF0A 3CJ0A 5FD1A 1S4FA 4ZDNA 2ZH6A 3V6JA 4LF8F 2J6SA 4Q2MA 1Z2ZA 2BM1A 2IRXA 2JJ4D 2K06A 4OHWA 4DR7F 2DNMA 2E5HA 1TKXB 2HLTA 4DSLA 3KHGA 2ZZTA 2B9XA 5E41A 3QGPA 1J5EJ 2C3OA 3AQPA 4BC9A 2PSZA 3M1VA 2RMLA 5T7LA 2OELA 1WKJA 5DS7A 1FHTA 1VLYA 4PQAA 1TFWA 3SCJE 1U8SA 3D9BA 2BJ8A 4NASA 3SSRA 2PEBA 1N54B 3QYYA 1SIWB 5KOXA 3OVSA 3CE8A 3L7OA 1HBNA 2OPPA 4DBQA 4NRUA 5LMNF 3T9NA 4QWDA 2E5JA 1NYLA 3Q24A 4K4WA 2ZE2A 3ZZPA 4DN0A 4DFKA 2LYVA 2XMWA 2ASJA 2WONB 1H74A 4U67Q 1FRLA 3OSNA 2JLEA 3R6LB 2HZCA 1KBRA 5K8OA 4G1QB 3PACA 5LXRA 2CWKA 5KFEA 1QRSA 5FLXU 3CIZA 1OMSA 4URGA 2O66A 2UVUA 4MMOA 1FFWB 3OUYB 2L9DA 4PRFA 2IC3B 3ZNUA 3DRPB 2GVDB 3ZTPA 3HJFA 4WTYA 4Y0FA 4MIBA 5ETPA 1P27B 1RUSA 2JOQA 2VQEJ 3OV7A 3O6QA 2K7KA 4RUHA 1UAWA 4J3CA 1L3TA 1NK4A 2B3TB 3I96A 2Y1RI 1N6QA 2V2VA 1KSPA 4C6AA 2HQIA 2PFDA 4RWXA 1BHNA 2BYCA 3EX7B 3DMJA 3CCLS 2X1BA 3PW4A 3MDFA 3Q0AA 1KQSR 4TY9A 4LVOP 4OJGA 4ILLA 1RHUB 1AA1B 2JDJA 4LFBF 3BPSP 3K8WA 4JI3F 1FX4A 2VL1A 3DC2A 4YHHF 3TNVA 1RJJA 4K5RA 4UOFA 3UR3C 4F3OA 2H3EB 1R89A 5CZXA 2HIYA 3LGMA 5KOWA 2VQEF 3MM8A 4A46A 3GG1A 4IO9Q 3OQ2A 3EGWB 5HP1B 5A6WA 3R5GA 1X0PA 3UI3A 5HMWA 3MAQA 1UJ4A 5KFPA 2E5LF 1D9DA 4V19X 3SQOP 5I42B 4AL5A 2P2CB 4B9VA 5KT4A 1NDLA 2AJ1A 2F9DA 3M32A 3KK3A 1U1PA 2O67A 3CJ3A 1XC9A 2K3IA 3AFGA 2OLWA 1A9NB 1EJ7L 1RP5A 3OR1B 2NR0A 4KPCA 1FKAF 2BJ7A 3VGSA 1C1CA 4EZ9A 3NWRA 2QYGA 1HNZF 4JYZA 2EKYA 3ENAA 2IJNA 4OX9F 3QRQA 1AYEA 4F4AA 4NLUA 4Q0BA 4TYAA 1T0TV 4AXJA 4JI8F 3DLJA 1XN9A 3PW7A 3DRRB 1HBUA 5KFZA 4TYBA 2MZ1A 3IFEA 1U02A 1M5OC 2V4JB 4ES3A 4E8BA 1RTHA 1DFDA 3SV4A 2UXDJ 3R9LA 5CYMB 2E9TA 5L38A 2J0WA 1X4DA 2VQFJ 1RT4B 2BABA 2DB1A 3IS9B 2ASYA 2RD2A 5F8IA 5EX0A 5E3RA 1FKOB 4DX8H 3QSIA 5CABA 1FDNA 1R8PA 1U1KA 2YBVA 4FKXA 2N7YA 1PC4A 2V2QA 3MM8B 3QFHA 4FVCA 5KFBA 2HRUA 2CNNB 4KC5A 3M6VA 3H5SA 3L3CA 2YKOA 5KT7A 4LSNA 2R2SA 3CCJS 1N5SA 1PAUB 5H9FJ 3TRGA 4IYQA 3H8YA 3TWZA 1KTVA 2GO8A 2YQ1A 4GC7A 1TK5A 2LQJA 3KMSA 1S10A 1VQ4S 3QRRA 4B3OB 1UETA 4C8YA 4QIGA 5F8JA 2F1FA 3FBEA 2DHGA 3W3SA 4MK7A 5C24B 3CD6S 1TUVA 2IPOB 1Z4UA 1EETA 2NSCA 2ZBCA 1HARA 3U1LA 3KHRA 3HZGA 3TEHB 4X66F 3IO1A 5DDRC 2R9LA 2MKSA 5J2MB 1C0UB 2FVCA 3N6MA 1MMNA 2KFZA 2IYIA 4EWTA 3CXCR 4USIA 1KVIA 3MAHA 2LFVA 2WRMA 4YB5A 5DDOC 3EGNA 2QG9B 1XMQJ 2Y0BB 3TEGA 4QWEA 1XERA 5E7OB 4CQ1A 2KTQA 1IVZA 3P5TL 5ETKA 5B0EA 4X66J 1JLFB 3CUNA 1TELA 1DURA 1FD2A 2Z0YA 3A8KA 3PX0A 3A3PB 3L7UA 4LIWA 3D1QA 3TZXA 2HNDB 2KVQE 3D6TB 2CDRB 2DIVA 2Z2MA 3D4JA 3EZOA 3IBCB 3SFUA 4C11A 2WW4A 3K5MA 3J80Y 4KQZA 4USHA 1S48A 4NPOA 2MLZA 1R0BG 1CQNA 5J2NA 2ZFHA 2UUBJ 3FCHA 2Q3PA 5FLXY 2M4MA 1IKXB 4O3OA 4AXIA 4X4VA 2XO7A 4JXXA 1D9AA 1OS5A 2P9CA 4J90A 1F3VA 2OTJS 4B3TJ 1VR6A 2G2YA 3IS9A 3RW7A 4IH7A 1RWXB 2P6TA 1FVSA 2HURA 3FFIA 2WOMA 4ZOSA 4ATNA 1U47A 5EGYA 1EZZB 3NCPA 1RAHB 3IRXA 5CYJA 4C4WA 2CJBA 2B56A 2RF2A 3AXMA 1H73A 5HVFA 4DI6A 5HI7A 2J6TA 4DR4F 3X1LB 1N34J 1WI8A 5F3TA 1YWXA 3R5BA 2Y0SD 1C4AA 1LWEA 5LSLA 1UKUA 1NU4A 3BGUA 4IFYB 1X4CA 1TV6B 4XPEA 2XZTB 2AYGA 3LP2B 2L3MA 3MF5A 5HQLA 3TUPA 1HBMA 2B6AA 1F9EB 2IYGA 4RNFA 3VQSA 1FNOA 1Y10A 4I0WA 4CLKA 5KTQA 3A4TA 5IT0A 1SC6A 2PEHA 1D8ZA 4NLWA 2VJUA 2FJVA 2V68A 5H9EJ 1CULB 1SC3B 3BB5A 2J9CA 3D3BJ 4H4OB 5KFSA 2WW8A 3VGUA 1Q5YA 1VBXA 4DSKA 1EHWA 4DFPA 2VQFF 4ECUA 5HSPA 3FRYA 3SSQA 1SV5A 5GAEI 1T9UA 2ZBQA 1CPZA 3VCDA 3EGVA 2AJ2A 2N4DA 4KGVB 2Z58B 2VJVA 4A8SA 2YQ3A 4LSNB 2AX0A 1DZ5A 2OHDA 3HVTA 1KFDA 5KG0A 1NZ8A 1HQ2A 1O6XA 5HVHA 1Q95G 4YB6A 1HNIA 2I8EA 4ANDA 2VPZB 2HVEA 2RQ4A 4YQWA 4E0DA 4USVA 3BREA 2AIRB 1KVJA 2QL5B 2D9PA 2H51B 2VBYA 3GIIA 2DTJA 2JC0A 1CSJA 2G13A 4RUCA 1CLFA 4ZHRB 2N3OA 1TL3A 5HLFB 1I6JA 1HNWF 1BXNA 4NWBA 1VHIA 3OL7A 1BWEA 3KJQB 4DS5A 3DGPA 5FDLA 5A0YB 2OPQA 3DLEB 3QFWA 1N48A 4DR6J 4X4UA 1GTEA 1U7LA 4J9RA 1HI1A 3KG0A 5IQQA 4A47A 4IR9A 2BMBA 4GKKJ 3M8ZA 3UWTA 3M2VA 4FYXB 3DRPA 2ZJRQ 2DGUA 2KFYA 1LNQA 2CRLA 2IY5B 3QO9B 3DOKA 6FDRA 1LXJA 2R8KA 2I9SA 4QR1A 1S49A 3NNAA 4JI3J 3THPA 2FVRA 2NCKL 4JP8A 4LR9A 4WZMA 2G2ZA 3KLFA 3V6DA 2BRKA 1ACMB 1QVFR 4CO5A 1P8GA 1DQAA 4ZPDA 5E3AA 4CLSA 5HQMA 4YP3A 1IR1A 3OTCA 2APOA 3KJNB 3N9UC 4I2QA 3EXCX 3VAHA 1DQ9A 2DYAA 4O4GB 2QTWA 4ELTA 4RW8B 3DDKA 3LGHA 5SZTA 4P7VA 3J81Y 4F50A 4C9DA 2DGXA 4OHXA 4A8QA 2M52A 4DZ6A 4OX6A 1RWMB 3CJRA 4GVBB 3T5JA 1ZM4A 2FD2A 4PABA 4UT4A 1Q7LB 4ES1A 2JEGA 2DY1A 5GADI 1NK7A 3OR1A 3M9OB 3ENWA 2IM3A 2YKQA 4DR7J 1D0EA 1OSDA 3M1VB 5E3PA 3KK1A 2GS8A 4Y2MA 1B64A 3M8YA 1U4BA 2CUYA 3UVJA 5CHCB 1KS2A 5HLFA 3CD7A 3V6KA 2ZJQS 1BQNB 4OI3A 4OYXA 4CO2A 1UJ6A 3VAKA 4BLGA 3HLUA 5A76A 3TUIC 1R6VA 3KW2A 1I5OB 2O5DA 2QLFB 3MR7A 3KLHB 3LPEA 1JJ4A 4FS2A 3RAMA 4OHYA 2Z4PA 3PJ9A 5ETQA 3NCQA 4ZLJA 3G8TA 1PO6A 1VIXA 1QAJA 4ER8A 5F0UA 1D1UA 2OMLA 1FWPA 2QL9B 1X9SA 4DUZJ 2VA2A 1IUJA 1SQGA 2EXUA 3VHQA 5KFJA 3W5XA 4DSFA 4PCQA 3ZZRA 4ECWA 4CLFA 3C6TB 3QT8A 2ALYB 4PXCA 2UUCF 4ZN3A 2N3LA 2NXCA 3M8RA 3MPUB 3TAPA 5KG7A 1C2PA 1HBNB 2OPPB 3DRXA 4A8OA 4NXNF 2DIUA 1X7VA 4C3LA 3P49B 3M7VA 4DQQA 1NKBA 2DBBA 2YTCA 1YG0A 2RRBA 2QMXA 3LP0A 3M2RA 2K3KA 4DL3A 2WB4A 4C3MA 2XLJA 2FJXA 3GJRB 4F4YA 4F26A 1I51B 2ADCA 4AL7A 3VAJA 1NK6A 3PYDA 3MM9B 5KT2A 1C1BB 3PYEA 2MZSA 1NH7A 3PIOQ 4JI6F 2H4YB 2DR5A 1F2GA 1NLKL 3UO0A 3QAUA 5E33A 5CD4A 4QIVA 3BZQA 3IR5B 1IXKA 2DPJA 2PT0A 2HNZA 5CYQA 5IZNA 2VFSA 3D66A 1KEKA 1PYTA 4X62J 1AZSB 2KO1A 3FBFA 5KFVA 2C2DA 3UDCA 5IV3A 2WZ1A 1OQ6A 3PJWA 5B0FA 3T1HJ 2CJAA 5AXKA 3KLGB 4QPTA 2IVFB 3IWXA 1SKSA 2W8LA 1QRUA 2IA0A 3OD2A 2P9EA 4KAIA 1TKTB 4Q7AA 1QRTA 5J1EB 4DPOA 1EP4A 1FA0A 5B0AA 4DL0C 4ED7A 1H2UX 2Q79A 1C1CB 5LSRA 3EJMA 3BBCA 4I68A 1H2TZ 1QAYA 5ETNA 4DS4A 5GAEW 2CJ9A 5DLFA 1QE1A 4HHHA 1X5TA 3W7BA 4R8UB 2YWGA 1RT1A 1B99A 1U2CA 9RUBA 2ABYA 2DO0A 1WELA 1VC6A 2DGWA 4FBUA 4FF3A 1K1QA 2B4VA 3PO4A 2GAHC 3FUYA 3W2VB 1MMLA 4J9VA 3CJKA 5KFMA 4U7UK 4DQIA 4ZPTR 2R7VA 5E2QA 4KHRA 4QOTA 4JXZA 4WYWA 4Z37A 2V2ZA 3KLEA 3PO5A 2ZITA 1NPPA 3AAWB 1SH2A 3IA0A 3D5MA 2AWZA 4ZPVR 3TUZC 1LV5A 3Q8UA 3ZZZA 4ECQA 5DM7Q 1UEVA 2M70A 3HVTB 3R5JB 5U47A 3SCLE 4LRBA 4KV8B 5KFQA 3QWUA 3WDOA 1XEZA 5L1IA 3CDUA 1N32F 3F56A 2BR0A 2XMJA 1W7WA 4DDFA 3DLKA 1Y3JA 2D1CA 4AT1B 3CB4A 1VRQC 4OYMA 1N6QB 4X64J 2ZDPA 4RU9A 3HDSA 3TZZA 3DU5A 4IH5A 2W9BA 5I42A 1VQ9S 4DZDA 1N52B 4Y34A 2X7IA 3NOCA 2A10A 3J81U 3GONA 2HPUA 3C16B 2CQ2A 4RJVA 3V2UC 1S1VA 2FLPA 2LQBA 1TV6A 2VB6A 1YZ6A 4LIRA 1GX6A 2HZVA 2UXBJ 4RO0A 2I6WA 5J2QA 1MWQA 2DEIA 3M8QB 5E3QA 3CCQS 1LWEB 4K4UA 4ZVEA 1S0OA 1Q4RA 1CJTA 1OPZA 7FDRA 4O4GA 3OL6A 4LJMA 2CG4A 2QGFB 1YITS 2HW3A 4GO5X 2XO6A 1UTAA 1VQMS 1HHSA 2CQDA 3TA2A 1M0SA 1D8YA 4P2MA 1CJVA 4H3SA 2DJWA 3DLGB 1SV5B 4QZVB 4C2MA 2GGPB 4DSIA 2JRSA 4RNNA 4X65J 2I0XA 1FFGB 3R7SB 1APSA 3CJTA 1BQXA 3SEOA 5L9NA 1RT6A 3JTOA 4Y6IA 3W8PA 1RHJB 1N36F 1KP6A 2RKIB 1V5VA 1P9YA 5D4NA 2PE8A 1R3NA 1Q53A 2YY3A 1FEHA 1WOOA 4TKTA 2DXFA 5DJBA 2PA3A 3AJ2A 5EWGA 1RKIA 2LEAA 3GJQB 1HNXJ 2WVBA 2CA9A 1IKVB 1TR0A 2BX6A 4FYVB 3IBFB 4JI4F 2V8DA 4DOZA 3FBCA 2NLWA 1SL2A 3NAIA 4CLLA 3OR2A 1PCAA 1HNVB 3GIKA 5FDLB 3W9JA 3VGVA 1FK9A 2XMVA 1QAXA 3JYTB 1SJ3P 1PJ6A 3AT1B 3UE2A 3RR7A 1KHWA 1SXLA 2Z2YB 3KDNA 1MWZA 1EUYA 4O3PA 5D6GA 1SVDA 4HACB 3W60A 4JI4J 2BUNA 4PG4A 4LF2A 2LMIA 4BCAA 4E8UA 1TKZA 3C15A 1IBMJ 3UNGC 1IKYA 1GTRA 5GAHW 2KT5A 3IR6B 2VIHA 1XJWB 4P6QA 2C22A 4KO0B 4G1IA 3S6EA 4ZKAA 2VPXB 3G6VA 2A6OA 1N32J 3PIPS 5GADU 2GQQA 1IKWA 1OYDA 2XSJB 2BE9B 4RLEA 3TX0A 4A4JA 5DRKA 2C2ZB 2DCUB 5HL7S 1N5VA 4XDDA 3ZZUA 3I55S 3G4SS 3QSYB 3T3FA 1RAEB 3JB9k 2OTLS 2IDEA 2PC6A 2YWHA 3R97A 1LFWA 2YNGB 4X4QA 3PR4A 1XNRJ 1UMJA 2ZZMA 1U0HA 5GVQA 2HFOA 1X4AA 3I5BA 4MH8A 3JSYA 4FVMA 4CDIA 2B6AB 2JX2A 2AGPA 4OZ5A 2XZWA 3R1LA 4DWIA 3MMJA 4B3RF 3EPGA 3FEYB 5K14A 1JLBA 4DR5F 2VBXA 2ZHAA 1OY6A 2BANA 1SH3A 4ICLA 2HYIB 4F8RA 3NNCA 4FYDA 2MJUA 5DM6Q 1QUVA 2F8MA 2QSFA 3AJDA 5LMUJ 2AJ0A 3MEKA 1LW0A 5AJ3F 1SI9A 2BE2A 2NZCA 3KNAA 4NMXA 2KRRA 1JK9B 1TTHB 4NLSA 2BW2A 4X64F 2WONA 4EYIB 2YXLA 1VBYA 4WFBQ 1D09B 4HT7A 3KLHA 5B0DA 1B7FA 3PYFA 1YJRA 4DUTA 3M05A 3LGNA 3JYTA 2ZJPQ 3VAGA 3S8SA 1B7YB 1VJQA 3OJUA 1WC4A 1XMOJ 3W5ZA 2UU9J 1KQKA 1HBOB 2HK3A 3BO2A 2B5JB 1LWCA 4HLBA 1S76D 4NCBA 2YPYA 4Y00A 2GVZA 2R42A 4ILMA 1UJ5A 2CPYA 4CH7A 4N7TA 5CCLA 1K8AT 5DDQC 1VRUA 1XIQA 1DY3A 3KJVA 4HH1A 2YX4A 1BUXA 3HXMA 1KNZA 3TX8A 2FGCA 1WHYA 4OLPA 5EWEA 4FYWB 5D4PA 2HHHJ 4EO6A 1R8BA 1WEZA 1KC8T 4GRSA 4B02A 5SUHA 1E6VB 3VV2B 3H59A 1VYAA 4OZNA 1DTTB 3GG0A 2QX0A 3CMES 3A12A 3MMAB 2ASLA 1FWLA 2KRBA 2EG1A 2XHWA 2DITA 1FVQA 2GQ2A 1R8AA 2HSEB 4HI2A 4PAAA 3T6JA 2PICA 4K7QA 5HP1A 2HRYA 3QMQA 2XMMA 3PEJA 1JKHA 3V81B 3UN3A 5KFFA 1VC0A 4LBHA 2LXFA 5C25B 1HMVB 1FD8A 3M6UA 4U6PA 1C0UA 1YRUA 5L46A 4USWA 3M30A 2VG7B 4IQXA 1RWKB 1N56A 1S0MA 2PMZD 4C97A 3MOZA 1RT5A 2FJEB 1EKRA 3CDEA 5ADZA 3WZ0A 5GAHU 1YBTA 3B4MA 3PYGA 3W9HA 4CZCA 4GVLA 4PG6A 2VC1A 3M32B 3UW1A 2UP1A 3ENQA 3DGPB 4DV3F 5HATA 3BKTA 3GCWP 4JI6J 1GK8A 4JI8J 1CJTB 1FDBA 2VD3A 4B9LA 4U7UD 2A0FB 4PR6A 1WKKA 2M3DA 2ROGA 2IAJB 1O0CA 4NZ6A 4ZP6A 3Q8PB 1YIJS 2Q6CA 4OX9J 4KHPF 3MMBB 2H54B 3UDVA 4ZVTB 3CCUS 5D4OA 1GQEA 1LOUA 1HNIB 1DAXA 3TO8A 2ZHOA 2LU1A 1S12A 2ILZA 1ZA1B 2J76E 3BSOA 2OEJA 3Q86A 3GWCA 1ROFA 1O51A 1QSSA 3TOQA 1L3VA 3HD2A 1SQEA 2RH3A 2V69A 5J1NA 2MLXA 3PTWA 1HWJA 4F36A 1P1TA 3CF5S 1VQYA 5A8WA 2EFGA 3IBWA 2HAIA 3BBFA 4B3MF 2A3JA 3QJLA 4NA1A 2IBKA 2XY5A 3MCSA 2NQPA 2J9DE 4B3SJ 2J7UA 4XIUA 1IQZA 5EX3A 3PZPA 2Q1LA 4ZCMA 3E3XA 3SV3A 1ITPA 4M5NA 2ZJQQ 1NSKL 4M95A 4LRDA 4CLTA 2A1BA 3IM9A 1S77D 8ATCB 2EK6A 5AXLA 1JLCA 1URNA 1IBLJ 4NI2B 1JWWA 1LXNA 5KFHA 3MTKA 2E9RX 2CQ4A 1NNDA 3C8YA 1HBOA 4OV1A 5HAOA 2DNGA 5KG1A 1NHKL 4USUA 3W2WB 5D0RA 5RUBA 1JLGB 1WDTA 1RTZA 1R8CA 1RCOB 3HHLD 4Y2IA 3ZO7A 1N5YB 1K47A 3O2IA 1W2IA 2QSWA 3OXFA 2AV5A 4DN9A 3Q8SB 3PNIA 2ZH1A 3MM5A 3BPDA 3GB0A 4IUFA 3MMCB 3H4BA 3MOJB 3MR6A 2G1HA 2W2OP 3GSDA 1RYSA 3D0HE 2BV3A 4EEYA 1NUEA 1FRIA 4FNIA 3CPWR 4GKKF 5DM7S 3FKBA 2EEYA 2MQ8A 3BKFA 1RABB 2E7VA 2IFXA 1S6OA 2W4CA 3LP0B 4TY8B 5T14A 3T9ZA 1RXOB 1HR0J 2LDIA 2AX1A 4URSA 2UUWA 2IVMA 2YNFA 2EC0A 4WFYA 2HNDA 2OD4A 3D28A 3CJ4A 1RK8A 4BBYA 1ZAWA 3IG1B 2CPZA 2J8AA 2DGQA 1B3TA 1JXVA 4MAKA 3NGUA 3P45B 4TNOA 2GGPA 4UOHA 7AT1B 3OFGA 5BR8F 4DL6A 2LDYA 1WNEA 4EU0A 4TVAB 2XLIA 1R31A 4ED5A 2RS8A 4B3MJ 2ZM6J 4IOBA 2QYCA 4NCGB 4XPCA 5A2QY 2VV5A 2FVSA 2F5GA 3CC7S 2JL9A 1Y5NB 1GFWB 2PGCA 4NYPA 4BHQA 2I1RA 1HA1A 4NCGA 3TZWA 3HHKA 1SKUB 4XK8C 2BKPA 4AFFA 2HQFA 4OYZA 1LW2B 3SDEA 1MNEA 2YX1A 5IQ6A 3PX6A 1PIEA 4ZP7A 2AF6A 5KT5A 2QL7B 4MK9A 4ED6A 1CEZA 2KVIA 1Y5IB 3ETMA 2D3O1 4GC6A 1VQ8S 2DO4A 4HTJA 3C6TA 3ZZTA 4NA2A 4HDHA 4P72A 5DZ7A 2MKIA 4CH0S 1H7WA 2WTFA 1RT7B 2YNHA 4EBCA 4TY8A 4HL9A 4GMKA 3DOLB 2R7RA 1G3OA 4KGMA 5F9LA 4UF4A 1NKCA 4CYUB 3O1LA 3CEDA 2HFUA 1T05B 2BZ2A 3HVRA 1Q81T 1FKOA 3IWNC 1IBKF 1JNZB 2CDQA 5CH7B 2ZZNA 2OSRA 4I2QB 1V3ZA 1S0VA 2VFTA 1SBRA 1PAEX 1O8BA 1PILA 3AD9C 3KNGA 1AXQA 2JEFA 5EDWA 4MKAA 1SJRA 2XHCA 4YN3B 2DR6A 2V4JA 1WEXA 3MMAA 2R8HA 4OMFG 2E7WA 1R0AB 3GE9A 3WC2A 3CWJA 2H9ZA 3KMQA 1TU0B 3BR8A 1RT5B 1GXUA 2LECA 3HFVA 2J0QD 4ZVRB 2K8GA 1TL7B 3BH6B 3NGTA 4ZA1A 3UQSA 4GVBA 2QMWA 5I3QA 5L39A 3GFHA 3KJFB 1UA0A 1VQ6S 5KFLA 1SPBP 1REVA 5KFGA 5J1PA 2CZVC 2WSCC 1PG5B 2GW8A 3KK3B 2B51A 2XMAA 1B75A 5J2PA 2I5JA 4RW4A 5F8GA 5ETOA 1IR2A 3H42A 1FJGJ 3CMQA 3ISNC 4A48A 4NLXA 5D8HB 1VHKA 3DFEA 3MHYA 4KKOA 3PKYA 2FZCB 3J7AN 2HFVA 4F04B 4JI2F 4ZIVA 4X4RA 1SKWA 2ZKUA 3POTA 4ECSA 3TI0A 4WU2A 1ZTTA 4DL2A 2BKNA 2NUUG 2CZ4A 5IT4A 4U67S 2HHTA 1EB0A 2K7JA 4F02A 2VONA 4IDKA 4YR0A 3RRHA 4O3RA 3TR5A 2B0GA 3SBMA 4IRKA 1TL5A 2QLJB 1OO0B 2D74B 2EK1A 4ED8A 1K0VA 3H20A 1N4LA 2XYGB 2F4VF 1Q86T 5AE2A 5HMXA 3ICLA 3FC9A 5CQGA 2F9JA 4WXOA 4PWDA 2R2TA 1S9EA 3GILA 5GADW 1FWKA 2FJDB 1YDLA 3DYAB 4ETXA 2HHHF 4JI2J 2HKEA 1RT3B 3CT9A 2W9CA 3QGHA 5HJYA 1HKAA 1ZM9A 1HMVA 3E01A 3HPOA 1YLXA 3PW2A 3SSSA 4F2RA 3CJ8A 1P6TA 4OLOA 3PVXA 4OI0A 2DD8S 4CH1A 3DCAA 1KRPA 2YWEA 4AL6A 2RNEA 4TQRA 4QWCA 1ZOTA 2YKNA 4Q8EA 1SJ1A 2F4VJ 3PM9A 3NS7B 3Q2TC 4ZLLA 4M5HA 4RX6A 1XNQF 2AHOB 1JLEB 3NKYA 2Y1LB 1K1SA 4PKDB 2W24A 6AT1B 4M5DB 1PJ5A 2PJJA 4M8LA 3A8JA 3FMBA 5G0RB 5JVGQ 1WG1A 5L1KA 5D3GB 1RKJA 1SJQA 2DCLA 1PSDA 5LL6d 2HWHA 4HYKA 3MEDA 3FQLA 3MM7B 1UFKA 5L9XA 2FYXA 4HKQA 1YJWS 1RT2B 2QA2A 4JV5F 1WSVA 1C0TB 2BOAA 4DQRA 1QY7A 2FJBB 1UW9A 2MKCA 4J9MA 4BDPA 4MKYA 2LU2A 1FJGF 4KO0A 4B3RJ 1RAAB 3NEKA 4B9NA 4DCJB 3FEXB 1S9FA 2ATLA 1IBKJ 4OFZA 5T7LB 1AUSL 5G4DA 2A2CA 3ZTRA 5C7PA 4YHHJ 3KK2A 3T5KA 2ZUAA 2KXFA 4QW8A 5GAEU 3IRWP 1FT8A 4HH0A 4LF4J 2XSFA 1EX8A 4R5PA 3RB0A 4LFBJ 4NLQA 5E3CA 5DG8A 2W2NP 3GYGA 5HQ8A 1CJVB 3DLGA 2YWWA 3I9ZA 3RUBL 5LT5A 1VMBA 1FI4A 4NX9A 1HQEB 2GCFA 1VQLS 2IJFA 3D54A 3U7JA 4X4TA 2VDIA 2DR9A 1T03B 2R8GA 4F4KA 1H2VZ 5K20B 4EZ6A 2C2MB 4J9PA 3UD4P 3D6HB 2LEPA 2KDOA 2NWAA 3G6YA 4ELVA 1LEOA 3IP0A 3DDIA 1S9EB 4LF9J 1HD1A 3FCVA 1W25A 4OJ3A 5AT1B 2PO4A 3UVJB 1WF1A 3DLEA 3AA8A 3GSIA 4PWWA 2MYFA 4WYLA 2FJWA 1S4EA 1X5OA 3P3DA 5M2RA 4DV1J 4DR1F 5KFAA 2F4FA 4QIFA 1A6LA 1X31C 1NDPA 3AA9A 1WI6A 3M2UB 3MR3A 3NMAA 1CBKA 2CFXA 2MZJA 3HVAA 2IDLA 4HT5A 3QPIA 4OHVA 2UVRA 3LTOA 3H40A 5A8RB 3LP1A 3GQCA 4JI0F 1XBWA 3H25A 3TYTA 3G86A 1TK8A 1HD0A 3C15B 5J2QB 1PBAA 2RUSA 4OX7A 3PFOA 3Q22A 1VC5A 2A6MA 3CO0P 2D41A 3T5LA 4YY3J 1DLOA 2WK4A 5ETRA 3O5TB 1RE1B 1V9OA 2EWHA 4RBVA 3T6BA 1HHTP 1NHVA 2DRAA 5CYMA 2B43A 3P96A 5IWAF 4NA3A 4YMEA 4H4MA 1Q1KA 2VFUA 1UW4A 2QJ3A 2ROEA 2OFGX 3G2XA 3OTDA 1EXDA 2HVZA 3OR2B 3PFEA 3ILLA 2EVZA 1LQ9A 1X5SA 1REVB 2MY8A 3LPYA 1QD1A 4HR2A 5C2GA 2BQRA 4JYAF 2ZM6F 4HHUA 5KFNA 1EQ0A 3EWGA 4M5IA 2UXBF 2W1BA 4B08A 3C66A 3NRBA 4I69A 3UNYA 2XS5A 1OYEA 1WJ9A 1T3OA 3Q8RB 4DCOB 1XR7A 3HFZB 3J7ZT 4DV2F 3GV8B 3QT6A 1NHUA 2HHXA 1YGYA 1OY8A 3FRZA 4WK1A 3R1HA 2CVEA 3QRPA 2PA8D 4DU7A 4N77A 1FXRA 3K2YA 3LOUA 4KH1B 2XS2A 1HBUB 1FNMA 3KWMA 4X4PA 4K0KJ 2J5AA 3RTVA 2BQ3A 5CD4H 2W8KA 4DR3J 3JTPA 3KTQA 2M9KA 3AHPA 3A8IA 3MCNA 2DHXA 4Q0BB 4U96A 3ILJA 3E8OA 3MCOA 1HWLA 2EKNA 3LP1B 3VQTA 3VVUA 3FNNA 5HROB 2B9WA 3LWMA 4ID8A 2Y1IA 2KZMA 5K8PA 1MN9A 1Q5VA 2QMUB 3WIVA 1U24A 5J1EA 4Y65A 4WZQA 2U2FA 2HVHA 1RT7A 2IM2A 1VHYA 2HNYA 4RBUA 4ZVOB 4DV0F 1GX5A 1VK8A 4P2SA 4ZPAA 3R6GB 3ONQA 3HHLB 2IRUA 4DPTA 1GXTA 1NXZA 4ZVSB 4ENOA 1IJFB 2AGOA 1VDHA 3UCGA 4J9SA 4C11B 3IC1A 3DM2A 4ZITA 1RWOB 1T3NA 3AIIA 1SQFA 2NXNA 3Q8VA 2DNQA 3CC2S 1TL1B 2HQGA 3FZBA 1VBKA 5DGBA 2ZH5A 2HS0A 3NGKA 1G2EA 1CJUB 4NXNJ 3BBBA 1QM9A 4LSLA 2EFVA 1RISA 3BN4A 1HNZJ 2Q43A 2CADA 1LW0B 1NH8A 2NPIA 5THWA 3TP2A 4UY8T 4K4YA 1U8WA 3R27A 4L72B 2QA1A 2D9OA 2XB2D 1J5OB 3H2VE 4WE1B 2MB0B 1U49A 2WSFC 3ZZYA 3H98A 3OFHA 1RTJA 4R0EA 1R27B 4EGLA 4F0KA 5IZHA 1WC6A 3D7SB 4DV7F 2RE8A 1HFEL 1NDCA 4J37A 4TN2A 4XDCA 3Q23A 1ZTWA 1K9MT 3KOAA 4DPWA 3P4UB 2E66A 1XNQJ 1RAGB 3O8WA 1IQTA 1VHFA 5KFTA 4C3KA 1HHQA 3CZBA 1BWVA 1TMJA 5KG4A 3DLLQ 4UOCA 5DG9A 2AD9A 3NS5A 4JI1J 1NK5A 4B9UA 2B9EA 2XYPB 4DR3F 4URQU 2YNIB 3ET6B 4O44A 3MEDB 5FIIA 1CVJA 4P71A 1U48A 1DARA 1CS4A 2OUGA 3FSXA 4H4KC 3SQGA 3K59A 1IM6A 1RACB 3HT3A 2MTLA 3PV8A 5H9FK 2WB1D 1UDXA 2M0GB 4ZS6A 2UUCJ 2P9GA 3THVA 2B4OA 4O0NA 2P6SA 2ZNYA 4IO9S 3JXOA 4JV5J 4WF9Q 2C2RA 4PG8A 5E5NA 3GIMA 3KXDA 1KHVA 2XMTA 2IVYA 3FEZA 4FDFA 3H90A 2UU9F 5KT3A 1GMWA 1UWBB 1QTQA 4Z7YA 3ULHA 3BDEA 2WBMA 3U1NA 1NSPA 4HVZA 3M2RB 4CIOA 2DNPA 3H5XA 1TP7A 4CP5A 2V8VA 2R7WA 4J9LA 1RTDA 1FERA 3C14A 1N8RT 4NLOA 2GC8A 3HULA 3R5DA 1U1QA 3M4XA 1T8EA 2CAJA 4J9QA 4UUWA 3VAMA 3LAKA 5I3UA 2XWYA 3MEGB 3V4IA 1JX4A 1KKHA 3DGVA 2VOPA 4XO0A 4WFBS 2AYBA 1TAUA 1UVLA 2RUGA 1RBLA 1IR0A 3CW2C 3M8PA 3J7ZV 4E2FB 3RRKA 3BSCA 2C3UA 2M8HA 1Q8BA 1SB6A 4K4ZA 1FESA 1WHVA 2RD5C 2PDAA 2YQ0A 2ZVSA 3ITHA 4L73A 4MYTA 3DOKB 3SCKE 2R8IA 4EYHB 4YS2A 5C2CA 4ZVPB 1RA6A 3UCZP 4CYUA 1CQMA 2HFNA 1RT3A 2MHNA 3N28A 2CYYA 4IFVA 2AZ1A 4C8KA 4QYZK 1CG2A 3T41A 1K44A 4MJKA 3L4BC 4FKYA 1YJVA 1VJWA 2GMLA 3HP6A 3CJSA 4FS1A 4LR8A 4RWWA 2BW7A 9ATCB 1FTCA 4IKAA 5A0YA 1Q79A 2QT7A 4WP3A 5J2PB 2COLA 1Z85A 4IO1A 5LMUF 4IQMA 4WP8A 2OH2A 3M30B 2KB2A 4NEYA 5DG7A 4ERDA 3QWPA 4DR5J 4S0MA 1LWXA 1FKPB 3I4HX 4IOAS 2AEJA 2B4UA 4DUYJ 2OFHX 3MECA 4RNOA 2AP6A 3D6MB 3PHEA 2RDJA 1ZM2A 3S01A 3SZ2A 2DNHA 3W65A 1NJZA 2UUAF 4N56A 5IM0A 3Q89A 2ZBRA 1V5IB 4EI2A 1FDDA 2CJQA 2F40A 4R0JA 3CD5A 5GAGU 4WF9S 4RPFA 3WIUA 1S7IA 4ZLNA 4DFJA 4LFAF 2JLFA 1T95A 2F3JA 3OTOJ 3MR2A 3O44A 3RGIA 1U2FA 1QTNB 2FHKA 4RW4B 3GYNA 2OIHA 1HQUA 1CULA 3OXLA 1N33F 2OGUA 1FXLA 1GAOA 1YSJA 1IBMF 3OTOF 2HMIA 2MQNA 4V194 5F9NA 4DG1A 4KE5A 3RBXA 5KT6A 2R8JA 2X3DA 3RRGA 5KFRA 2Q66A 3R5AA 1Q78A 1UWAA 2ZOGA 3MPDA 2E1MC 5LM7E 4DU8A 1B4SA 4DQPA 1UVMA 3SIPB 5LJ5Y 1UVNA 2JEIA 4OI6A 4U9RA 3HHEA 2F8EX 2DNNA 3ELHA 5D0EA 4PYAA 1HQEA 2AKWB 4PEOA 2PI4A 2FHJD 3KUEA 2LXUA 1WSRA 4CRJA 2B4PA 5E0OA 4JV0A 4CLPA 1HL6A 1MU2A 1DFUP 2HVDA 3P8BB 4P74A 3MUTP 4K2XA 1NK9A 3CNQP 2G4BA 3N6NA 2V50A 1OQ3A 1UPPA 2HNZB 4KGXB 4NL5A 1KLMA 1KOHA 5CYQB 3WX8A 4Z7CA 1H38A 2FLNA 2MQQA 1WD6A 4OZ0A 5FJ4A 3W1YC 1RTIA 3BSAA 2OEMA 3IM8A 1N33J 3GFYA 1N34F 4KB7A
chains in the Genus database with same CATH topology
3C46A 2R7SA 2J6UA 3AQOA 2GMHA 4C8MA 4FZVA 4W92B 4H54A 5DDPC 3L09A 4I4BA 1SUQA 4QBUA 3P6YC 4A8XA 1QAIA 1F60B 2BJEA 2V94A 2FVPA 5HL7Q 2RQCA 3RAXA 2LXIA 3R5CA 1SJ4P 1QUPA 2DR8A 1MROA 4NZ0A 5BYRA 2ZBIA 2VOOA 2MQOA 1ZETA 1L5UA 2BDPA 1RA7A 2E5IA 3D1OA 2CPXA 3V6HA 1V3RA 4ITSA 2N7CA 2FDNA 4ZVFA 1KR4A 2BA9A 4QWBA 3OJSA 4KJIA 2HHSA 2HIQA 2AJFE 3OFEA 1VS3A 4ZMMA 3QLHA 3F73A 3B82A 4NZ7A 4KRWA 1L3SA 1MW7A 4DQPA 2MHEA 4NLRA 2KHDA 3OW2R 2VA3A 2X1FA 4K4VA 1GTHA 2J9DA 1HW9A 4MYUA 3TVZA 5GAHI 1K0TA 2K1RB 3I0RA 4C0OC 2KFNA 1S97A 3ZZOA 2FLLA 2XWXA 5MLCV 1VQ5S 2LA4A 2LVWA 2YKMB 2ZKTA 1Z1ZA 3NBPB 4A8KA 3U02A 2FHMA 3PIOS 1X8DA 4EO8A 4O3SA 3MR5A 4YDXA 3TARA 1Q8IA 3QIPA 4IOAQ 1VQSA 1X9WA 1RGVA 2DH7A 4Y3CA 5A8KA 1S6QB 4WFXA 5B0GA 5M2PA 2XGPA 3MFIA 3JSMB 1M1KT 4M5DA 5G0RA 2JLGA 4C7QA 4MFBA 5ITHA 1LK5A 3M6WA 1HW8A 1LWFB 3GR0A 1TZ0A 5AE3A 4I1TA 3M9NB 2VC0A 4MFBB 1VRTB 4B9TA 1E6VA 3DRSB 3FMWA 3CDAA 4USJC 4WKYA 4CO3A 4W90B 2Y1JA 4I64A 3U27A 1NJYA 1O5JA 5F41A 4CNYA 1E6YA 5HMYA 2ZH3A 3BDPA 3OVBA 5AXNA 3QGIA 3SYZA 2X1GA 4IG3A 3D2WA 1FKPA 1UFWA 3I87A 2E44A 3QJJA 3L7PA 4ID5B 3QGGA 3OVAA 5L8RC 2KG1A 4FBTA 1R0AA 3T1YF 2ZH7A 4LVNP 4PCQA 2HGNA 4I56A 1BQMB 2GIQA 3I5CA 2YH1A 4LF5F 2GX8A 1Y00A 1ZPVA 2J0XA 4L6V3 3FJ2A 1R8HA 2KZZA 2J7WA 3CJKB 4YR3A 3TUJC 1SH0A 4I67A 1BY9A 1UEUA 1DTQB 4G1QA 2BQUA 2KT3A 1QSLA 5K9FA 4FXWA 1KQGB 1JJHA 3M8PB 2LA6A 2CPDA 2JVRA 2JZ5A 2KHCA 4XAKA 1M5HA 1SIZA 2KXNB 3PIPQ 1URRA 5L1JA 2EFQA 4DL4A 1E6YB 1U6ZA 2YNFB 2F7VA 2W7AA 3PXGa 3VTIA 2E29A 1AROP 2XMUA 3EUNA 4ALZA 2L9WA 3M9MB 1Z2LA 3LAMA 4G6VB 2HHUA 2KXHA 1GTSA 5HMZA 4B17A 5LSOA 2JC1A 2VG6A 3GV5B 2OP5A 1U1RA 3AJ1A 3CDBA 1CC8A 5GAGI 3UCUP 4YFUA 2NREA 1FDAA 1S1UB 1X4HA 3U1MA 2HWTA 2P5VA 1ZPWX 5BYQA 4ED0A 4ZVGA 1JLAA 2NSBA 3IG1A 4KBIA 2V9WA 3RB4A 3QLHB 2VKRA 4FXDA 5JXSA 1C1BA 2PD1A 1KOOA 4DLEA 1OSCA 3FQKA 3S7RA 4A8WA 2GHPA 4RW7A 2W4PA 2YKNB 3H2LA 5AXMA 5KFXA 3THTA 4IG0B 1VRUB 3MURP 1XMOF 4WFAQ 3OTBA 5B0CA 1TK0A 4HI1A 3N5FA 2HHQA 4N8NA 4DQSA 2ZH2A 4RW6B 4PPZA 2DNLA 3TVYA 3MM5B 4BC7A 4CCHA 1MSWD 3CULA 3DYAA 1RQ0A 1J5OA 3GFZA 1YJTA 2FIUA 2WBRA 4NCAA 2JVOA 2HG4A 2KYZA 4X4NA 4C8ZA 4B3SF 2IHR1 5F0WA 2QRRA 3TVKA 5F8NA 4KPYA 3Q8QB 4OQJA 1NZAA 5IT9Y 3DLHA 4WK3A 4R25A 2V4RA 4WCEQ 1JXEA 3IGNA 2XLKA 4NMLA 3MMBA 3UFCX 3OL8A 3TAMB 2A2DA 4WXWA 1JLAB 4A8MP 4ZCIA 4QW9A 2FJAB 2W9CB 1WEYA 2ZE2B 2RRAA 2XI2A 4C0HA 1BQMA 4FNHA 1XR5A 4QU6A 3E2EA 4LUBA 3J7A1 1NB7A 3OSPA 3HHLA 5KG2A 4JI7F 2I5JB 2UUTA 3BGRA 4OJHA 2J9EA 2FGOA 3AH6A 3GYXB 2YVSA 4RW7B 1RAJA 2E1AA 5C25A 4GKJF 1S6PB 3C6UA 4PUOA 2RT3A 3HX9A 4Y28C 3GV7B 3RBEA 2CIMA 4F4ZA 5HROA 4G1PA 3PJXA 2QFJA 2KKHA 1OWXA 2ZHBA 4FXVA 1S99A 1FK9B 5B09A 4QPXA 3KLFB 3IAS9 1EUQA 2MSSA 3NL0A 2M7SA 3CCMS 3V4IB 1NK8A 3CTRA 5CXTA 4ZCLA 4OHZA 1YJUA 2X1AA 4KT0C 3M8QA 4FPRA 1X4BA 4K5SA 3N01A 2XY7A 5KG6A 2VH7A 1TL4A 3QJPA 1B0PA 1UWBA 1U45A 2HMIB 2ZUGA 4CTAA 3HM9A 1H7XA 2ZD1A 1R43A 4H4MB 4OX8A 2FLOA 3ZZ0A 1H98A 1LK7A 3RAQA 4A8FA 2LQ9A 2MZQA 4LT6A 3BSNA 2EBGA 3C3LA 3G96A 1KLNA 1F0XA 3C2PA 3SXLA 4J9OA 1IJEB 1BD6A 1R7IA 2K1RA 4KHMA 2B9YA 4ZCKA 4B9SA 2DGTA 3A8EA 2M88A 2FC8A 4TU9A 4RNHA 1FE0A 2KH9A 5DO2A 2UV8G 4YB7A 5IXUA 3PKMA 2DGOA 4I2PB 1DLOB 3MUMP 1JLQA 2D3ZA 2QLWA 3C6UB 4PUOB 2JSXA 3DXBA 4K4XA 2DRBA 3MPVA 1Y3KA 4ZPBA 1NKEA 2QA4S 2JHEA 4Y2KA 4NYOA 4F4XA 2YH0A 3MEGA 5JUMA 3T1HF 2HQ3A 3ISZA 3M2UA 4LQ9A 1O0PA 3DMJB 4X62F 2Z0GA 2ZH4A 2C42A 4IG3B 5HBMA 5IFMA 3QIPB 3MM6B 4CTAB 3VALA 4IR1A 3HHNB 4WFNS 1S1TB 4YDDB 1IKWB 2XSJA 4QJVA 3LF0A 4PQUA 1DJ0A 4DV4F 3RB3A 2UZAA 1S1XB 1J2VA 4IOCS 2I2YA 1VRTA 3IR7B 2YKAA 2NUHA 4ETZA 4ZVHA 3DHWC 2PI5A 1DTTA 2MZTA 1X4FA 4F3QA 3DM2B 3KK2B 4M94A 2UXCF 4F2SA 2FTRA 4QYRA 4HEA9 1I1GA 2RU9A 1WHXA 2CKWA 3W2WA 5EHHA 5DGAA 1HNVA 1N0VC 4CNZA 1WF2A 4BWMA 5B0BA 3MEEA 4DUZF 1M5VC 1IKVA 1YVFA 2QIFA 2WAQD 3ETOA 3MM7A 4O3NA 2GMJA 1HI8A 4J9KA 4DR3F 4DQQA 1X0FA 4KGKA 4N47A 1U09A 5F8HA 2EG2A 3ISND 3NG8A 5I4MA 2DNKA 4UW2A 1LWCB 2OPSB 4WIIA 3BEGB 1U1NA 2B7BB 2LQ5A 4RW9A 4YOEA 4OL8A 2C3YA 3CCTA 1TKXA 2IM0A 1V3SA 2RSQA 3NP5A 1MU2B 5LXYA 4FN5A 2ROPA 4OZ1A 5A8WB 3QZ8A 3ZC4A 1N5YA 1JJ2R 3HF5A 1S1UA 2EPIA 2O1PA 5KFWA 3UR0A 2YNIA 1FXDA 1ZJWA 4OI1A 2V0NA 1S1XA 2B7CB 4NLDA 2CVIA 2BXJA 4N41A 3CD0A 1ZM3A 3MECB 2XCAA 3E01B 3HKZD 2CQ3A 5BJRA 1Y5LB 5GMKa 1AW0A 2OPQB 1U2RA 2RJZA 4YY3F 4B9MA 3K5NA 1F5CA 5MAOA 2VG5B 1TL3B 5LJ3Y 2EFNA 3CIMA 1Q8LA 3TA0A 2V5HG 4KFBA 4Q44A 2QE5A 4DL7A 2HHWA 4Q2LA 1C4CA 4N5SA 1D9FA 1UA1A 2CPEA 3NLCA 1HR0F 2FPHX 1X4EA 1V6HA 5C42A 1TKZB 4MIWA 1G1XA 4ES2A 6FD1A 3K58A 5EN1A 4MTPA 1VIOA 1HQUB 2GFFA 3I0SA 5A6PA 5B7WA 3G8TA 4IUFA 1D6KA 5JVHQ 4GKKF 1LFPA 1S6UA 3EZUA 3M8SA 2CPIA 2V2KA 1VQOS 1NJIT 4DV5F 2RIJA 4J9NA 4H4OA 3MZIA 2HNYB 2GJIA 2N4CA 3O3LA 2DPIA 1FCAA 1OPIA 3OXGA 4QYZJ 4ECRA 2ZD1B 5JVGS 1RWUA 4UQTA 2DR7A 2VG7A 3M2VB 1TVRB 4LFCF 4IFYA 2ZH8A 3OTEA 4F25A 3JTNA 1TKTA 3KG4A 2VFRA 1WG5A 1JB0C 2AW0A 1PC5A 2CQ0A 4NLVA 3TANA 4G3IA 3K8VA 2MQLA 1WHWA 2WHOA 1FRHA 3QIDA 4ZHRA 4EUVA 3I0RB 1TFYA 2O01C 2ZJPS 3VR1A 1QE1B 1LWFA 3MUVP 1SJFA 3I4PA 3A1YG 2EBEA 3DNCA 2C2EA 4DV6F 4U7CA 1Q86T 2IBOA 3CMAS 2HWIA 3T19A 2HS3A 5KAKA 1JXLA 2GO9A 2DT9A 3G8QA 1U6FA 3GR1A 2A18A 2DGVA 1S9GB 3CF5Q 3H5YA 3GIJA 2GV1A 1C0TA 2XNQA 2CPJA 3K5PA 1H6KX 4YEAA 1VK3A 4Y2AA 4FF4A 4AQYF 2HVIA 3HMJG 3I5AA 4TQSA 1IBLF 1TKDA 1U25A 4C0BA 4C8NA 2XEXA 4I7FB 4LF4F 1BGXT 3RR8A 2W9AA 3OLAA 1X5PA 1S7HA 5GAGW 1P1LA 2KT2A 1XMBA 1WTFA 4RKUC 4LSLB 4JV1A 3PR5B 1GH8A 3IRXB 4CO0A 3S1TA 2XS7A 4MKBA 2BANB 3KFWX 1RTIB 1JLBB 3CSKA 1D3WA 2DNRA 3CCRS 4OZLA 3KHHA 1M5PC 1IM4A 1HPZB 3K0JA 1BQNA 2DK2A 3DRYA 1Q16B 4RW6A 1S6QA 3D0GE 1EETB 2CQPA 4NLTA 5F8MA 3RZAA 1RTJB 4OI4A 4WU3A 2Z8QA 4A8YA 1ZYQA 1RTDB 2MQPA 4FF1A 3DLLS 1ULRA 3HK2A 3I31A 1UP1A 1DHMA 3HZEA 3KG1A 3EGZA 1T03A 2MPUA 4N76A 3NBPA 1YHQS 5K8MA 5CCMA 3L95X 7FD1A 2SXLA 4IG0A 4QWAA 4DR2F 4B3TF 5DQGA 2RILA 5D3GA 2WOMB 1BC6A 3MMCA 4ECZA 2VODA 2EW9A 4FF2A 4KKOB 1RT4A 1FJEB 2XBPA 2OPSA 5BYSA 4C8OA 4DHVA 3BQ1A 1ZAVA 2JH3A 1RTHB 3MXHP 3HVWA 2MDAA 2GJ2A 3CCSS 5T41A 1ZZFA 1IKXA 2VBWA 3SI8A 1KQFB 3G71S 4DSEA 5CA5A 1S1TA 5B08A 4I6YA 4F4WA 2M8DB 2OKQA 1TL1A 4IRDA 2KM8C 3BJYA 2W7OA 3EPIA 4PWUA 2GA7A 3IN5A 3K57A 3SCIE 3V4MA 2R7TA 4RW8A 1HPZA 3RU0A 3G8SA 2CQIA 3LALA 3CJ5A 3H4DA 1SL0A 3I32A 2LLZA 5DM6S 3MPWA 1DTQA 3IXQA 4LF6F 3MPYA 2ZNZA 3BQ0A 4K4SA 3HKWA 3I0SB 3PDNA 4YR2A 1XNRF 4KV8A 3V5RA 3DI6A 2MKHA 5DQHA 1H3DA 3X3UA 2RDIA 5D77A 5IM0B 4V19J 4HDGA 2C3PA 3I82A 4QU7A 2DH9A 2E5GA 3ITHB 4OZJA 3I9V9 1FE4A 5HBMB 2IAJA 3DOLA 3FGVA 1F9FA 3B8HA 2W7PA 4I6AA 4CO1A 4QR0A 4O4RA 1FEUA 4TU7A 2CQBA 2KM8B 4O0IA 4X84A 4M1KA 1Y9OA 2E1RA 1S72S 1Q82T 2GIRA 1FJ7A 1ELOA 3TW0A 2HS4A 5F3ZA 4UY88 2MQMA 3D1HA 1TVRA 4X4SA 2RE1A 2ZC3A 3KHGA 1N88A 3LWLA 5HN0A 2XI3A 4DG1B 4D3GA 2ZJRS 1TAQA 4KTQA 1X4GA 2VBZA 1HNXF 2VUGA 4LF7F 4ZPCA 4ZK7M 1U1MA 2MMYA 3KLIB 3DHXA 5K8NA 1VQKS 3OFFA 4IRCA 5KFYA 2KJWA 4ED2A 1FTRA 4X4OA 3CJ2A 3DXSX 2O3DA 3G9CA 1YRXA 2BJDA 2V8GA 1U6BA 1FO1A 4BWJA 5C42B 3DDNA 3MFHA 4J5OA 1L3KA 4DQIA 5A8KB 3DU6A 2ZOMA 2KG0A 2YKMA 1VFJA 3KJVB 4ILRA 4ED1A 1B0TA 3LUYA 1O0BA 1BLUA 2AYMA 1VQPS 4CI0B 1YRTA 2KYXA 4Q45A 1DBDA 2OPRA 2VG5A 1QTMA 2W4DA 3LO3A 2E7XA 4O23A 4CT9A 3M6XA 3OPKA 4NRTA 2H5EA 2ILYA 4Q5VA 3TA1A 4QIWD 2GHWA 2W25A 2UUBF 4IFVB 3D0IE 1YI2S 3RYLA 2AJ4A 2L41A 1T05A 2Q6BA 3CVKA 5A8RA 2XMKA 3HO1A 1KN6A 4GO7X 4NLPA 1YTYA 4K4TA 4O44B 3IAM9 1UL3A 3BGRB 5EUHA 5JVHS 2U1AA 2DISA 1HWIA 1VGYA 2MY7A 4WKRA 3SMZA 1GXLA 2V9KA 4JUZA 5J2NB 3BO3A 5K14B 1XMQF 2XG8A 1YBAA 2YNGA 1U1OA 2BM0A 2HGLA 3CGIA 2MSTA 1DQ8A 4YUDA 3PW5A 1HBMB 2OAUA 2OMOA 1LW2A 3KHLA 1XWLA 1SL1A 2YWFA 3PEHA 2PI4A 4H4KA 4QIEA 4TU8A 2R2RA 4WE1A 1I94F 3OUYA 2KI2A 4RNMA 4Z2XA 3MEEB 1WWHA 3HHDA 2PN6A 3DN9A 2OSQA 1S9GA 4DF8A 1XK8A 1JLQB 2MJNA 3EZ5A 3FZ2A 1KONA 3CCWA 2WSEC 4NOHA 2ASDA 2MKJA 1N0UA 4DV1F 2DVIA 2BOPA 2RQKA 1NO8A 4ECVA 2EI5A 2D3OR 3K5LA 1N5TA 2GQCA 4HHJA 1NK0A 3Q2SC 4JBCA 3VAIA 3PO5A 2VASA 3V6DB 2XNRA 2J7KA 3MTJA 4DF4A 3JAMY 2QV6A 4DSJA 3RBDA 4PQUB 3TAQA 2J0SD 4B3OA 3NNHA 2OPRB 2M2BA 3EXYA 2UXDF 2JWNA 1T7PA 2ZOFA 4K59A 3ENVA 1XR6A 2MXYA 3HHLC 1RYRA 3LH2S 1JKHB 1RT6B 3N4WA 5F8LA 4JV2A 2RS2A 2OJ3A 3OLBA 1LKZA 2FHOB 4X2B