3CF5S

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
total genus 18
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3cf5S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 3cf5S02
1EXDA 1O0BA 1B75A 5DM6S 2ZJQS 1NYLA 4WFAS 2ZJPS 1EUYA 1FEUA 1D6KA 1QRSA 1DFUP 5BNZA 4IOAS 3J7ZV 4JYZA 1GTRA 4IO9S 4WF9S 5IZNA 3DLLS 5JVGS 1QRUA 1QTQA 5DM7S 2ZJRS 3PIOS 4U67S 5JVHS 4IOCS 5GAGW 4JXXA 5HL7S 4WFBS 1QRTA 4P2BA 3CF5S 4UY88 2RE8A 2HZ7A 1O0CA 4WCES 4JXZA 1ZJWA 5GAEW 1EUQA 4WFNS 4H3SA 2RD2A 3AIIA 5GAHW 5GADW 3PIPS 1GTSA
chains in the Genus database with same CATH superfamily
3GTOC 5TMCA 3CQZC 4A93C 1UDXA 1I6VA 4Q5SA 1I6HC 2WB1D 1VHKA 2A69A 1EUYA 2EGVA 1BDFA 4YFKA 2PICA 1Y1VC 3S2HC 3HOXC 3GTGC 3J7ZV 3FKIC 4JK1A 2BE5A 4A3EC 3DLLS 1Y1WC 4MEYA 4OIPA 3W2VB 4NOIA 5IYCC 5DM7S 3M4OC 4MEXA 2ZJRS 3PIOS 4U67S 4KN7A 4Y7NC 4YFNA 3HOYC 5IP9C 2NWAA 4JXXA 5TMFA 3H0GC 4OINA 4WFBS 4XSZA 4UY88 3PO3C 2RE8A 2HZ7A 2L3UA 3LYWA 5FLMC 4A3CC 2GAEA 1O0CA 4WCES 2NVXC 3GTKC 1EUQA 4OIOA 4Y52C 3S1NC 4G7HA 4A3MC 1V6ZA 4G7ZA 3I4NC 3CZBA 5C4JC 2NVTC 2ZJQS 4XSXA 1NYLA 4A3IC 4H4KA 1QRSA 4A3BC 2R93C 4LLGA 4A3KC 3S1QC 1GTRA 3S16C 3S15C 5JVGS 1QTQA 1R9TC 4L69A 4E8BA 3HOZC 3S2DC 4YG2A 4LK0A 5HQHA 4A3GC 2PMZD 4KN4A 2NVQC 2L5NA 3H3VD 1IW7A 5C4XC 1I50C 2PA8D 1QRTA 3K7AC 4A3FC 2WAQD 4BXXC 3CF5S 4KMUA 2PI8A 1Z85A 1YNJA 4OIRA 3I4MC 3X1LB 2PNWA 1TWFC 3WODA 4WFNS 2RD2A 2E2IC 5GAHW 2CW0A 4Q4ZA 3GTPC 1EXDA 1O0BA 4C2MC 1VHYA 2ZJPS 4V194 4A3JC 1D6KA 1DFUP 1TWCC 1NXZA 3S14C 5IYDC 4A3DC 2O5JA 4IOAS 2JA6C 4IO9S 4LK1A 4BBSC 1QRUA 4QIWD 2CX8A 4C3JC 3KW2A 2E2HC 2YU9C 4OIQA 4LJZA 5GAGW 4XLNA 2Y0SD 4J3CA 4QJVA 1TWHC 4P2BA 2A68A 3DXJA 4ZH4A 5C44C 4C3HC 2E2JC 2AE0X 2NVYC 4GZYA 1ZJWA 5GAEW 1SMYA 4H3SA 2JA8C 3AIIA 5GADW 1I3QC 3HKZD 2VUMC 3M3YC 1B75A 3PO2C 2KQ1A 5IP7C 5DM6S 3GTQC 2B63C 2KXYA 4YFXA 3S1MC 4WFAS 2G6GA 1FEUA 4MQ9A 3GTLC 4G7OA 2G5DA 1TWAC 3GTMC 5BNZA 4BBRC 2A6EA 4BY7C 4JYZA 3HOUC 4C3IC 4WF9S 5C3EC 4AYBD 2PJJA 2Z0YA 5IZNA 1WCMC 2A6HA 2KPUA 4BY1C 4IOCS 2PPBA 5JVHS 1ZYRA 2O5IA 3GTJC 3HOWC 4XLPA 3W2WB 5HL7S 3RZDC 3EQLA 2JA7C 4X6AC 1TWGC 3S1RC 3RZOC 4JXZA 2R7ZC 3S17C 5IYBC 1SFOC 5D4DA 2JA5C 1YNNA 4A3LC 1HQMA 2EGWA 3HOVC 2R92C 3PIPS 1GTSA 1K83C
chains in the Genus database with same CATH topology
1EXDA 1O0BA 1UDXA 1B75A 5DM6S 2ZJQS 4V194 1NYLA 4WFAS 2ZJPS 1EUYA 4H4KA 1FEUA 1D6KA 1QRSA 1DFUP 5BNZA 4IOAS 3J7ZV 4JYZA 1GTRA 4IO9S 4WF9S 5IZNA 3DLLS 5JVGS 1QRUA 1QTQA 3W2VB 5DM7S 2ZJRS 3PIOS 4U67S 5JVHS 4IOCS 5GAGW 4JXXA 3W2WB 5HL7S 4WFBS 1QRTA 4P2BA 3CF5S 4UY88 2RE8A 2HZ7A 1O0CA 4WCES 4JXZA 3X1LB 1ZJWA 5GAEW 1EUQA 4WFNS 4H3SA 2RD2A 3AIIA 5GAHW 5GADW 3PIPS 1GTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EXD A;  1O0B A;  1B75 A;  5DM6 S;  2ZJQ S;  1NYL A;  4WFA S;  2ZJP S;  1EUY A;  1FEU A;  1D6K A;  1QRS A;  1DFU P;  5BNZ A;  4IOA S;  3J7Z V;  4JYZ A;  1GTR A;  4IO9 S;  4WF9 S;  5IZN A;  3DLL S;  5JVG S;  1QRU A;  1QTQ A;  5DM7 S;  2ZJR S;  3PIO S;  4U67 S;  5JVH S;  4IOC S;  5GAG W;  4JXX A;  5HL7 S;  4WFB S;  1QRT A;  4P2B A;  3CF5 S;  4UY8 8;  2RE8 A;  2HZ7 A;  1O0C A;  4WCE S;  4JXZ A;  1ZJW A;  5GAE W;  1EUQ A;  4WFN S;  4H3S A;  2RD2 A;  3AII A;  5GAH W;  5GAD W;  3PIP S;  1GTS A; 
#chains in the Genus database with same CATH topology
 3GTO C;  5TMC A;  3CQZ C;  4A93 C;  1UDX A;  1I6V A;  4Q5S A;  1I6H C;  2WB1 D;  1VHK A;  2A69 A;  1EUY A;  2EGV A;  1BDF A;  4YFK A;  2PIC A;  1Y1V C;  3S2H C;  3HOX C;  3GTG C;  3J7Z V;  3FKI C;  4JK1 A;  2BE5 A;  4A3E C;  3DLL S;  1Y1W C;  4MEY A;  4OIP A;  3W2V B;  4NOI A;  5IYC C;  5DM7 S;  3M4O C;  4MEX A;  2ZJR S;  3PIO S;  4U67 S;  4KN7 A;  4Y7N C;  4YFN A;  3HOY C;  5IP9 C;  2NWA A;  4JXX A;  5TMF A;  3H0G C;  4OIN A;  4WFB S;  4XSZ A;  4UY8 8;  3PO3 C;  2RE8 A;  2HZ7 A;  2L3U A;  3LYW A;  5FLM C;  4A3C C;  2GAE A;  1O0C A;  4WCE S;  2NVX C;  3GTK C;  1EUQ A;  4OIO A;  4Y52 C;  3S1N C;  4G7H A;  4A3M C;  1V6Z A;  4G7Z A;  3I4N C;  3CZB A;  5C4J C;  2NVT C;  2ZJQ S;  4XSX A;  1NYL A;  4A3I C;  4H4K A;  1QRS A;  4A3B C;  2R93 C;  4LLG A;  4A3K C;  3S1Q C;  1GTR A;  3S16 C;  3S15 C;  5JVG S;  1QTQ A;  1R9T C;  4L69 A;  4E8B A;  3HOZ C;  3S2D C;  4YG2 A;  4LK0 A;  5HQH A;  4A3G C;  2PMZ D;  4KN4 A;  2NVQ C;  2L5N A;  3H3V D;  1IW7 A;  5C4X C;  1I50 C;  2PA8 D;  1QRT A;  3K7A C;  4A3F C;  2WAQ D;  4BXX C;  3CF5 S;  4KMU A;  2PI8 A;  1Z85 A;  1YNJ A;  4OIR A;  3I4M C;  3X1L B;  2PNW A;  1TWF C;  3WOD A;  4WFN S;  2RD2 A;  2E2I C;  5GAH W;  2CW0 A;  4Q4Z A;  3GTP C;  1EXD A;  1O0B A;  4C2M C;  1VHY A;  2ZJP S;  4V19 4;  4A3J C;  1D6K A;  1DFU P;  1TWC C;  1NXZ A;  3S14 C;  5IYD C;  4A3D C;  2O5J A;  4IOA S;  2JA6 C;  4IO9 S;  4LK1 A;  4BBS C;  1QRU A;  4QIW D;  2CX8 A;  4C3J C;  3KW2 A;  2E2H C;  2YU9 C;  4OIQ A;  4LJZ A;  5GAG W;  4XLN A;  2Y0S D;  4J3C A;  4QJV A;  1TWH C;  4P2B A;  2A68 A;  3DXJ A;  4ZH4 A;  5C44 C;  4C3H C;  2E2J C;  2AE0 X;  2NVY C;  4GZY A;  1ZJW A;  5GAE W;  1SMY A;  4H3S A;  2JA8 C;  3AII A;  5GAD W;  1I3Q C;  3HKZ D;  2VUM C;  3M3Y C;  1B75 A;  3PO2 C;  2KQ1 A;  5IP7 C;  5DM6 S;  3GTQ C;  2B63 C;  2KXY A;  4YFX A;  3S1M C;  4WFA S;  2G6G A;  1FEU A;  4MQ9 A;  3GTL C;  4G7O A;  2G5D A;  1TWA C;  3GTM C;  5BNZ A;  4BBR C;  2A6E A;  4BY7 C;  4JYZ A;  3HOU C;  4C3I C;  4WF9 S;  5C3E C;  4AYB D;  2PJJ A;  2Z0Y A;  5IZN A;  1WCM C;  2A6H A;  2KPU A;  4BY1 C;  4IOC S;  2PPB A;  5JVH S;  1ZYR A;  2O5I A;  3GTJ C;  3HOW C;  4XLP A;  3W2W B;  5HL7 S;  3RZD C;  3EQL A;  2JA7 C;  4X6A C;  1TWG C;  3S1R C;  3RZO C;  4JXZ A;  2R7Z C;  3S17 C;  5IYB C;  1SFO C;  5D4D A;  2JA5 C;  1YNN A;  4A3L C;  1HQM A;  2EGW A;  3HOV C;  2R92 C;  3PIP S;  1GTS A;  1K83 C; 
#chains in the Genus database with same CATH homology
 1EXD A;  1O0B A;  1UDX A;  1B75 A;  5DM6 S;  2ZJQ S;  4V19 4;  1NYL A;  4WFA S;  2ZJP S;  1EUY A;  4H4K A;  1FEU A;  1D6K A;  1QRS A;  1DFU P;  5BNZ A;  4IOA S;  3J7Z V;  4JYZ A;  1GTR A;  4IO9 S;  4WF9 S;  5IZN A;  3DLL S;  5JVG S;  1QRU A;  1QTQ A;  3W2V B;  5DM7 S;  2ZJR S;  3PIO S;  4U67 S;  5JVH S;  4IOC S;  5GAG W;  4JXX A;  3W2W B;  5HL7 S;  4WFB S;  1QRT A;  4P2B A;  3CF5 S;  4UY8 8;  2RE8 A;  2HZ7 A;  1O0C A;  4WCE S;  4JXZ A;  3X1L B;  1ZJW A;  5GAE W;  1EUQ A;  4WFN S;  4H3S A;  2RD2 A;  3AII A;  5GAH W;  5GAD W;  3PIP S;  1GTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...