3CF5S

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
total genus 18
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3cf5S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 3cf5S02
5GAEW 4WFBS 5GAGW 2ZJPS 4U67S 2ZJRS 1EUQA 1NYLA 5JVGS 3PIPS 4IO9S 4IOCS 4P2BA 5JVHS 4WF9S 2RE8A 1D6KA 4UY88 5DM6S 4WFAS 4JXXA 1QRUA 5DM7S 5IZNA 3J7ZV 4JYZA 1O0BA 4WCES 4WFNS 5BNZA 4IOAS 2RD2A 2ZJQS 1QRSA 5HL7S 1EUYA 3DLLS 1DFUP 5GAHW 3PIOS 1ZJWA 1GTRA 1EXDA 1QTQA 1FEUA 2HZ7A 3AIIA 3CF5S 1GTSA 1B75A 1QRTA 5GADW 4JXZA 1O0CA 4H3SA
chains in the Genus database with same CATH superfamily
2PMZD 4U67S 1NYLA 2A6HA 4G7HA 4YFXA 4IO9S 2GAEA 2E2JC 2JA8C 2EGWA 4Q5SA 3GTKC 1IW7A 3GTJC 4C3JC 4WFAS 5IYBC 5C4XC 3S1NC 2Z0YA 4WCES 4J3CA 3KW2A 2ZJQS 1QRSA 1I6VA 3K7AC 4OIRA 3HOXC 3HOZC 5GAHW 3CQZC 4G7ZA 4BBSC 3W2VB 1EXDA 2Y0SD 4OIPA 1WCMC 4C3IC 2KPUA 4Y7NC 4C2MC 2R93C 3CF5S 4C3HC 4H4KA 5HQHA 4BXXC 1K83C 2E2HC 5JVGS 5IP7C 4WFBS 4A3EC 2ZJPS 1EUQA 3M4OC 3GTQC 3GTOC 3PIPS 1TWHC 2NVYC 3S14C 3CZBA 3S17C 4A3DC 3RZDC 4QJVA 2RE8A 2PICA 3HOVC 5TMCA 4A3MC 2YU9C 4A3CC 2A68A 3LYWA 3GTPC 3I4NC 3HOWC 4JK1A 2NVQC 1I50C 4LK1A 2CX8A 2JA5C 4XLNA 4Y52C 4MEYA 4LK0A 3PIOS 1YNJA 4BBRC 3HOYC 5C3EC 2B63C 3AIIA 1R9TC 3GTGC 3X1LB 2AE0X 3RZOC 3HOUC 1B75A 4BY1C 2R7ZC 5GADW 4MQ9A 4JXZA 4XSZA 1Z85A 4A3FC 2JA6C 4ZH4A 4H3SA 4OIOA 1SFOC 1VHYA 4LLGA 2PA8D 2NVXC 2E2IC 2KQ1A 4A3IC 3GTMC 4A93C 2L5NA 1UDXA 4P2BA 4GZYA 4L69A 2WAQD 2PNWA 1D6KA 4UY88 4BY7C 5IYCC 3S2DC 5DM7S 3J7ZV 3HKZD 1V6ZA 2EGVA 4Q4ZA 1Y1WC 1YNNA 4QIWD 5TMFA 2JA7C 4G7OA 4A3GC 5C44C 4KN4A 2RD2A 2PPBA 5HL7S 4LJZA 3S1MC 2NWAA 3DLLS 1EUYA 4A3JC 1SMYA 4MEXA 1ZJWA 1VHKA 2G6GA 5D4DA 2NVTC 1QTQA 1NXZA 1FEUA 3H0GC 2HZ7A 4NOIA 3PO3C 1GTSA 3S1RC 4A3LC 1QRTA 5C4JC 5IP9C 4AYBD 1O0CA 3H3VD 5GAEW 4XLPA 5GAGW 1TWFC 4OIQA 2ZJRS 1ZYRA 1BDFA 4OINA 3WODA 1I6HC 3W2WB 4IOCS 5JVHS 4KMUA 3PO2C 4WF9S 2CW0A 1TWAC 4YG2A 2O5IA 1TWGC 5DM6S 4JXXA 1QRUA 1Y1VC 4E8BA 5IZNA 4JYZA 1O0BA 2KXYA 3M3YC 3S15C 2G5DA 3I4MC 4WFNS 4A3BC 5BNZA 4IOAS 4KN7A 5IYDC 3S1QC 5FLMC 2R92C 2VUMC 4V194 1DFUP 1TWCC 3FKIC 2A6EA 3DXJA 4YFNA 3S2HC 2BE5A 2PI8A 1GTRA 2O5JA 2WB1D 3S16C 3GTLC 4A3KC 2PJJA 2A69A 4XSXA 3EQLA 2L3UA 1I3QC 4YFKA 4X6AC 1HQMA
chains in the Genus database with same CATH topology
5GAEW 4WFBS 5GAGW 2ZJPS 4U67S 2ZJRS 1EUQA 1NYLA 5JVGS 3PIPS 4IO9S 3W2WB 1UDXA 4P2BA 4IOCS 5JVHS 4WF9S 2RE8A 1D6KA 4UY88 5DM6S 4WFAS 4JXXA 1QRUA 5DM7S 5IZNA 3J7ZV 4JYZA 1O0BA 4WCES 4WFNS 5BNZA 4IOAS 2RD2A 2ZJQS 1QRSA 5HL7S 1EUYA 3DLLS 4V194 1DFUP 5GAHW 3PIOS 1ZJWA 1GTRA 3W2VB 1EXDA 1QTQA 1FEUA 2HZ7A 3AIIA 3X1LB 3CF5S 1GTSA 4H4KA 1B75A 1QRTA 5GADW 4JXZA 1O0CA 4H3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE W;  4WFB S;  5GAG W;  2ZJP S;  4U67 S;  2ZJR S;  1EUQ A;  1NYL A;  5JVG S;  3PIP S;  4IO9 S;  4IOC S;  4P2B A;  5JVH S;  4WF9 S;  2RE8 A;  1D6K A;  4UY8 8;  5DM6 S;  4WFA S;  4JXX A;  1QRU A;  5DM7 S;  5IZN A;  3J7Z V;  4JYZ A;  1O0B A;  4WCE S;  4WFN S;  5BNZ A;  4IOA S;  2RD2 A;  2ZJQ S;  1QRS A;  5HL7 S;  1EUY A;  3DLL S;  1DFU P;  5GAH W;  3PIO S;  1ZJW A;  1GTR A;  1EXD A;  1QTQ A;  1FEU A;  2HZ7 A;  3AII A;  3CF5 S;  1GTS A;  1B75 A;  1QRT A;  5GAD W;  4JXZ A;  1O0C A;  4H3S A; 
#chains in the Genus database with same CATH topology
 2PMZ D;  4U67 S;  1NYL A;  2A6H A;  4G7H A;  4YFX A;  4IO9 S;  2GAE A;  2E2J C;  2JA8 C;  2EGW A;  4Q5S A;  3GTK C;  1IW7 A;  3GTJ C;  4C3J C;  4WFA S;  5IYB C;  5C4X C;  3S1N C;  2Z0Y A;  4WCE S;  4J3C A;  3KW2 A;  2ZJQ S;  1QRS A;  1I6V A;  3K7A C;  4OIR A;  3HOX C;  3HOZ C;  5GAH W;  3CQZ C;  4G7Z A;  4BBS C;  3W2V B;  1EXD A;  2Y0S D;  4OIP A;  1WCM C;  4C3I C;  2KPU A;  4Y7N C;  4C2M C;  2R93 C;  3CF5 S;  4C3H C;  4H4K A;  5HQH A;  4BXX C;  1K83 C;  2E2H C;  5JVG S;  5IP7 C;  4WFB S;  4A3E C;  2ZJP S;  1EUQ A;  3M4O C;  3GTQ C;  3GTO C;  3PIP S;  1TWH C;  2NVY C;  3S14 C;  3CZB A;  3S17 C;  4A3D C;  3RZD C;  4QJV A;  2RE8 A;  2PIC A;  3HOV C;  5TMC A;  4A3M C;  2YU9 C;  4A3C C;  2A68 A;  3LYW A;  3GTP C;  3I4N C;  3HOW C;  4JK1 A;  2NVQ C;  1I50 C;  4LK1 A;  2CX8 A;  2JA5 C;  4XLN A;  4Y52 C;  4MEY A;  4LK0 A;  3PIO S;  1YNJ A;  4BBR C;  3HOY C;  5C3E C;  2B63 C;  3AII A;  1R9T C;  3GTG C;  3X1L B;  2AE0 X;  3RZO C;  3HOU C;  1B75 A;  4BY1 C;  2R7Z C;  5GAD W;  4MQ9 A;  4JXZ A;  4XSZ A;  1Z85 A;  4A3F C;  2JA6 C;  4ZH4 A;  4H3S A;  4OIO A;  1SFO C;  1VHY A;  4LLG A;  2PA8 D;  2NVX C;  2E2I C;  2KQ1 A;  4A3I C;  3GTM C;  4A93 C;  2L5N A;  1UDX A;  4P2B A;  4GZY A;  4L69 A;  2WAQ D;  2PNW A;  1D6K A;  4UY8 8;  4BY7 C;  5IYC C;  3S2D C;  5DM7 S;  3J7Z V;  3HKZ D;  1V6Z A;  2EGV A;  4Q4Z A;  1Y1W C;  1YNN A;  4QIW D;  5TMF A;  2JA7 C;  4G7O A;  4A3G C;  5C44 C;  4KN4 A;  2RD2 A;  2PPB A;  5HL7 S;  4LJZ A;  3S1M C;  2NWA A;  3DLL S;  1EUY A;  4A3J C;  1SMY A;  4MEX A;  1ZJW A;  1VHK A;  2G6G A;  5D4D A;  2NVT C;  1QTQ A;  1NXZ A;  1FEU A;  3H0G C;  2HZ7 A;  4NOI A;  3PO3 C;  1GTS A;  3S1R C;  4A3L C;  1QRT A;  5C4J C;  5IP9 C;  4AYB D;  1O0C A;  3H3V D;  5GAE W;  4XLP A;  5GAG W;  1TWF C;  4OIQ A;  2ZJR S;  1ZYR A;  1BDF A;  4OIN A;  3WOD A;  1I6H C;  3W2W B;  4IOC S;  5JVH S;  4KMU A;  3PO2 C;  4WF9 S;  2CW0 A;  1TWA C;  4YG2 A;  2O5I A;  1TWG C;  5DM6 S;  4JXX A;  1QRU A;  1Y1V C;  4E8B A;  5IZN A;  4JYZ A;  1O0B A;  2KXY A;  3M3Y C;  3S15 C;  2G5D A;  3I4M C;  4WFN S;  4A3B C;  5BNZ A;  4IOA S;  4KN7 A;  5IYD C;  3S1Q C;  5FLM C;  2R92 C;  2VUM C;  4V19 4;  1DFU P;  1TWC C;  3FKI C;  2A6E A;  3DXJ A;  4YFN A;  3S2H C;  2BE5 A;  2PI8 A;  1GTR A;  2O5J A;  2WB1 D;  3S16 C;  3GTL C;  4A3K C;  2PJJ A;  2A69 A;  4XSX A;  3EQL A;  2L3U A;  1I3Q C;  4YFK A;  4X6A C;  1HQM A; 
#chains in the Genus database with same CATH homology
 5GAE W;  4WFB S;  5GAG W;  2ZJP S;  4U67 S;  2ZJR S;  1EUQ A;  1NYL A;  5JVG S;  3PIP S;  4IO9 S;  3W2W B;  1UDX A;  4P2B A;  4IOC S;  5JVH S;  4WF9 S;  2RE8 A;  1D6K A;  4UY8 8;  5DM6 S;  4WFA S;  4JXX A;  1QRU A;  5DM7 S;  5IZN A;  3J7Z V;  4JYZ A;  1O0B A;  4WCE S;  4WFN S;  5BNZ A;  4IOA S;  2RD2 A;  2ZJQ S;  1QRS A;  5HL7 S;  1EUY A;  3DLL S;  4V19 4;  1DFU P;  5GAH W;  3PIO S;  1ZJW A;  1GTR A;  3W2V B;  1EXD A;  1QTQ A;  1FEU A;  2HZ7 A;  3AII A;  3X1L B;  3CF5 S;  1GTS A;  4H4K A;  1B75 A;  1QRT A;  5GAD W;  4JXZ A;  1O0C A;  4H3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...