3CF5S

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
total genus 18
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3cf5S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 3cf5S02
3PIPS 4IO9S 4IOAS 5JVHS 1DFUP 3J7ZV 5BNZA 5DM6S 5DM7S 1QTQA 1ZJWA 4WF9S 4WFAS 5GAEW 4WFBS 5JVGS 1GTRA 4JXXA 5GAHW 2RE8A 5IZNA 1EXDA 4UY88 1QRUA 5HL7S 4P2BA 1EUQA 2ZJRS 2ZJPS 4H3SA 1QRTA 3CF5S 3DLLS 2RD2A 5GAGW 4WCES 3AIIA 1O0CA 1EUYA 3PIOS 1GTSA 2ZJQS 4U67S 1QRSA 1B75A 4WFNS 1NYLA 1FEUA 1O0BA 4JXZA 2HZ7A 4JYZA 5GADW 1D6KA 4IOCS
chains in the Genus database with same CATH superfamily
4BBSC 4YFNA 3J7ZV 3W2WB 5BNZA 3GTGC 4A3CC 2PMZD 1QTQA 3W2VB 4WFAS 2WAQD 2E2IC 4JXXA 4C3HC 3GTMC 4ZH4A 5HL7S 4P2BA 2Y0SD 2EGVA 2ZJRS 3HOYC 2ZJPS 4H3SA 1QRTA 2CX8A 2PJJA 1I3QC 2GAEA 3AIIA 3M3YC 3CZBA 2NVTC 4A3JC 4OIPA 4LLGA 1IW7A 4L69A 3H3VD 4A3LC 5IYCC 3GTQC 4WFNS 2L5NA 5C44C 4JXZA 4E8BA 2HZ7A 2NVXC 5GADW 4A3KC 5IP7C 3X1LB 2PA8D 3PIPS 4IO9S 4A3DC 2E2JC 5DM6S 3PO2C 3RZOC 2G6GA 5C3EC 1SFOC 4WF9S 2PI8A 5GAEW 4WFBS 4A93C 1I6VA 3HOVC 4A3EC 1NXZA 5IZNA 1EXDA 3HOUC 1QRUA 1TWHC 1K83C 2PICA 3K7AC 3M4OC 4JK1A 1EUQA 1VHYA 2YU9C 2JA6C 3S15C 3S2DC 3H0GC 5HQHA 4X6AC 1TWCC 2O5IA 1V6ZA 4J3CA 4A3IC 1EUYA 1GTSA 4XSZA 4Y52C 2ZJQS 3S16C 5IP9C 1QRSA 5C4XC 1NYLA 1FEUA 2KQ1A 4JYZA 2JA8C 4LK0A 2CW0A 1D6KA 4IOCS 3S1NC 4Q5SA 3S14C 1YNNA 5TMCA 2JA5C 4IOAS 5JVHS 4MEYA 4C3JC 2E2HC 3S1MC 3LYWA 3WODA 3CQZC 1Y1VC 4BY1C 2O5JA 3FKIC 4OIOA 3EQLA 4KN7A 1GTRA 2R93C 2L3UA 4BXXC 1Y1WC 4BBRC 3HOWC 4UY88 2EGWA 5IYBC 2NVQC 3I4NC 2KXYA 4G7HA 4OIQA 4GZYA 2A6EA 5TMFA 3GTLC 4YG2A 3CF5S 1ZYRA 2RD2A 4WCES 2WB1D 3HKZD 1VHKA 2NWAA 1TWAC 4AYBD 2JA7C 3S1QC 2G5DA 3PO3C 4BY7C 4G7OA 1HQMA 4QJVA 3GTPC 3KW2A 4YFXA 5IYDC 4G7ZA 4XSXA 1R9TC 4OINA 1TWGC 2R7ZC 2VUMC 1DFUP 1I50C 1SMYA 5DM7S 3GTKC 1BDFA 1ZJWA 1TWFC 3S2HC 4NOIA 2A69A 4KMUA 4KN4A 2B63C 5C4JC 4LK1A 5JVGS 3RZDC 4A3GC 4C2MC 3HOXC 4OIRA 5GAHW 2AE0X 1UDXA 2RE8A 3DXJA 3GTJC 3S17C 2NVYC 4LJZA 3HOZC 1Z85A 4A3BC 3S1RC 4C3IC 2PNWA 5FLMC 2KPUA 3DLLS 4Q4ZA 5GAGW 4QIWD 4YFKA 1I6HC 2PPBA 3I4MC 1O0CA 2BE5A 3PIOS 1WCMC 4XLNA 4A3FC 5D4DA 1YNJA 2A68A 4XLPA 4U67S 1B75A 4MQ9A 4MEXA 4Y7NC 2R92C 1O0BA 4V194 4A3MC 4H4KA 2A6HA 3GTOC 2Z0YA
chains in the Genus database with same CATH topology
3PIPS 4IO9S 4IOAS 5JVHS 1DFUP 3J7ZV 3W2WB 5BNZA 5DM6S 5DM7S 1QTQA 1ZJWA 3W2VB 4WF9S 4WFAS 5GAEW 4WFBS 5JVGS 1GTRA 4JXXA 5GAHW 2RE8A 1UDXA 5IZNA 1EXDA 4UY88 1QRUA 5HL7S 4P2BA 1EUQA 2ZJRS 2ZJPS 4H3SA 1QRTA 3CF5S 3DLLS 2RD2A 5GAGW 4WCES 3AIIA 1O0CA 1EUYA 3PIOS 1GTSA 2ZJQS 4U67S 1QRSA 1B75A 4WFNS 1NYLA 1FEUA 1O0BA 4V194 4JXZA 2HZ7A 4H4KA 4JYZA 5GADW 1D6KA 4IOCS 3X1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP S;  4IO9 S;  4IOA S;  5JVH S;  1DFU P;  3J7Z V;  5BNZ A;  5DM6 S;  5DM7 S;  1QTQ A;  1ZJW A;  4WF9 S;  4WFA S;  5GAE W;  4WFB S;  5JVG S;  1GTR A;  4JXX A;  5GAH W;  2RE8 A;  5IZN A;  1EXD A;  4UY8 8;  1QRU A;  5HL7 S;  4P2B A;  1EUQ A;  2ZJR S;  2ZJP S;  4H3S A;  1QRT A;  3CF5 S;  3DLL S;  2RD2 A;  5GAG W;  4WCE S;  3AII A;  1O0C A;  1EUY A;  3PIO S;  1GTS A;  2ZJQ S;  4U67 S;  1QRS A;  1B75 A;  4WFN S;  1NYL A;  1FEU A;  1O0B A;  4JXZ A;  2HZ7 A;  4JYZ A;  5GAD W;  1D6K A;  4IOC S; 
#chains in the Genus database with same CATH topology
 4BBS C;  4YFN A;  3J7Z V;  3W2W B;  5BNZ A;  3GTG C;  4A3C C;  2PMZ D;  1QTQ A;  3W2V B;  4WFA S;  2WAQ D;  2E2I C;  4JXX A;  4C3H C;  3GTM C;  4ZH4 A;  5HL7 S;  4P2B A;  2Y0S D;  2EGV A;  2ZJR S;  3HOY C;  2ZJP S;  4H3S A;  1QRT A;  2CX8 A;  2PJJ A;  1I3Q C;  2GAE A;  3AII A;  3M3Y C;  3CZB A;  2NVT C;  4A3J C;  4OIP A;  4LLG A;  1IW7 A;  4L69 A;  3H3V D;  4A3L C;  5IYC C;  3GTQ C;  4WFN S;  2L5N A;  5C44 C;  4JXZ A;  4E8B A;  2HZ7 A;  2NVX C;  5GAD W;  4A3K C;  5IP7 C;  3X1L B;  2PA8 D;  3PIP S;  4IO9 S;  4A3D C;  2E2J C;  5DM6 S;  3PO2 C;  3RZO C;  2G6G A;  5C3E C;  1SFO C;  4WF9 S;  2PI8 A;  5GAE W;  4WFB S;  4A93 C;  1I6V A;  3HOV C;  4A3E C;  1NXZ A;  5IZN A;  1EXD A;  3HOU C;  1QRU A;  1TWH C;  1K83 C;  2PIC A;  3K7A C;  3M4O C;  4JK1 A;  1EUQ A;  1VHY A;  2YU9 C;  2JA6 C;  3S15 C;  3S2D C;  3H0G C;  5HQH A;  4X6A C;  1TWC C;  2O5I A;  1V6Z A;  4J3C A;  4A3I C;  1EUY A;  1GTS A;  4XSZ A;  4Y52 C;  2ZJQ S;  3S16 C;  5IP9 C;  1QRS A;  5C4X C;  1NYL A;  1FEU A;  2KQ1 A;  4JYZ A;  2JA8 C;  4LK0 A;  2CW0 A;  1D6K A;  4IOC S;  3S1N C;  4Q5S A;  3S14 C;  1YNN A;  5TMC A;  2JA5 C;  4IOA S;  5JVH S;  4MEY A;  4C3J C;  2E2H C;  3S1M C;  3LYW A;  3WOD A;  3CQZ C;  1Y1V C;  4BY1 C;  2O5J A;  3FKI C;  4OIO A;  3EQL A;  4KN7 A;  1GTR A;  2R93 C;  2L3U A;  4BXX C;  1Y1W C;  4BBR C;  3HOW C;  4UY8 8;  2EGW A;  5IYB C;  2NVQ C;  3I4N C;  2KXY A;  4G7H A;  4OIQ A;  4GZY A;  2A6E A;  5TMF A;  3GTL C;  4YG2 A;  3CF5 S;  1ZYR A;  2RD2 A;  4WCE S;  2WB1 D;  3HKZ D;  1VHK A;  2NWA A;  1TWA C;  4AYB D;  2JA7 C;  3S1Q C;  2G5D A;  3PO3 C;  4BY7 C;  4G7O A;  1HQM A;  4QJV A;  3GTP C;  3KW2 A;  4YFX A;  5IYD C;  4G7Z A;  4XSX A;  1R9T C;  4OIN A;  1TWG C;  2R7Z C;  2VUM C;  1DFU P;  1I50 C;  1SMY A;  5DM7 S;  3GTK C;  1BDF A;  1ZJW A;  1TWF C;  3S2H C;  4NOI A;  2A69 A;  4KMU A;  4KN4 A;  2B63 C;  5C4J C;  4LK1 A;  5JVG S;  3RZD C;  4A3G C;  4C2M C;  3HOX C;  4OIR A;  5GAH W;  2AE0 X;  1UDX A;  2RE8 A;  3DXJ A;  3GTJ C;  3S17 C;  2NVY C;  4LJZ A;  3HOZ C;  1Z85 A;  4A3B C;  3S1R C;  4C3I C;  2PNW A;  5FLM C;  2KPU A;  3DLL S;  4Q4Z A;  5GAG W;  4QIW D;  4YFK A;  1I6H C;  2PPB A;  3I4M C;  1O0C A;  2BE5 A;  3PIO S;  1WCM C;  4XLN A;  4A3F C;  5D4D A;  1YNJ A;  2A68 A;  4XLP A;  4U67 S;  1B75 A;  4MQ9 A;  4MEX A;  4Y7N C;  2R92 C;  1O0B A;  4V19 4;  4A3M C;  4H4K A;  2A6H A;  3GTO C;  2Z0Y A; 
#chains in the Genus database with same CATH homology
 3PIP S;  4IO9 S;  4IOA S;  5JVH S;  1DFU P;  3J7Z V;  3W2W B;  5BNZ A;  5DM6 S;  5DM7 S;  1QTQ A;  1ZJW A;  3W2V B;  4WF9 S;  4WFA S;  5GAE W;  4WFB S;  5JVG S;  1GTR A;  4JXX A;  5GAH W;  2RE8 A;  1UDX A;  5IZN A;  1EXD A;  4UY8 8;  1QRU A;  5HL7 S;  4P2B A;  1EUQ A;  2ZJR S;  2ZJP S;  4H3S A;  1QRT A;  3CF5 S;  3DLL S;  2RD2 A;  5GAG W;  4WCE S;  3AII A;  1O0C A;  1EUY A;  3PIO S;  1GTS A;  2ZJQ S;  4U67 S;  1QRS A;  1B75 A;  4WFN S;  1NYL A;  1FEU A;  1O0B A;  4V19 4;  4JXZ A;  2HZ7 A;  4H4K A;  4JYZ A;  5GAD W;  1D6K A;  4IOC S;  3X1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...