3CF5S

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3cf5S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 3cf5S02
3PIPS 3DLLS 4IO9S 4UY88 1GTRA 4P2BA 4WCES 2ZJQS 4JXZA 4WF9S 1QRSA 2ZJRS 1QRUA 1DFUP 3AIIA 4JYZA 1O0BA 1O0CA 1GTSA 5IZNA 5GADW 2RE8A 4IOCS 3CF5S 5DM6S 5HL7S 3J7ZV 5GAEW 5JVHS 4WFNS 5JVGS 1NYLA 2HZ7A 1QTQA 4WFBS 4IOAS 2ZJPS 1EUYA 4JXXA 1EXDA 4WFAS 5GAGW 4U67S 1FEUA 5GAHW 1QRTA 2RD2A 5BNZA 1D6KA 4H3SA 1B75A 1ZJWA 3PIOS 5DM7S 1EUQA
chains in the Genus database with same CATH superfamily
4IO9S 4LK1A 4G7HA 4H4KA 4A3DC 4XLPA 4Q4ZA 3S2HC 1TWGC 1QRSA 1QRUA 5C3EC 4C2MC 4JYZA 4MEYA 1SFOC 3S1NC 4XLNA 3W2WB 2VUMC 3GTQC 2JA6C 3HOZC 4A3GC 5IP7C 3GTGC 5JVHS 5C4XC 2PMZD 3HOYC 3W2VB 1NYLA 2PNWA 4C3JC 1WCMC 1SMYA 4IOAS 4OIRA 4KN4A 2B63C 4JXXA 4YFXA 5GAGW 4U67S 2GAEA 2KQ1A 2E2HC 1UDXA 5C4JC 2KPUA 1YNNA 2RD2A 4KMUA 1D6KA 2O5IA 2BE5A 4A3KC 4OINA 3H3VD 4ZH4A 3PIOS 2NVQC 4JK1A 3H0GC 4YFNA 4XSZA 4LK0A 3FKIC 3PIPS 4XSXA 2PI8A 4WF9S 4P2BA 4WCES 1ZYRA 2R7ZC 3AIIA 1O0BA 1O0CA 1GTSA 4MQ9A 4A3MC 5IZNA 4BBSC 2G6GA 1TWHC 2PA8D 2PJJA 3CF5S 4X6AC 5FLMC 2NVXC 2A69A 4WFNS 1IW7A 5TMFA 3HOVC 2HZ7A 4C3IC 2A68A 1QTQA 4WFBS 3GTKC 4G7ZA 1K83C 3HOWC 1EUYA 1EXDA 4AYBD 4L69A 2Z0YA 3HKZD 3GTMC 1FEUA 5D4DA 2O5JA 3S16C 1QRTA 1V6ZA 4BBRC 1I3QC 3S2DC 1I6HC 1ZJWA 3RZOC 4YFKA 5DM7S 3S1MC 2Y0SD 4J3CA 4Y7NC 1EUQA 1R9TC 1TWAC 2G5DA 2NVYC 4QIWD 4JXZA 4OIOA 3S14C 1GTRA 4A3EC 3WODA 4A3LC 2ZJRS 4A3JC 2A6HA 2L5NA 3GTOC 5GADW 2RE8A 4IOCS 5DM6S 1HQMA 4MEXA 4GZYA 3CZBA 5GAEW 4LLGA 2NVTC 3I4NC 1BDFA 5JVGS 4A3BC 3GTLC 2R92C 2JA7C 2ZJPS 1Y1VC 2A6EA 3HOXC 3KW2A 1Z85A 4V194 1VHKA 3S15C 4OIPA 3M4OC 4LJZA 3EQLA 3M3YC 5IYCC 4BXXC 3I4MC 2YU9C 4A93C 1TWFC 3CQZC 4A3CC 2CX8A 3DLLS 4UY88 5IYBC 2JA8C 2ZJQS 5TMCA 3K7AC 1DFUP 1I6VA 3X1LB 2KXYA 2EGVA 2WAQD 4YG2A 2PPBA 3S1QC 4A3FC 4BY7C 4G7OA 5IP9C 5HQHA 3PO3C 4KN7A 2NWAA 1NXZA 1I50C 5C44C 5HL7S 3J7ZV 2R93C 3LYWA 4QJVA 2JA5C 4NOIA 4Y52C 2EGWA 4E8BA 2WB1D 3S1RC 2AE0X 1Y1WC 3PO2C 2CW0A 4Q5SA 4C3HC 5IYDC 4WFAS 3RZDC 3HOUC 4OIQA 1VHYA 2L3UA 2E2JC 2E2IC 4BY1C 5GAHW 5BNZA 3DXJA 4H3SA 3GTPC 4A3IC 2PICA 1B75A 3GTJC 3S17C 1TWCC 1YNJA
chains in the Genus database with same CATH topology
3PIPS 3DLLS 4IO9S 4UY88 4H4KA 4P2BA 4WCES 2ZJQS 1GTRA 4JXZA 4WF9S 1QRSA 2ZJRS 1QRUA 3X1LB 1DFUP 3AIIA 4JYZA 1O0BA 1O0CA 1GTSA 5IZNA 5GADW 3W2WB 2RE8A 4IOCS 3CF5S 5DM6S 5HL7S 3J7ZV 5GAEW 5JVHS 4WFNS 3W2VB 5JVGS 1NYLA 2HZ7A 1QTQA 4WFBS 4IOAS 2ZJPS 1EUYA 4JXXA 1EXDA 4WFAS 5GAGW 4U67S 4V194 1FEUA 1UDXA 5GAHW 1QRTA 2RD2A 5BNZA 1D6KA 4H3SA 1B75A 1ZJWA 3PIOS 5DM7S 1EUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP S;  3DLL S;  4IO9 S;  4UY8 8;  1GTR A;  4P2B A;  4WCE S;  2ZJQ S;  4JXZ A;  4WF9 S;  1QRS A;  2ZJR S;  1QRU A;  1DFU P;  3AII A;  4JYZ A;  1O0B A;  1O0C A;  1GTS A;  5IZN A;  5GAD W;  2RE8 A;  4IOC S;  3CF5 S;  5DM6 S;  5HL7 S;  3J7Z V;  5GAE W;  5JVH S;  4WFN S;  5JVG S;  1NYL A;  2HZ7 A;  1QTQ A;  4WFB S;  4IOA S;  2ZJP S;  1EUY A;  4JXX A;  1EXD A;  4WFA S;  5GAG W;  4U67 S;  1FEU A;  5GAH W;  1QRT A;  2RD2 A;  5BNZ A;  1D6K A;  4H3S A;  1B75 A;  1ZJW A;  3PIO S;  5DM7 S;  1EUQ A; 
#chains in the Genus database with same CATH topology
 4IO9 S;  4LK1 A;  4G7H A;  4H4K A;  4A3D C;  4XLP A;  4Q4Z A;  3S2H C;  1TWG C;  1QRS A;  1QRU A;  5C3E C;  4C2M C;  4JYZ A;  4MEY A;  1SFO C;  3S1N C;  4XLN A;  3W2W B;  2VUM C;  3GTQ C;  2JA6 C;  3HOZ C;  4A3G C;  5IP7 C;  3GTG C;  5JVH S;  5C4X C;  2PMZ D;  3HOY C;  3W2V B;  1NYL A;  2PNW A;  4C3J C;  1WCM C;  1SMY A;  4IOA S;  4OIR A;  4KN4 A;  2B63 C;  4JXX A;  4YFX A;  5GAG W;  4U67 S;  2GAE A;  2KQ1 A;  2E2H C;  1UDX A;  5C4J C;  2KPU A;  1YNN A;  2RD2 A;  4KMU A;  1D6K A;  2O5I A;  2BE5 A;  4A3K C;  4OIN A;  3H3V D;  4ZH4 A;  3PIO S;  2NVQ C;  4JK1 A;  3H0G C;  4YFN A;  4XSZ A;  4LK0 A;  3FKI C;  3PIP S;  4XSX A;  2PI8 A;  4WF9 S;  4P2B A;  4WCE S;  1ZYR A;  2R7Z C;  3AII A;  1O0B A;  1O0C A;  1GTS A;  4MQ9 A;  4A3M C;  5IZN A;  4BBS C;  2G6G A;  1TWH C;  2PA8 D;  2PJJ A;  3CF5 S;  4X6A C;  5FLM C;  2NVX C;  2A69 A;  4WFN S;  1IW7 A;  5TMF A;  3HOV C;  2HZ7 A;  4C3I C;  2A68 A;  1QTQ A;  4WFB S;  3GTK C;  4G7Z A;  1K83 C;  3HOW C;  1EUY A;  1EXD A;  4AYB D;  4L69 A;  2Z0Y A;  3HKZ D;  3GTM C;  1FEU A;  5D4D A;  2O5J A;  3S16 C;  1QRT A;  1V6Z A;  4BBR C;  1I3Q C;  3S2D C;  1I6H C;  1ZJW A;  3RZO C;  4YFK A;  5DM7 S;  3S1M C;  2Y0S D;  4J3C A;  4Y7N C;  1EUQ A;  1R9T C;  1TWA C;  2G5D A;  2NVY C;  4QIW D;  4JXZ A;  4OIO A;  3S14 C;  1GTR A;  4A3E C;  3WOD A;  4A3L C;  2ZJR S;  4A3J C;  2A6H A;  2L5N A;  3GTO C;  5GAD W;  2RE8 A;  4IOC S;  5DM6 S;  1HQM A;  4MEX A;  4GZY A;  3CZB A;  5GAE W;  4LLG A;  2NVT C;  3I4N C;  1BDF A;  5JVG S;  4A3B C;  3GTL C;  2R92 C;  2JA7 C;  2ZJP S;  1Y1V C;  2A6E A;  3HOX C;  3KW2 A;  1Z85 A;  4V19 4;  1VHK A;  3S15 C;  4OIP A;  3M4O C;  4LJZ A;  3EQL A;  3M3Y C;  5IYC C;  4BXX C;  3I4M C;  2YU9 C;  4A93 C;  1TWF C;  3CQZ C;  4A3C C;  2CX8 A;  3DLL S;  4UY8 8;  5IYB C;  2JA8 C;  2ZJQ S;  5TMC A;  3K7A C;  1DFU P;  1I6V A;  3X1L B;  2KXY A;  2EGV A;  2WAQ D;  4YG2 A;  2PPB A;  3S1Q C;  4A3F C;  4BY7 C;  4G7O A;  5IP9 C;  5HQH A;  3PO3 C;  4KN7 A;  2NWA A;  1NXZ A;  1I50 C;  5C44 C;  5HL7 S;  3J7Z V;  2R93 C;  3LYW A;  4QJV A;  2JA5 C;  4NOI A;  4Y52 C;  2EGW A;  4E8B A;  2WB1 D;  3S1R C;  2AE0 X;  1Y1W C;  3PO2 C;  2CW0 A;  4Q5S A;  4C3H C;  5IYD C;  4WFA S;  3RZD C;  3HOU C;  4OIQ A;  1VHY A;  2L3U A;  2E2J C;  2E2I C;  4BY1 C;  5GAH W;  5BNZ A;  3DXJ A;  4H3S A;  3GTP C;  4A3I C;  2PIC A;  1B75 A;  3GTJ C;  3S17 C;  1TWC C;  1YNJ A; 
#chains in the Genus database with same CATH homology
 3PIP S;  3DLL S;  4IO9 S;  4UY8 8;  4H4K A;  4P2B A;  4WCE S;  2ZJQ S;  1GTR A;  4JXZ A;  4WF9 S;  1QRS A;  2ZJR S;  1QRU A;  3X1L B;  1DFU P;  3AII A;  4JYZ A;  1O0B A;  1O0C A;  1GTS A;  5IZN A;  5GAD W;  3W2W B;  2RE8 A;  4IOC S;  3CF5 S;  5DM6 S;  5HL7 S;  3J7Z V;  5GAE W;  5JVH S;  4WFN S;  3W2V B;  5JVG S;  1NYL A;  2HZ7 A;  1QTQ A;  4WFB S;  4IOA S;  2ZJP S;  1EUY A;  4JXX A;  1EXD A;  4WFA S;  5GAG W;  4U67 S;  4V19 4;  1FEU A;  1UDX A;  5GAH W;  1QRT A;  2RD2 A;  5BNZ A;  1D6K A;  4H3S A;  1B75 A;  1ZJW A;  3PIO S;  5DM7 S;  1EUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...