3CF5S

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
molecule tags Ribosome/antibiotic
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
total genus 18
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3cf5S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 3cf5S02
4WFBS 5GAEW 3J7ZV 4IOAS 5BNZA 3CF5S 1QRTA 4UY88 1FEUA 5JVHS 1NYLA 4WFAS 4WF9S 4IOCS 1ZJWA 2RE8A 1EUQA 4P2BA 2ZJQS 3AIIA 1O0BA 1EXDA 1GTRA 4H3SA 1QRUA 5JVGS 1QTQA 1GTSA 1D6KA 4JXZA 5IZNA 1DFUP 2RD2A 2ZJRS 4U67S 5GAHW 3DLLS 3PIOS 3PIPS 4JYZA 5HL7S 1EUYA 5DM7S 4JXXA 1QRSA 5GAGW 2HZ7A 4WCES 4IO9S 1O0CA 5DM6S 2ZJPS 4WFNS 1B75A 5GADW
chains in the Genus database with same CATH superfamily
4WFBS 4GZYA 3S14C 1Z85A 4WFAS 1ZJWA 4BY1C 1YNNA 1O0BA 1HQMA 2G5DA 3CQZC 2KXYA 1NXZA 4XLNA 2NVXC 3HOXC 4E8BA 4A3CC 1GTSA 4JXZA 4A3GC 1I50C 3DXJA 3GTOC 3HOVC 5IZNA 2RD2A 3WODA 3GTKC 1K83C 5GAHW 5IYCC 4A3BC 3PIOS 4JYZA 1EUYA 4KN7A 5IYBC 1UDXA 2B63C 5C4XC 2NWAA 2A6HA 5GAGW 2HZ7A 4WCES 1SMYA 4MQ9A 4C3HC 5IP7C 1O0CA 1TWGC 4MEYA 4A3MC 5DM6S 3RZOC 2JA8C 4G7ZA 2O5JA 5GAEW 4KN4A 3GTJC 3KW2A 4A3DC 2A69A 3J7ZV 4LK1A 1TWCC 5JVHS 3H3VD 4WF9S 4YG2A 4AYBD 4OINA 4A3EC 4Q5SA 1IW7A 4C3JC 3W2VB 3EQLA 4Y52C 2ZJQS 3AIIA 1R9TC 4X6AC 4Q4ZA 4YFNA 3W2WB 1GTRA 3S1NC 3CZBA 3S2DC 2PJJA 3HOYC 2PMZD 1QTQA 4LK0A 1SFOC 3S15C 1TWAC 3GTMC 1V6ZA 4A3JC 4H4KA 2YU9C 1I6HC 4U67S 3H0GC 4YFKA 3RZDC 2KPUA 3HKZD 5IYDC 5HL7S 4Y7NC 2NVYC 4JXXA 2WAQD 1I3QC 4KMUA 2A68A 4G7OA 1YNJA 3PO3C 2GAEA 3HOZC 4BY7C 2L3UA 3FKIC 5C3EC 3S1RC 2E2JC 4J3CA 5HQHA 4OIOA 5D4DA 4C3IC 4BBRC 5BNZA 4UY88 4V194 2O5IA 3GTPC 2E2HC 1NYLA 3GTQC 4IOCS 4LJZA 4BBSC 4QJVA 2RE8A 1EUQA 4P2BA 1I6VA 1TWHC 4G7HA 4OIQA 2JA7C 4XSXA 2PICA 4XSZA 1EXDA 4OIRA 4H3SA 2PI8A 2R92C 1QRUA 3M3YC 3S17C 2EGVA 2CX8A 5TMCA 2L5NA 2JA6C 1D6KA 2A6EA 5FLMC 5C4JC 2AE0X 2PPBA 4QIWD 3S2HC 3X1LB 4A3LC 2E2IC 3PIPS 2JA5C 1Y1WC 4A3KC 1QRSA 4IO9S 4BXXC 2WB1D 4MEXA 3M4OC 2PNWA 2KQ1A 1VHKA 2NVTC 4IOAS 1ZYRA 3CF5S 1QRTA 1FEUA 3K7AC 3HOUC 2BE5A 1Y1VC 3GTLC 2R7ZC 3I4MC 2Y0SD 5IP9C 4XLPA 3LYWA 2PA8D 3I4NC 4OIPA 4NOIA 1BDFA 3GTGC 2VUMC 5JVGS 5C44C 4C2MC 1WCMC 4ZH4A 1DFUP 2Z0YA 4YFXA 3S1MC 3PO2C 4A3FC 2ZJRS 2EGWA 4A3IC 3S1QC 4JK1A 3DLLS 3HOWC 2G6GA 5DM7S 4A93C 3S16C 2NVQC 5TMFA 1VHYA 4L69A 1TWFC 4LLGA 2CW0A 2R93C 2ZJPS 4WFNS 1B75A 5GADW
chains in the Genus database with same CATH topology
4WFBS 5GAEW 3J7ZV 4IOAS 5BNZA 3CF5S 1QRTA 4UY88 4V194 5JVHS 1FEUA 1NYLA 4WFAS 4WF9S 4IOCS 1ZJWA 3W2VB 2RE8A 4P2BA 2ZJQS 3AIIA 1O0BA 1EUQA 3W2WB 1EXDA 1GTRA 4H3SA 1QRUA 5JVGS 1QTQA 1GTSA 1D6KA 4JXZA 5IZNA 1DFUP 2RD2A 4H4KA 3X1LB 2ZJRS 4U67S 5GAHW 3DLLS 3PIOS 3PIPS 4JYZA 5HL7S 1EUYA 5DM7S 1UDXA 4JXXA 1QRSA 5GAGW 2HZ7A 4WCES 4IO9S 1O0CA 5DM6S 2ZJPS 4WFNS 1B75A 5GADW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB S;  5GAE W;  3J7Z V;  4IOA S;  5BNZ A;  3CF5 S;  1QRT A;  4UY8 8;  1FEU A;  5JVH S;  1NYL A;  4WFA S;  4WF9 S;  4IOC S;  1ZJW A;  2RE8 A;  1EUQ A;  4P2B A;  2ZJQ S;  3AII A;  1O0B A;  1EXD A;  1GTR A;  4H3S A;  1QRU A;  5JVG S;  1QTQ A;  1GTS A;  1D6K A;  4JXZ A;  5IZN A;  1DFU P;  2RD2 A;  2ZJR S;  4U67 S;  5GAH W;  3DLL S;  3PIO S;  3PIP S;  4JYZ A;  5HL7 S;  1EUY A;  5DM7 S;  4JXX A;  1QRS A;  5GAG W;  2HZ7 A;  4WCE S;  4IO9 S;  1O0C A;  5DM6 S;  2ZJP S;  4WFN S;  1B75 A;  5GAD W; 
#chains in the Genus database with same CATH topology
 4WFB S;  4GZY A;  3S14 C;  1Z85 A;  4WFA S;  1ZJW A;  4BY1 C;  1YNN A;  1O0B A;  1HQM A;  2G5D A;  3CQZ C;  2KXY A;  1NXZ A;  4XLN A;  2NVX C;  3HOX C;  4E8B A;  4A3C C;  1GTS A;  4JXZ A;  4A3G C;  1I50 C;  3DXJ A;  3GTO C;  3HOV C;  5IZN A;  2RD2 A;  3WOD A;  3GTK C;  1K83 C;  5GAH W;  5IYC C;  4A3B C;  3PIO S;  4JYZ A;  1EUY A;  4KN7 A;  5IYB C;  1UDX A;  2B63 C;  5C4X C;  2NWA A;  2A6H A;  5GAG W;  2HZ7 A;  4WCE S;  1SMY A;  4MQ9 A;  4C3H C;  5IP7 C;  1O0C A;  1TWG C;  4MEY A;  4A3M C;  5DM6 S;  3RZO C;  2JA8 C;  4G7Z A;  2O5J A;  5GAE W;  4KN4 A;  3GTJ C;  3KW2 A;  4A3D C;  2A69 A;  3J7Z V;  4LK1 A;  1TWC C;  5JVH S;  3H3V D;  4WF9 S;  4YG2 A;  4AYB D;  4OIN A;  4A3E C;  4Q5S A;  1IW7 A;  4C3J C;  3W2V B;  3EQL A;  4Y52 C;  2ZJQ S;  3AII A;  1R9T C;  4X6A C;  4Q4Z A;  4YFN A;  3W2W B;  1GTR A;  3S1N C;  3CZB A;  3S2D C;  2PJJ A;  3HOY C;  2PMZ D;  1QTQ A;  4LK0 A;  1SFO C;  3S15 C;  1TWA C;  3GTM C;  1V6Z A;  4A3J C;  4H4K A;  2YU9 C;  1I6H C;  4U67 S;  3H0G C;  4YFK A;  3RZD C;  2KPU A;  3HKZ D;  5IYD C;  5HL7 S;  4Y7N C;  2NVY C;  4JXX A;  2WAQ D;  1I3Q C;  4KMU A;  2A68 A;  4G7O A;  1YNJ A;  3PO3 C;  2GAE A;  3HOZ C;  4BY7 C;  2L3U A;  3FKI C;  5C3E C;  3S1R C;  2E2J C;  4J3C A;  5HQH A;  4OIO A;  5D4D A;  4C3I C;  4BBR C;  5BNZ A;  4UY8 8;  4V19 4;  2O5I A;  3GTP C;  2E2H C;  1NYL A;  3GTQ C;  4IOC S;  4LJZ A;  4BBS C;  4QJV A;  2RE8 A;  1EUQ A;  4P2B A;  1I6V A;  1TWH C;  4G7H A;  4OIQ A;  2JA7 C;  4XSX A;  2PIC A;  4XSZ A;  1EXD A;  4OIR A;  4H3S A;  2PI8 A;  2R92 C;  1QRU A;  3M3Y C;  3S17 C;  2EGV A;  2CX8 A;  5TMC A;  2L5N A;  2JA6 C;  1D6K A;  2A6E A;  5FLM C;  5C4J C;  2AE0 X;  2PPB A;  4QIW D;  3S2H C;  3X1L B;  4A3L C;  2E2I C;  3PIP S;  2JA5 C;  1Y1W C;  4A3K C;  1QRS A;  4IO9 S;  4BXX C;  2WB1 D;  4MEX A;  3M4O C;  2PNW A;  2KQ1 A;  1VHK A;  2NVT C;  4IOA S;  1ZYR A;  3CF5 S;  1QRT A;  1FEU A;  3K7A C;  3HOU C;  2BE5 A;  1Y1V C;  3GTL C;  2R7Z C;  3I4M C;  2Y0S D;  5IP9 C;  4XLP A;  3LYW A;  2PA8 D;  3I4N C;  4OIP A;  4NOI A;  1BDF A;  3GTG C;  2VUM C;  5JVG S;  5C44 C;  4C2M C;  1WCM C;  4ZH4 A;  1DFU P;  2Z0Y A;  4YFX A;  3S1M C;  3PO2 C;  4A3F C;  2ZJR S;  2EGW A;  4A3I C;  3S1Q C;  4JK1 A;  3DLL S;  3HOW C;  2G6G A;  5DM7 S;  4A93 C;  3S16 C;  2NVQ C;  5TMF A;  1VHY A;  4L69 A;  1TWF C;  4LLG A;  2CW0 A;  2R93 C;  2ZJP S;  4WFN S;  1B75 A;  5GAD W; 
#chains in the Genus database with same CATH homology
 4WFB S;  5GAE W;  3J7Z V;  4IOA S;  5BNZ A;  3CF5 S;  1QRT A;  4UY8 8;  4V19 4;  5JVH S;  1FEU A;  1NYL A;  4WFA S;  4WF9 S;  4IOC S;  1ZJW A;  3W2V B;  2RE8 A;  4P2B A;  2ZJQ S;  3AII A;  1O0B A;  1EUQ A;  3W2W B;  1EXD A;  1GTR A;  4H3S A;  1QRU A;  5JVG S;  1QTQ A;  1GTS A;  1D6K A;  4JXZ A;  5IZN A;  1DFU P;  2RD2 A;  4H4K A;  3X1L B;  2ZJR S;  4U67 S;  5GAH W;  3DLL S;  3PIO S;  3PIP S;  4JYZ A;  5HL7 S;  1EUY A;  5DM7 S;  1UDX A;  4JXX A;  1QRS A;  5GAG W;  2HZ7 A;  4WCE S;  4IO9 S;  1O0C A;  5DM6 S;  2ZJP S;  4WFN S;  1B75 A;  5GAD W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...