3CF5S

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3cf5S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 3cf5S02
4WFNS 4U67S 2HZ7A 4P2BA 1B75A 2ZJQS 4WCES 1EUYA 1QRUA 1GTSA 5JVGS 3J7ZV 4WFBS 1NYLA 1O0CA 5DM7S 1GTRA 3AIIA 5GADW 1EXDA 4WFAS 5IZNA 2RD2A 5GAHW 5GAGW 1O0BA 1QRTA 5HL7S 4H3SA 2ZJPS 1QRSA 4IOAS 3PIPS 1D6KA 2ZJRS 2RE8A 3PIOS 1ZJWA 4JXXA 1QTQA 4JYZA 3CF5S 1DFUP 5JVHS 5DM6S 3DLLS 1EUQA 4JXZA 1FEUA 4IO9S 5BNZA 4WF9S 4IOCS 4UY88 5GAEW
chains in the Genus database with same CATH superfamily
1BDFA 3S1RC 4A93C 4JK1A 4U67S 2HZ7A 2PA8D 2WB1D 1NXZA 3X1LB 2JA5C 4C3JC 2O5IA 5FLMC 1R9TC 4OIPA 3DXJA 1SFOC 1V6ZA 4LLGA 5GAGW 4Q4ZA 1SMYA 5HL7S 1QRSA 2KQ1A 5IP9C 2JA7C 1I50C 3W2WB 1ZJWA 4JXXA 4C2MC 4YG2A 4XSZA 4G7ZA 1YNNA 4YFNA 4QJVA 3HOXC 4OIQA 2NVQC 3DLLS 5IP7C 4A3FC 4JXZA 2NVTC 3HOWC 4G7OA 1I6HC 4IO9S 4LJZA 4WF9S 4IOCS 4UY88 1K83C 5GAEW 5IYBC 3HKZD 4WFNS 2NVYC 4Y7NC 2L3UA 4OINA 3EQLA 3PO2C 2PICA 4P2BA 1TWAC 2E2HC 4LK0A 2ZJQS 1QRUA 5TMFA 5C4JC 2NVXC 2KXYA 5JVGS 3H0GC 4MEYA 4WFBS 4E8BA 3LYWA 3GTKC 3GTMC 4A3BC 2A6HA 1VHYA 1O0CA 3W2VB 2CX8A 1GTRA 1ZYRA 4YFXA 5TMCA 3HOZC 3AIIA 3I4NC 4BXXC 2PJJA 1TWCC 5C44C 1TWGC 2GAEA 3S1MC 4Q5SA 4KN4A 4H4KA 5IYDC 4AYBD 3S16C 4X6AC 4XLPA 1IW7A 3S1NC 1Y1VC 1D6KA 2JA8C 4YFKA 3PO3C 3RZOC 3GTQC 1DFUP 1YNJA 2A69A 5JVHS 4A3GC 1HQMA 2R93C 2KPUA 4C3HC 1EUQA 3KW2A 5IYCC 4A3JC 4A3LC 3K7AC 5BNZA 1WCMC 2AE0X 4H3SA 2BE5A 2PMZD 3S14C 2CW0A 4Y52C 4A3CC 4BBSC 1Z85A 4A3MC 2Z0YA 5D4DA 1B75A 3S2HC 4WCES 1GTSA 5HQHA 4C3IC 3RZDC 1NYLA 4KMUA 2A6EA 2JA6C 5GADW 1EXDA 4L69A 5IZNA 2R92C 2EGWA 5GAHW 1QRTA 2E2IC 3I4MC 4A3EC 2VUMC 3PIPS 2PPBA 2RE8A 4NOIA 4G7HA 3HOYC 3CZBA 1I3QC 3H3VD 1VHKA 4MQ9A 1FEUA 4OIRA 2Y0SD 3GTPC 3GTGC 4BBRC 3WODA 3S17C 2L5NA 4A3KC 1TWFC 4QIWD 4XSXA 2R7ZC 4OIOA 3GTOC 4XLNA 5C3EC 1EUYA 3GTJC 4BY7C 4GZYA 3FKIC 3J7ZV 1UDXA 4ZH4A 2YU9C 4BY1C 4A3DC 4A3IC 5DM7S 1TWHC 2G6GA 1Y1WC 4J3CA 4MEXA 3S1QC 3CQZC 3S2DC 2PI8A 4WFAS 2PNWA 2RD2A 1O0BA 3GTLC 3M3YC 2ZJPS 3S15C 4IOAS 2B63C 3HOUC 2ZJRS 2E2JC 3PIOS 1QTQA 4KN7A 3CF5S 5C4XC 5DM6S 4LK1A 2EGVA 4V194 2WAQD 3HOVC 2NWAA 2G5DA 1I6VA 4JYZA 2O5JA 3M4OC 2A68A
chains in the Genus database with same CATH topology
4WFNS 4U67S 2HZ7A 4P2BA 1B75A 2ZJQS 4WCES 1EUYA 1QRUA 3X1LB 1GTSA 5JVGS 3J7ZV 1UDXA 4WFBS 1NYLA 1O0CA 3W2VB 5DM7S 1GTRA 3AIIA 5GADW 1EXDA 5IZNA 4WFAS 2RD2A 5GAHW 5GAGW 1O0BA 1QRTA 4H4KA 5HL7S 4H3SA 2ZJPS 1QRSA 4IOAS 3PIPS 1D6KA 2ZJRS 2RE8A 3W2WB 3PIOS 4JXXA 1ZJWA 1QTQA 4JYZA 3CF5S 1DFUP 5JVHS 5DM6S 3DLLS 4V194 1EUQA 4JXZA 1FEUA 4IO9S 5BNZA 4WF9S 4IOCS 4UY88 5GAEW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFN S;  4U67 S;  2HZ7 A;  4P2B A;  1B75 A;  2ZJQ S;  4WCE S;  1EUY A;  1QRU A;  1GTS A;  5JVG S;  3J7Z V;  4WFB S;  1NYL A;  1O0C A;  5DM7 S;  1GTR A;  3AII A;  5GAD W;  1EXD A;  4WFA S;  5IZN A;  2RD2 A;  5GAH W;  5GAG W;  1O0B A;  1QRT A;  5HL7 S;  4H3S A;  2ZJP S;  1QRS A;  4IOA S;  3PIP S;  1D6K A;  2ZJR S;  2RE8 A;  3PIO S;  1ZJW A;  4JXX A;  1QTQ A;  4JYZ A;  3CF5 S;  1DFU P;  5JVH S;  5DM6 S;  3DLL S;  1EUQ A;  4JXZ A;  1FEU A;  4IO9 S;  5BNZ A;  4WF9 S;  4IOC S;  4UY8 8;  5GAE W; 
#chains in the Genus database with same CATH topology
 1BDF A;  3S1R C;  4A93 C;  4JK1 A;  4U67 S;  2HZ7 A;  2PA8 D;  2WB1 D;  1NXZ A;  3X1L B;  2JA5 C;  4C3J C;  2O5I A;  5FLM C;  1R9T C;  4OIP A;  3DXJ A;  1SFO C;  1V6Z A;  4LLG A;  5GAG W;  4Q4Z A;  1SMY A;  5HL7 S;  1QRS A;  2KQ1 A;  5IP9 C;  2JA7 C;  1I50 C;  3W2W B;  1ZJW A;  4JXX A;  4C2M C;  4YG2 A;  4XSZ A;  4G7Z A;  1YNN A;  4YFN A;  4QJV A;  3HOX C;  4OIQ A;  2NVQ C;  3DLL S;  5IP7 C;  4A3F C;  4JXZ A;  2NVT C;  3HOW C;  4G7O A;  1I6H C;  4IO9 S;  4LJZ A;  4WF9 S;  4IOC S;  4UY8 8;  1K83 C;  5GAE W;  5IYB C;  3HKZ D;  4WFN S;  2NVY C;  4Y7N C;  2L3U A;  4OIN A;  3EQL A;  3PO2 C;  2PIC A;  4P2B A;  1TWA C;  2E2H C;  4LK0 A;  2ZJQ S;  1QRU A;  5TMF A;  5C4J C;  2NVX C;  2KXY A;  5JVG S;  3H0G C;  4MEY A;  4WFB S;  4E8B A;  3LYW A;  3GTK C;  3GTM C;  4A3B C;  2A6H A;  1VHY A;  1O0C A;  3W2V B;  2CX8 A;  1GTR A;  1ZYR A;  4YFX A;  5TMC A;  3HOZ C;  3AII A;  3I4N C;  4BXX C;  2PJJ A;  1TWC C;  5C44 C;  1TWG C;  2GAE A;  3S1M C;  4Q5S A;  4KN4 A;  4H4K A;  5IYD C;  4AYB D;  3S16 C;  4X6A C;  4XLP A;  1IW7 A;  3S1N C;  1Y1V C;  1D6K A;  2JA8 C;  4YFK A;  3PO3 C;  3RZO C;  3GTQ C;  1DFU P;  1YNJ A;  2A69 A;  5JVH S;  4A3G C;  1HQM A;  2R93 C;  2KPU A;  4C3H C;  1EUQ A;  3KW2 A;  5IYC C;  4A3J C;  4A3L C;  3K7A C;  5BNZ A;  1WCM C;  2AE0 X;  4H3S A;  2BE5 A;  2PMZ D;  3S14 C;  2CW0 A;  4Y52 C;  4A3C C;  4BBS C;  1Z85 A;  4A3M C;  2Z0Y A;  5D4D A;  1B75 A;  3S2H C;  4WCE S;  1GTS A;  5HQH A;  4C3I C;  3RZD C;  1NYL A;  4KMU A;  2A6E A;  2JA6 C;  5GAD W;  1EXD A;  4L69 A;  5IZN A;  2R92 C;  2EGW A;  5GAH W;  1QRT A;  2E2I C;  3I4M C;  4A3E C;  2VUM C;  3PIP S;  2PPB A;  2RE8 A;  4NOI A;  4G7H A;  3HOY C;  3CZB A;  1I3Q C;  3H3V D;  1VHK A;  4MQ9 A;  1FEU A;  4OIR A;  2Y0S D;  3GTP C;  3GTG C;  4BBR C;  3WOD A;  3S17 C;  2L5N A;  4A3K C;  1TWF C;  4QIW D;  4XSX A;  2R7Z C;  4OIO A;  3GTO C;  4XLN A;  5C3E C;  1EUY A;  3GTJ C;  4BY7 C;  4GZY A;  3FKI C;  3J7Z V;  1UDX A;  4ZH4 A;  2YU9 C;  4BY1 C;  4A3D C;  4A3I C;  5DM7 S;  1TWH C;  2G6G A;  1Y1W C;  4J3C A;  4MEX A;  3S1Q C;  3CQZ C;  3S2D C;  2PI8 A;  4WFA S;  2PNW A;  2RD2 A;  1O0B A;  3GTL C;  3M3Y C;  2ZJP S;  3S15 C;  4IOA S;  2B63 C;  3HOU C;  2ZJR S;  2E2J C;  3PIO S;  1QTQ A;  4KN7 A;  3CF5 S;  5C4X C;  5DM6 S;  4LK1 A;  2EGV A;  4V19 4;  2WAQ D;  3HOV C;  2NWA A;  2G5D A;  1I6V A;  4JYZ A;  2O5J A;  3M4O C;  2A68 A; 
#chains in the Genus database with same CATH homology
 4WFN S;  4U67 S;  2HZ7 A;  4P2B A;  1B75 A;  2ZJQ S;  4WCE S;  1EUY A;  1QRU A;  3X1L B;  1GTS A;  5JVG S;  3J7Z V;  1UDX A;  4WFB S;  1NYL A;  1O0C A;  3W2V B;  5DM7 S;  1GTR A;  3AII A;  5GAD W;  1EXD A;  5IZN A;  4WFA S;  2RD2 A;  5GAH W;  5GAG W;  1O0B A;  1QRT A;  4H4K A;  5HL7 S;  4H3S A;  2ZJP S;  1QRS A;  4IOA S;  3PIP S;  1D6K A;  2ZJR S;  2RE8 A;  3W2W B;  3PIO S;  4JXX A;  1ZJW A;  1QTQ A;  4JYZ A;  3CF5 S;  1DFU P;  5JVH S;  5DM6 S;  3DLL S;  4V19 4;  1EUQ A;  4JXZ A;  1FEU A;  4IO9 S;  5BNZ A;  4WF9 S;  4IOC S;  4UY8 8;  5GAE W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...