3PIOS

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3pioS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 3pioS02
4WCES 5JVHS 4IO9S 1EUYA 3CF5S 1QRUA 1NYLA 5JVGS 5GADW 3J7ZV 1EXDA 4WFBS 1QRSA 4JYZA 4WFNS 1DFUP 1QTQA 4IOAS 5DM7S 1O0BA 2HZ7A 1O0CA 4JXXA 5GAGW 4JXZA 2RD2A 4U67S 5IZNA 2ZJRS 1FEUA 1B75A 5HL7S 2RE8A 1EUQA 5GAHW 4H3SA 4IOCS 4P2BA 5GAEW 3PIOS 3PIPS 5DM6S 2ZJQS 4WF9S 4WFAS 3DLLS 1D6KA 1QRTA 4UY88 3AIIA 1GTSA 2ZJPS 1GTRA 1ZJWA 5BNZA
chains in the Genus database with same CATH superfamily
4WCES 5JVHS 1TWGC 1TWFC 3CF5S 1NYLA 3HOVC 2L3UA 4J3CA 3GTOC 2GAEA 5JVGS 4XLPA 2KQ1A 3H0GC 3CZBA 3CQZC 5C4JC 3GTGC 3S1QC 3S2DC 4WFNS 1DFUP 1QTQA 4IOAS 2YU9C 4A3KC 4Q4ZA 1V6ZA 4A3CC 2NVTC 1ZYRA 4G7HA 3FKIC 4C3HC 4A93C 5HL7S 2E2HC 2JA6C 3S14C 4E8BA 2NVYC 4Q5SA 2PA8D 4H3SA 4IOCS 1K83C 4GZYA 5DM6S 4YG2A 4WFAS 2PPBA 4OIQA 4G7OA 1VHKA 5D4DA 2E2IC 3HOXC 2WAQD 4MEXA 2ZJPS 1I6HC 4YFNA 1ZJWA 4KN7A 4YFKA 2AE0X 4A3DC 5IYBC 2KXYA 3KW2A 1EUYA 2Y0SD 4KMUA 3GTMC 1YNJA 3GTPC 2R93C 4MQ9A 4X6AC 3I4MC 4BY1C 1QRSA 3J7ZV 4H4KA 4JYZA 1TWCC 4G7ZA 3HOZC 4OINA 4C3IC 4JXXA 1VHYA 2PJJA 2EGWA 4JXZA 5FLMC 2RD2A 1WCMC 4BBSC 2A6EA 1FEUA 2PI8A 2A6HA 1SFOC 4YFXA 5GAHW 3W2WB 4OIOA 2VUMC 3PO3C 4P2BA 3HOUC 3DXJA 5IP9C 2JA7C 3WODA 2NVXC 2L5NA 4QIWD 4UY88 1SMYA 1TWAC 3AIIA 4BBRC 4A3BC 2BE5A 2G5DA 4QJVA 2R7ZC 1GTRA 2R92C 1IW7A 4IO9S 1NXZA 2O5IA 4Y7NC 4BXXC 3HKZD 3K7AC 3GTJC 4Y52C 2JA8C 3S1RC 3X1LB 4KN4A 5GADW 4WFBS 1TWHC 4V194 1I50C 4LJZA 4A3JC 3S15C 3GTKC 1HQMA 5C4XC 3S16C 1I3QC 3RZDC 1O0BA 2HZ7A 1O0CA 4XSZA 5GAGW 3W2VB 2A68A 5TMCA 3HOYC 2ZJRS 2WB1D 4A3FC 1R9TC 1UDXA 3M3YC 2EGVA 4A3MC 5GAEW 3PIOS 2ZJQS 4OIRA 2PMZD 1QRTA 4ZH4A 5TMFA 3S1NC 2CW0A 2NWAA 3H3VD 5IYCC 2CX8A 1GTSA 3HOWC 2PICA 4JK1A 5IYDC 2JA5C 2A69A 3EQLA 4NOIA 1QRUA 4LLGA 2NVQC 1Y1VC 1EXDA 5C44C 3GTQC 3RZOC 3I4NC 2E2JC 3PO2C 3S2HC 5DM7S 4L69A 2B63C 4C2MC 1Y1WC 1Z85A 4U67S 3GTLC 4MEYA 5IZNA 5IP7C 4OIPA 1B75A 3M4OC 2RE8A 4C3JC 4XLNA 4AYBD 4LK0A 1EUQA 5HQHA 4A3GC 1YNNA 2O5JA 3S17C 3PIPS 4LK1A 4A3IC 4WF9S 4A3EC 3S1MC 3DLLS 1D6KA 5C3EC 2Z0YA 1BDFA 2G6GA 3LYWA 2KPUA 2PNWA 4A3LC 4XSXA 4BY7C 1I6VA 5BNZA
chains in the Genus database with same CATH topology
4WCES 5JVHS 4IO9S 1EUYA 3CF5S 1QRUA 1NYLA 3X1LB 5JVGS 5GADW 3J7ZV 4H4KA 4WFBS 1EXDA 4JYZA 1QRSA 4V194 4WFNS 1DFUP 1QTQA 4IOAS 5DM7S 1O0BA 2HZ7A 1O0CA 4JXXA 5GAGW 4JXZA 3W2VB 2RD2A 4U67S 5IZNA 2ZJRS 1FEUA 1B75A 5HL7S 2RE8A 1UDXA 1EUQA 5GAHW 3W2WB 4H3SA 4IOCS 4P2BA 5GAEW 3PIOS 3PIPS 5DM6S 2ZJQS 4WF9S 4WFAS 3DLLS 1D6KA 1QRTA 4UY88 3AIIA 1GTSA 2ZJPS 1GTRA 1ZJWA 5BNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE S;  5JVH S;  4IO9 S;  1EUY A;  3CF5 S;  1QRU A;  1NYL A;  5JVG S;  5GAD W;  3J7Z V;  1EXD A;  4WFB S;  1QRS A;  4JYZ A;  4WFN S;  1DFU P;  1QTQ A;  4IOA S;  5DM7 S;  1O0B A;  2HZ7 A;  1O0C A;  4JXX A;  5GAG W;  4JXZ A;  2RD2 A;  4U67 S;  5IZN A;  2ZJR S;  1FEU A;  1B75 A;  5HL7 S;  2RE8 A;  1EUQ A;  5GAH W;  4H3S A;  4IOC S;  4P2B A;  5GAE W;  3PIO S;  3PIP S;  5DM6 S;  2ZJQ S;  4WF9 S;  4WFA S;  3DLL S;  1D6K A;  1QRT A;  4UY8 8;  3AII A;  1GTS A;  2ZJP S;  1GTR A;  1ZJW A;  5BNZ A; 
#chains in the Genus database with same CATH topology
 4WCE S;  5JVH S;  1TWG C;  1TWF C;  3CF5 S;  1NYL A;  3HOV C;  2L3U A;  4J3C A;  3GTO C;  2GAE A;  5JVG S;  4XLP A;  2KQ1 A;  3H0G C;  3CZB A;  3CQZ C;  5C4J C;  3GTG C;  3S1Q C;  3S2D C;  4WFN S;  1DFU P;  1QTQ A;  4IOA S;  2YU9 C;  4A3K C;  4Q4Z A;  1V6Z A;  4A3C C;  2NVT C;  1ZYR A;  4G7H A;  3FKI C;  4C3H C;  4A93 C;  5HL7 S;  2E2H C;  2JA6 C;  3S14 C;  4E8B A;  2NVY C;  4Q5S A;  2PA8 D;  4H3S A;  4IOC S;  1K83 C;  4GZY A;  5DM6 S;  4YG2 A;  4WFA S;  2PPB A;  4OIQ A;  4G7O A;  1VHK A;  5D4D A;  2E2I C;  3HOX C;  2WAQ D;  4MEX A;  2ZJP S;  1I6H C;  4YFN A;  1ZJW A;  4KN7 A;  4YFK A;  2AE0 X;  4A3D C;  5IYB C;  2KXY A;  3KW2 A;  1EUY A;  2Y0S D;  4KMU A;  3GTM C;  1YNJ A;  3GTP C;  2R93 C;  4MQ9 A;  4X6A C;  3I4M C;  4BY1 C;  1QRS A;  3J7Z V;  4H4K A;  4JYZ A;  1TWC C;  4G7Z A;  3HOZ C;  4OIN A;  4C3I C;  4JXX A;  1VHY A;  2PJJ A;  2EGW A;  4JXZ A;  5FLM C;  2RD2 A;  1WCM C;  4BBS C;  2A6E A;  1FEU A;  2PI8 A;  2A6H A;  1SFO C;  4YFX A;  5GAH W;  3W2W B;  4OIO A;  2VUM C;  3PO3 C;  4P2B A;  3HOU C;  3DXJ A;  5IP9 C;  2JA7 C;  3WOD A;  2NVX C;  2L5N A;  4QIW D;  4UY8 8;  1SMY A;  1TWA C;  3AII A;  4BBR C;  4A3B C;  2BE5 A;  2G5D A;  4QJV A;  2R7Z C;  1GTR A;  2R92 C;  1IW7 A;  4IO9 S;  1NXZ A;  2O5I A;  4Y7N C;  4BXX C;  3HKZ D;  3K7A C;  3GTJ C;  4Y52 C;  2JA8 C;  3S1R C;  3X1L B;  4KN4 A;  5GAD W;  4WFB S;  1TWH C;  4V19 4;  1I50 C;  4LJZ A;  4A3J C;  3S15 C;  3GTK C;  1HQM A;  5C4X C;  3S16 C;  1I3Q C;  3RZD C;  1O0B A;  2HZ7 A;  1O0C A;  4XSZ A;  5GAG W;  3W2V B;  2A68 A;  5TMC A;  3HOY C;  2ZJR S;  2WB1 D;  4A3F C;  1R9T C;  1UDX A;  3M3Y C;  2EGV A;  4A3M C;  5GAE W;  3PIO S;  2ZJQ S;  4OIR A;  2PMZ D;  1QRT A;  4ZH4 A;  5TMF A;  3S1N C;  2CW0 A;  2NWA A;  3H3V D;  5IYC C;  2CX8 A;  1GTS A;  3HOW C;  2PIC A;  4JK1 A;  5IYD C;  2JA5 C;  2A69 A;  3EQL A;  4NOI A;  1QRU A;  4LLG A;  2NVQ C;  1Y1V C;  1EXD A;  5C44 C;  3GTQ C;  3RZO C;  3I4N C;  2E2J C;  3PO2 C;  3S2H C;  5DM7 S;  4L69 A;  2B63 C;  4C2M C;  1Y1W C;  1Z85 A;  4U67 S;  3GTL C;  4MEY A;  5IZN A;  5IP7 C;  4OIP A;  1B75 A;  3M4O C;  2RE8 A;  4C3J C;  4XLN A;  4AYB D;  4LK0 A;  1EUQ A;  5HQH A;  4A3G C;  1YNN A;  2O5J A;  3S17 C;  3PIP S;  4LK1 A;  4A3I C;  4WF9 S;  4A3E C;  3S1M C;  3DLL S;  1D6K A;  5C3E C;  2Z0Y A;  1BDF A;  2G6G A;  3LYW A;  2KPU A;  2PNW A;  4A3L C;  4XSX A;  4BY7 C;  1I6V A;  5BNZ A; 
#chains in the Genus database with same CATH homology
 4WCE S;  5JVH S;  4IO9 S;  1EUY A;  3CF5 S;  1QRU A;  1NYL A;  3X1L B;  5JVG S;  5GAD W;  3J7Z V;  4H4K A;  4WFB S;  1EXD A;  4JYZ A;  1QRS A;  4V19 4;  4WFN S;  1DFU P;  1QTQ A;  4IOA S;  5DM7 S;  1O0B A;  2HZ7 A;  1O0C A;  4JXX A;  5GAG W;  4JXZ A;  3W2V B;  2RD2 A;  4U67 S;  5IZN A;  2ZJR S;  1FEU A;  1B75 A;  5HL7 S;  2RE8 A;  1UDX A;  1EUQ A;  5GAH W;  3W2W B;  4H3S A;  4IOC S;  4P2B A;  5GAE W;  3PIO S;  3PIP S;  5DM6 S;  2ZJQ S;  4WF9 S;  4WFA S;  3DLL S;  1D6K A;  1QRT A;  4UY8 8;  3AII A;  1GTS A;  2ZJP S;  1GTR A;  1ZJW A;  5BNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...