2PJJA

E. coli lytic transglycosylase mlta-d308a in apo-1 form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pjjA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pjjA02
3M3GA 4AVRA 2BH0A 3X2IA 3X2NA 3X2MA 3SUKA 4FG4A 1BW3A 2AE0X 4FG2A 5H4UA 3SULA 4JS7A 1BW4A 1L8FA 1WC2A 4FFTA 3SUJA 2ENGA 4ENGA 4L48A 2KQAA 1OA9A 3X2JA 3D30A 5GM9A 4JJOA 4JCWA 1N10A 3X2GA 2PICA 3CZBA 2G5DA 2PNWA 2PI8A 4ZM7A 2HCZX 1HD5A 3X2PA 1OA7A 3X2LA 2G6GA 5GLXA 5GLYA 4FERA 3SUMA 4JP6A 3X2KA 3X2HA 4JP7A 3X2OA 2PJJA 3ENGA 2GAEA
chains in the Genus database with same CATH superfamily
2R7ZA 4IOAS 5GAGW 4AOKB 3HU3A 1AA6A 4KODA 2WB1A 3X2IA 1R27A 3X2MA 3GTLA 1UDXA 2A68D 1TMOA 1VHKA 1QRTA 1ZJWA 5B6CA 2PJHB 1E32A 3GTMA 1BW3A 2ZJQS 2NVXA 1AW8B 2PMZA 4FG2A 3SULA 4DMRA 1PQEA 1L8FA 1Z85A 1EU1A 4CRYG 2JA6A 4E8BA 1R7RA 3QC8A 5BNZA 2NVYA 4UY88 5C1BA 4IO9S 1D6KA 1EUQA 2JIPA 1I3QA 2Z0YA 4L69A 2O5JD 4ZM7A 1KQGA 2V45A 5HL7S 1HD5A 1SMYD 4JXZA 5GAHW 3H0GA 3X2LA 1WLFA 1YNJD 1ZC1A 2NAPA 5GLYA 4FERA 3X2KA 1TWAA 1TWHA 3IR5A 4JP6A 3X2HA 2E2IA 2JA5A 3KW2A 5GADW 3ENGA 2GAEA 2C45A 2VPWA 1NXZA 1TWGA 1VC3B 3IR7A 3PLXB 5DYIA 3J7ZV 2JIQA 4QIWA 1EXDA 3TIWA 5FTNA 4WF9S 1WCMA 3QWZA 4FG4A 2ZJPS 4KDIA 1DMSA 1O0CA 1Y4ZA 3QQ7A 1CZ4A 3ML1A 1GTSA 4KDLA 5GLFA 1SIWA 1WC2A 4FFTA 1Y1WA 1FEUA 4D7ZB 2KQAA 3X2JA 4JJOA 5FTKA 2A69D 3CQZA 1N10A 1QCSA 3GTOA 2RD2A 3GTGA 2G5DA 1R9TA 1B75A 4JYZA 2HCZX 1E18A 1E5VA 2V3VA 4KLNA 2JIRA 1YLEA 5T5ID 1FDOA 2IV2X 1PYUB 3SUMA 2YU9A 1NYLA 2A6HD 4JP7A 1S3SA 3FKIA 3CF5S 3M3GA 2R93A 1EUYA 2A6ED 3X1LB 1CR5A 5JVHS 1Q16A 3PIOS 2VPYA 3IR6A 1QDNA 4H3SA 1TWCA 5H4UA 4CRZA 5DM7S 5C18A 4V194 3GTKA 1KQFA 4GA6A 1SFOA 3SUJA 5EPPA 4AAYA 4ENGA 1V6ZA 2Y0SA 4L48A 2DMRA 2BE5D 4NOHA 5FTLA 3D30A 2E2HA 5GM9A 1PT0A 1UHDA 2E7ZA 4JCWA 4AZDA 4GA5A 1K83A 1CZ5A 2EGVA 3CZBA 1TWFA 2PNWA 2PI8A 4AYBA 4C2MA 4WCES 3DLLS 1GTRA 3GTJA 1OA7A 1PT1A 2CW0D 4JXXA 3AIIA 1QRUA 2VPZA 2VUMA 2G6GA 5GLXA 3QQ8A 2CX8A 3HU2A 5IZNA 4WFAS 1E60A 3OUGA 5FTMA 3X2OA 4AONB 3PIPS 3W2WB 2YUJA 1VHYA 3TM7B 2R92A 2B63A 2JIOA 5DYGA 4AVRA 1PPYA 3W2VB 5T5MD 4KO8A 2BH0A 4P2BA 2ZJRS 1QTQA 3X2NA 2RE8A 3SUKA 5GAEW 1PQFA 3DMRA 4WFNS 1UHEA 3GTQA 2AE0X 4CS0A 1DMRA 4RV0A 4JS7A 1BW4A 2EEOB 2JIMA 2HZ7A 1FDIA 2ENGA 1G8JA 1Y1VA 1DFUP 3HKZA 1OA9A 3O5AA 4U67S 1PQHA 3CF2A 1H5NA 1OGYA 1O0BA 1PYQA 4J3CA 1H0HA 3X2GA 2JA7A 2PICA 1I50A 4WFBS 1QRSA 3GTPA 4H4KA 2VPXA 2NWAA 3HU1A 2KI8A 5FTJA 1IW7D 4IOCS 2EGWA 2NYAA 5DM6S 5JVGS 1ZYRD 2PJJA 1Y5IA 2WAQA 3X2PA 1YNND 1E61A 1G8KA
chains in the Genus database with same CATH topology
2R7ZA 4AOKB 3HU3A 1AA6A 4KODA 3X2IA 3X2MA 1R27A 2WB1A 3GTLA 2A68D 1TMOA 5B6CA 2PJHB 1E32A 3GTMA 1BW3A 2NVXA 4FG2A 1AW8B 3SULA 2PMZA 4DMRA 1PQEA 1L8FA 1EU1A 4CRYG 2JA6A 1R7RA 3QC8A 2NVYA 5C1BA 2JIPA 1I3QA 2O5JD 4ZM7A 1KQGA 2V45A 1HD5A 1SMYD 3H0GA 3X2LA 1WLFA 1YNJD 5GLYA 1ZC1A 2NAPA 4FERA 3X2KA 4JP6A 3X2HA 1TWAA 1TWHA 3IR5A 2E2IA 2JA5A 3ENGA 2GAEA 2C45A 2VPWA 1TWGA 1VC3B 3IR7A 3PLXB 5DYIA 2JIQA 4QIWA 3TIWA 5FTNA 1WCMA 3QWZA 4FG4A 4KDIA 1DMSA 1Y4ZA 3QQ7A 1CZ4A 3ML1A 4KDLA 5GLFA 1SIWA 1WC2A 4FFTA 1Y1WA 4D7ZB 2KQAA 3X2JA 4JJOA 5FTKA 2A69D 3CQZA 1N10A 1QCSA 3GTOA 3GTGA 2G5DA 1R9TA 2HCZX 1E18A 1E5VA 2V3VA 4KLNA 2JIRA 1YLEA 5T5ID 1FDOA 2IV2X 1PYUB 3SUMA 2YU9A 2A6HD 4JP7A 1S3SA 3FKIA 3M3GA 2R93A 2A6ED 1CR5A 1Q16A 2VPYA 3IR6A 1QDNA 1TWCA 5H4UA 4CRZA 5C18A 3GTKA 1KQFA 4GA6A 1SFOA 3SUJA 5EPPA 4AAYA 4ENGA 4L48A 2Y0SA 2DMRA 2BE5D 4NOHA 5FTLA 3D30A 2E2HA 5GM9A 1PT0A 1UHDA 2E7ZA 4JCWA 4AZDA 4GA5A 1K83A 1CZ5A 3CZBA 1TWFA 2PNWA 2PI8A 4AYBA 4C2MA 3GTJA 1OA7A 1PT1A 2CW0D 2VPZA 2VUMA 2G6GA 5GLXA 3QQ8A 3HU2A 1E60A 3OUGA 3X2OA 5FTMA 4AONB 2YUJA 3TM7B 2R92A 2B63A 2JIOA 4AVRA 5DYGA 1PPYA 5T5MD 4KO8A 2BH0A 3X2NA 3SUKA 1PQFA 3DMRA 1UHEA 3GTQA 2AE0X 4CS0A 1DMRA 4RV0A 4JS7A 1BW4A 2EEOB 2JIMA 1FDIA 2ENGA 1G8JA 1Y1VA 3HKZA 1OA9A 3O5AA 1PQHA 3CF2A 1H5NA 1OGYA 1PYQA 1H0HA 3X2GA 2JA7A 2PICA 1I50A 3GTPA 2VPXA 3HU1A 2KI8A 5FTJA 1IW7D 2NYAA 1ZYRD 2PJJA 1Y5IA 2WAQA 3X2PA 1YNND 1E61A 1G8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3G A;  4AVR A;  2BH0 A;  3X2I A;  3X2N A;  3X2M A;  3SUK A;  4FG4 A;  1BW3 A;  2AE0 X;  4FG2 A;  5H4U A;  3SUL A;  4JS7 A;  1BW4 A;  1L8F A;  1WC2 A;  4FFT A;  3SUJ A;  2ENG A;  4ENG A;  4L48 A;  2KQA A;  1OA9 A;  3X2J A;  3D30 A;  5GM9 A;  4JJO A;  4JCW A;  1N10 A;  3X2G A;  2PIC A;  3CZB A;  2G5D A;  2PNW A;  2PI8 A;  4ZM7 A;  2HCZ X;  1HD5 A;  3X2P A;  1OA7 A;  3X2L A;  2G6G A;  5GLX A;  5GLY A;  4FER A;  3SUM A;  4JP6 A;  3X2K A;  3X2H A;  4JP7 A;  3X2O A;  2PJJ A;  3ENG A;  2GAE A; 
#chains in the Genus database with same CATH topology
 2R7Z A;  4IOA S;  5GAG W;  4AOK B;  3HU3 A;  1AA6 A;  4KOD A;  2WB1 A;  3X2I A;  1R27 A;  3X2M A;  3GTL A;  1UDX A;  2A68 D;  1TMO A;  1VHK A;  1QRT A;  1ZJW A;  5B6C A;  2PJH B;  1E32 A;  3GTM A;  1BW3 A;  2ZJQ S;  2NVX A;  1AW8 B;  2PMZ A;  4FG2 A;  3SUL A;  4DMR A;  1PQE A;  1L8F A;  1Z85 A;  1EU1 A;  4CRY G;  2JA6 A;  4E8B A;  1R7R A;  3QC8 A;  5BNZ A;  2NVY A;  4UY8 8;  5C1B A;  4IO9 S;  1D6K A;  1EUQ A;  2JIP A;  1I3Q A;  2Z0Y A;  4L69 A;  2O5J D;  4ZM7 A;  1KQG A;  2V45 A;  5HL7 S;  1HD5 A;  1SMY D;  4JXZ A;  5GAH W;  3H0G A;  3X2L A;  1WLF A;  1YNJ D;  1ZC1 A;  2NAP A;  5GLY A;  4FER A;  3X2K A;  1TWA A;  1TWH A;  3IR5 A;  4JP6 A;  3X2H A;  2E2I A;  2JA5 A;  3KW2 A;  5GAD W;  3ENG A;  2GAE A;  2C45 A;  2VPW A;  1NXZ A;  1TWG A;  1VC3 B;  3IR7 A;  3PLX B;  5DYI A;  3J7Z V;  2JIQ A;  4QIW A;  1EXD A;  3TIW A;  5FTN A;  4WF9 S;  1WCM A;  3QWZ A;  4FG4 A;  2ZJP S;  4KDI A;  1DMS A;  1O0C A;  1Y4Z A;  3QQ7 A;  1CZ4 A;  3ML1 A;  1GTS A;  4KDL A;  5GLF A;  1SIW A;  1WC2 A;  4FFT A;  1Y1W A;  1FEU A;  4D7Z B;  2KQA A;  3X2J A;  4JJO A;  5FTK A;  2A69 D;  3CQZ A;  1N10 A;  1QCS A;  3GTO A;  2RD2 A;  3GTG A;  2G5D A;  1R9T A;  1B75 A;  4JYZ A;  2HCZ X;  1E18 A;  1E5V A;  2V3V A;  4KLN A;  2JIR A;  1YLE A;  5T5I D;  1FDO A;  2IV2 X;  1PYU B;  3SUM A;  2YU9 A;  1NYL A;  2A6H D;  4JP7 A;  1S3S A;  3FKI A;  3CF5 S;  3M3G A;  2R93 A;  1EUY A;  2A6E D;  3X1L B;  1CR5 A;  5JVH S;  1Q16 A;  3PIO S;  2VPY A;  3IR6 A;  1QDN A;  4H3S A;  1TWC A;  5H4U A;  4CRZ A;  5DM7 S;  5C18 A;  4V19 4;  3GTK A;  1KQF A;  4GA6 A;  1SFO A;  3SUJ A;  5EPP A;  4AAY A;  4ENG A;  1V6Z A;  2Y0S A;  4L48 A;  2DMR A;  2BE5 D;  4NOH A;  5FTL A;  3D30 A;  2E2H A;  5GM9 A;  1PT0 A;  1UHD A;  2E7Z A;  4JCW A;  4AZD A;  4GA5 A;  1K83 A;  1CZ5 A;  2EGV A;  3CZB A;  1TWF A;  2PNW A;  2PI8 A;  4AYB A;  4C2M A;  4WCE S;  3DLL S;  1GTR A;  3GTJ A;  1OA7 A;  1PT1 A;  2CW0 D;  4JXX A;  3AII A;  1QRU A;  2VPZ A;  2VUM A;  2G6G A;  5GLX A;  3QQ8 A;  2CX8 A;  3HU2 A;  5IZN A;  4WFA S;  1E60 A;  3OUG A;  5FTM A;  3X2O A;  4AON B;  3PIP S;  3W2W B;  2YUJ A;  1VHY A;  3TM7 B;  2R92 A;  2B63 A;  2JIO A;  5DYG A;  4AVR A;  1PPY A;  3W2V B;  5T5M D;  4KO8 A;  2BH0 A;  4P2B A;  2ZJR S;  1QTQ A;  3X2N A;  2RE8 A;  3SUK A;  5GAE W;  1PQF A;  3DMR A;  4WFN S;  1UHE A;  3GTQ A;  2AE0 X;  4CS0 A;  1DMR A;  4RV0 A;  4JS7 A;  1BW4 A;  2EEO B;  2JIM A;  2HZ7 A;  1FDI A;  2ENG A;  1G8J A;  1Y1V A;  1DFU P;  3HKZ A;  1OA9 A;  3O5A A;  4U67 S;  1PQH A;  3CF2 A;  1H5N A;  1OGY A;  1O0B A;  1PYQ A;  4J3C A;  1H0H A;  3X2G A;  2JA7 A;  2PIC A;  1I50 A;  4WFB S;  1QRS A;  3GTP A;  4H4K A;  2VPX A;  2NWA A;  3HU1 A;  2KI8 A;  5FTJ A;  1IW7 D;  4IOC S;  2EGW A;  2NYA A;  5DM6 S;  5JVG S;  1ZYR D;  2PJJ A;  1Y5I A;  2WAQ A;  3X2P A;  1YNN D;  1E61 A;  1G8K A; 
#chains in the Genus database with same CATH homology
 2R7Z A;  4AOK B;  3HU3 A;  1AA6 A;  4KOD A;  3X2I A;  3X2M A;  1R27 A;  2WB1 A;  3GTL A;  2A68 D;  1TMO A;  5B6C A;  2PJH B;  1E32 A;  3GTM A;  1BW3 A;  2NVX A;  4FG2 A;  1AW8 B;  3SUL A;  2PMZ A;  4DMR A;  1PQE A;  1L8F A;  1EU1 A;  4CRY G;  2JA6 A;  1R7R A;  3QC8 A;  2NVY A;  5C1B A;  2JIP A;  1I3Q A;  2O5J D;  4ZM7 A;  1KQG A;  2V45 A;  1HD5 A;  1SMY D;  3H0G A;  3X2L A;  1WLF A;  1YNJ D;  5GLY A;  1ZC1 A;  2NAP A;  4FER A;  3X2K A;  4JP6 A;  3X2H A;  1TWA A;  1TWH A;  3IR5 A;  2E2I A;  2JA5 A;  3ENG A;  2GAE A;  2C45 A;  2VPW A;  1TWG A;  1VC3 B;  3IR7 A;  3PLX B;  5DYI A;  2JIQ A;  4QIW A;  3TIW A;  5FTN A;  1WCM A;  3QWZ A;  4FG4 A;  4KDI A;  1DMS A;  1Y4Z A;  3QQ7 A;  1CZ4 A;  3ML1 A;  4KDL A;  5GLF A;  1SIW A;  1WC2 A;  4FFT A;  1Y1W A;  4D7Z B;  2KQA A;  3X2J A;  4JJO A;  5FTK A;  2A69 D;  3CQZ A;  1N10 A;  1QCS A;  3GTO A;  3GTG A;  2G5D A;  1R9T A;  2HCZ X;  1E18 A;  1E5V A;  2V3V A;  4KLN A;  2JIR A;  1YLE A;  5T5I D;  1FDO A;  2IV2 X;  1PYU B;  3SUM A;  2YU9 A;  2A6H D;  4JP7 A;  1S3S A;  3FKI A;  3M3G A;  2R93 A;  2A6E D;  1CR5 A;  1Q16 A;  2VPY A;  3IR6 A;  1QDN A;  1TWC A;  5H4U A;  4CRZ A;  5C18 A;  3GTK A;  1KQF A;  4GA6 A;  1SFO A;  3SUJ A;  5EPP A;  4AAY A;  4ENG A;  4L48 A;  2Y0S A;  2DMR A;  2BE5 D;  4NOH A;  5FTL A;  3D30 A;  2E2H A;  5GM9 A;  1PT0 A;  1UHD A;  2E7Z A;  4JCW A;  4AZD A;  4GA5 A;  1K83 A;  1CZ5 A;  3CZB A;  1TWF A;  2PNW A;  2PI8 A;  4AYB A;  4C2M A;  3GTJ A;  1OA7 A;  1PT1 A;  2CW0 D;  2VPZ A;  2VUM A;  2G6G A;  5GLX A;  3QQ8 A;  3HU2 A;  1E60 A;  3OUG A;  3X2O A;  5FTM A;  4AON B;  2YUJ A;  3TM7 B;  2R92 A;  2B63 A;  2JIO A;  4AVR A;  5DYG A;  1PPY A;  5T5M D;  4KO8 A;  2BH0 A;  3X2N A;  3SUK A;  1PQF A;  3DMR A;  1UHE A;  3GTQ A;  2AE0 X;  4CS0 A;  1DMR A;  4RV0 A;  4JS7 A;  1BW4 A;  2EEO B;  2JIM A;  1FDI A;  2ENG A;  1G8J A;  1Y1V A;  3HKZ A;  1OA9 A;  3O5A A;  1PQH A;  3CF2 A;  1H5N A;  1OGY A;  1PYQ A;  1H0H A;  3X2G A;  2JA7 A;  2PIC A;  1I50 A;  3GTP A;  2VPX A;  3HU1 A;  2KI8 A;  5FTJ A;  1IW7 D;  2NYA A;  1ZYR D;  2PJJ A;  1Y5I A;  2WAQ A;  3X2P A;  1YNN D;  1E61 A;  1G8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...