2PJJA

E. coli lytic transglycosylase mlta-d308a in apo-1 form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pjjA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pjjA02
1OA7A 4FG2A 4JCWA 3X2MA 4AVRA 4FERA 1BW3A 2AE0X 2PI8A 5GLYA 3X2NA 1HD5A 1L8FA 4JP7A 3CZBA 3SULA 3SUJA 3X2JA 4ZM7A 2HCZX 3SUKA 3SUMA 3ENGA 3X2GA 3X2LA 5GM9A 3D30A 1OA9A 5H4UA 3X2HA 2BH0A 2GAEA 4L48A 4FG4A 2KQAA 3X2OA 5GLXA 4JJOA 3X2KA 2G6GA 3M3GA 3X2IA 1WC2A 2PICA 3X2PA 2ENGA 4ENGA 2G5DA 2PJJA 2PNWA 1BW4A 4JS7A 1N10A 4FFTA 4JP6A
chains in the Genus database with same CATH superfamily
2NWAA 2EGWA 1OA7A 1PT1A 1E18A 3CF2A 4FG2A 1Y1VA 2YUJA 3H0GA 2IV2X 4AZDA 1EUQA 1FEUA 2PI8A 3X2NA 4H3SA 3X1LB 1GTRA 1HD5A 1L8FA 4JP7A 4L69A 3CQZA 1O0BA 1Y4ZA 4U67S 1QDNA 3HU2A 3SUKA 5GLFA 3QC8A 5FTNA 1CR5A 1OA9A 1YLEA 5H4UA 3X2HA 1Y1WA 4P2BA 4WCES 1PQEA 4UY88 4DMRA 1E60A 1SMYD 3QQ8A 2E7ZA 3HU3A 3HU1A 1CZ4A 2NVXA 2JA7A 5JVHS 3GTKA 2NYAA 4C2MA 4AAYA 1EU1A 1VC3B 5B6CA 1DFUP 1G8JA 3IR5A 5DYIA 3GTOA 2ENGA 4NOHA 3GTGA 3J7ZV 5FTJA 1AA6A 1QCSA 1QRUA 3X2OA 1G8KA 1NYLA 1CZ5A 5DYGA 1H5NA 5C18A 4KLNA 3X2MA 1O0CA 1I3QA 5C1BA 1BW3A 5GLYA 1AW8B 4AONB 2C45A 2R93A 2HZ7A 1E5VA 5GAHW 2B63A 3CF5S 1QRSA 3CZBA 3X2JA 1WLFA 3X2LA 1ZC1A 4RV0A 3ENGA 3SUMA 4AYBA 1E61A 1GTSA 5GM9A 4D7ZB 3DLLS 2ZJPS 1DMRA 2VPZA 1TWAA 2BH0A 3IR6A 1VHKA 2JIRA 1YNJD 3PIPS 4FG4A 3GTMA 5DM7S 1S3SA 3PIOS 2A6ED 4JXZA 1EXDA 3X2KA 2G6GA 2R92A 2A69D 1WC2A 1Q16A 1TWCA 4IOCS 3HKZA 3OUGA 2PICA 2A6HD 4ENGA 2DMRA 2G5DA 1EUYA 4IOAS 5T5MD 2PJJA 2PJHB 2EGVA 2PNWA 1BW4A 2KI8A 5DM6S 3TM7B 2ZJQS 4ZM7A 2JIQA 4JP6A 4KO8A 1PT0A 1OGYA 1WCMA 3DMRA 1K83A 4JCWA 4FERA 1R7RA 2AE0X 4KDLA 3GTPA 5T5ID 3SUJA 3SULA 2RE8A 1R9TA 2HCZX 1PQFA 1NXZA 5EPPA 1QTQA 3D30A 1ZJWA 1PPYA 1SIWA 2JIPA 1SFOA 2GAEA 4L48A 1E32A 2E2HA 5HL7S 4AOKB 1TWGA 1Y5IA 2JA5A 2CW0D 1TWHA 2BE5D 2NVYA 5GLXA 4JJOA 2V3VA 3O5AA 3M3GA 3X2IA 1V6ZA 4JXXA 1PQHA 2EEOB 4KODA 5FTKA 3X2PA 4CRYG 2JA6A 2E2IA 4GA5A 2WB1A 1ZYRD 2JIOA 3ML1A 4CRZA 2YU9A 5IZNA 2WAQA 1N10A 4FFTA 4JS7A 2VUMA 5GADW 1D6KA 3TIWA 1B75A 4E8BA 2JIMA 4AVRA 3FKIA 4QIWA 1VHYA 5FTMA 1Z85A 5GAGW 3IR7A 1YNND 2VPXA 4KDIA 1I50A 3GTJA 2CX8A 5JVGS 3X2GA 1TWFA 1TMOA 1KQFA 2PMZA 2O5JD 3W2WB 1UDXA 1QRTA 1R27A 3PLXB 2R7ZA 5FTLA 4WFNS 2KQAA 3GTLA 2Y0SA 1FDIA 1H0HA 4JYZA 4WF9S 1IW7D 2VPYA 1FDOA 1KQGA 4WFBS 1DMSA 4GA6A 3W2VB 5GAEW 3AIIA 4H4KA 2ZJRS 4IO9S 1PYQA 1UHEA 2A68D 3QQ7A 2NAPA 4CS0A 2Z0YA 2VPWA 3GTQA 4WFAS 4V194 5BNZA 4J3CA 2RD2A 2V45A 1UHDA 1PYUB 3KW2A 3QWZA
chains in the Genus database with same CATH topology
1OA7A 4FG2A 1E18A 1PT1A 3CF2A 1Y1VA 2YUJA 3H0GA 2IV2X 4AZDA 2PI8A 3X2NA 1HD5A 1L8FA 4JP7A 3CQZA 1Y4ZA 3SUKA 1QDNA 3HU2A 5GLFA 3QC8A 5FTNA 3X2HA 1OA9A 5H4UA 1CR5A 1YLEA 1Y1WA 1PQEA 4DMRA 1E60A 1SMYD 3QQ8A 2E7ZA 3HU3A 3HU1A 1CZ4A 2NVXA 2JA7A 3GTKA 2NYAA 4C2MA 4AAYA 1EU1A 1VC3B 5B6CA 1G8JA 3IR5A 5DYIA 3GTOA 2ENGA 4NOHA 3GTGA 5FTJA 1AA6A 1QCSA 3X2OA 1G8KA 1CZ5A 5DYGA 1H5NA 5C18A 4KLNA 3X2MA 1I3QA 1BW3A 5C1BA 5GLYA 1AW8B 4AONB 2C45A 2R93A 1E5VA 2B63A 3CZBA 3X2JA 1WLFA 3X2LA 1ZC1A 3SUMA 3ENGA 4RV0A 4AYBA 1E61A 5GM9A 4D7ZB 1DMRA 2VPZA 2BH0A 1TWAA 3IR6A 2JIRA 1YNJD 4FG4A 3GTMA 1S3SA 2A6ED 3X2KA 2G6GA 2R92A 2A69D 1WC2A 1Q16A 1TWCA 3HKZA 3OUGA 2PICA 4ENGA 2A6HD 2G5DA 2DMRA 5T5MD 2PJJA 2PJHB 2PNWA 1BW4A 2KI8A 3TM7B 4ZM7A 4JP6A 2JIQA 4KO8A 1PT0A 1OGYA 1WCMA 3DMRA 1K83A 4JCWA 4FERA 2AE0X 1R7RA 4KDLA 3GTPA 5T5ID 3SUJA 3SULA 1R9TA 2HCZX 1PQFA 5EPPA 3D30A 1PPYA 1SIWA 2JIPA 1SFOA 2GAEA 4L48A 1E32A 2E2HA 4AOKB 1TWGA 1Y5IA 2JA5A 2CW0D 1TWHA 2BE5D 2NVYA 5GLXA 4JJOA 2V3VA 3O5AA 3M3GA 3X2IA 1PQHA 2EEOB 4KODA 3X2PA 5FTKA 4CRYG 2JA6A 2E2IA 4GA5A 2WB1A 1ZYRD 2JIOA 3ML1A 4CRZA 2YU9A 4JS7A 1N10A 4FFTA 2WAQA 2VUMA 3TIWA 2JIMA 4AVRA 3FKIA 4QIWA 5FTMA 3IR7A 1YNND 2VPXA 4KDIA 1I50A 3GTJA 3X2GA 1TWFA 1TMOA 1KQFA 2PMZA 2O5JD 1R27A 3PLXB 2R7ZA 5FTLA 2KQAA 3GTLA 2Y0SA 1FDIA 1H0HA 1IW7D 2VPYA 1FDOA 1KQGA 1DMSA 4GA6A 1PYQA 1UHEA 2A68D 3QQ7A 2NAPA 4CS0A 2VPWA 3GTQA 2V45A 1UHDA 1PYUB 3QWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OA7 A;  4FG2 A;  4JCW A;  3X2M A;  4AVR A;  4FER A;  1BW3 A;  2AE0 X;  2PI8 A;  5GLY A;  3X2N A;  1HD5 A;  1L8F A;  4JP7 A;  3CZB A;  3SUL A;  3SUJ A;  3X2J A;  4ZM7 A;  2HCZ X;  3SUK A;  3SUM A;  3ENG A;  3X2G A;  3X2L A;  5GM9 A;  3D30 A;  1OA9 A;  5H4U A;  3X2H A;  2BH0 A;  2GAE A;  4L48 A;  4FG4 A;  2KQA A;  3X2O A;  5GLX A;  4JJO A;  3X2K A;  2G6G A;  3M3G A;  3X2I A;  1WC2 A;  2PIC A;  3X2P A;  2ENG A;  4ENG A;  2G5D A;  2PJJ A;  2PNW A;  1BW4 A;  4JS7 A;  1N10 A;  4FFT A;  4JP6 A; 
#chains in the Genus database with same CATH topology
 2NWA A;  2EGW A;  1OA7 A;  1PT1 A;  1E18 A;  3CF2 A;  4FG2 A;  1Y1V A;  2YUJ A;  3H0G A;  2IV2 X;  4AZD A;  1EUQ A;  1FEU A;  2PI8 A;  3X2N A;  4H3S A;  3X1L B;  1GTR A;  1HD5 A;  1L8F A;  4JP7 A;  4L69 A;  3CQZ A;  1O0B A;  1Y4Z A;  4U67 S;  1QDN A;  3HU2 A;  3SUK A;  5GLF A;  3QC8 A;  5FTN A;  1CR5 A;  1OA9 A;  1YLE A;  5H4U A;  3X2H A;  1Y1W A;  4P2B A;  4WCE S;  1PQE A;  4UY8 8;  4DMR A;  1E60 A;  1SMY D;  3QQ8 A;  2E7Z A;  3HU3 A;  3HU1 A;  1CZ4 A;  2NVX A;  2JA7 A;  5JVH S;  3GTK A;  2NYA A;  4C2M A;  4AAY A;  1EU1 A;  1VC3 B;  5B6C A;  1DFU P;  1G8J A;  3IR5 A;  5DYI A;  3GTO A;  2ENG A;  4NOH A;  3GTG A;  3J7Z V;  5FTJ A;  1AA6 A;  1QCS A;  1QRU A;  3X2O A;  1G8K A;  1NYL A;  1CZ5 A;  5DYG A;  1H5N A;  5C18 A;  4KLN A;  3X2M A;  1O0C A;  1I3Q A;  5C1B A;  1BW3 A;  5GLY A;  1AW8 B;  4AON B;  2C45 A;  2R93 A;  2HZ7 A;  1E5V A;  5GAH W;  2B63 A;  3CF5 S;  1QRS A;  3CZB A;  3X2J A;  1WLF A;  3X2L A;  1ZC1 A;  4RV0 A;  3ENG A;  3SUM A;  4AYB A;  1E61 A;  1GTS A;  5GM9 A;  4D7Z B;  3DLL S;  2ZJP S;  1DMR A;  2VPZ A;  1TWA A;  2BH0 A;  3IR6 A;  1VHK A;  2JIR A;  1YNJ D;  3PIP S;  4FG4 A;  3GTM A;  5DM7 S;  1S3S A;  3PIO S;  2A6E D;  4JXZ A;  1EXD A;  3X2K A;  2G6G A;  2R92 A;  2A69 D;  1WC2 A;  1Q16 A;  1TWC A;  4IOC S;  3HKZ A;  3OUG A;  2PIC A;  2A6H D;  4ENG A;  2DMR A;  2G5D A;  1EUY A;  4IOA S;  5T5M D;  2PJJ A;  2PJH B;  2EGV A;  2PNW A;  1BW4 A;  2KI8 A;  5DM6 S;  3TM7 B;  2ZJQ S;  4ZM7 A;  2JIQ A;  4JP6 A;  4KO8 A;  1PT0 A;  1OGY A;  1WCM A;  3DMR A;  1K83 A;  4JCW A;  4FER A;  1R7R A;  2AE0 X;  4KDL A;  3GTP A;  5T5I D;  3SUJ A;  3SUL A;  2RE8 A;  1R9T A;  2HCZ X;  1PQF A;  1NXZ A;  5EPP A;  1QTQ A;  3D30 A;  1ZJW A;  1PPY A;  1SIW A;  2JIP A;  1SFO A;  2GAE A;  4L48 A;  1E32 A;  2E2H A;  5HL7 S;  4AOK B;  1TWG A;  1Y5I A;  2JA5 A;  2CW0 D;  1TWH A;  2BE5 D;  2NVY A;  5GLX A;  4JJO A;  2V3V A;  3O5A A;  3M3G A;  3X2I A;  1V6Z A;  4JXX A;  1PQH A;  2EEO B;  4KOD A;  5FTK A;  3X2P A;  4CRY G;  2JA6 A;  2E2I A;  4GA5 A;  2WB1 A;  1ZYR D;  2JIO A;  3ML1 A;  4CRZ A;  2YU9 A;  5IZN A;  2WAQ A;  1N10 A;  4FFT A;  4JS7 A;  2VUM A;  5GAD W;  1D6K A;  3TIW A;  1B75 A;  4E8B A;  2JIM A;  4AVR A;  3FKI A;  4QIW A;  1VHY A;  5FTM A;  1Z85 A;  5GAG W;  3IR7 A;  1YNN D;  2VPX A;  4KDI A;  1I50 A;  3GTJ A;  2CX8 A;  5JVG S;  3X2G A;  1TWF A;  1TMO A;  1KQF A;  2PMZ A;  2O5J D;  3W2W B;  1UDX A;  1QRT A;  1R27 A;  3PLX B;  2R7Z A;  5FTL A;  4WFN S;  2KQA A;  3GTL A;  2Y0S A;  1FDI A;  1H0H A;  4JYZ A;  4WF9 S;  1IW7 D;  2VPY A;  1FDO A;  1KQG A;  4WFB S;  1DMS A;  4GA6 A;  3W2V B;  5GAE W;  3AII A;  4H4K A;  2ZJR S;  4IO9 S;  1PYQ A;  1UHE A;  2A68 D;  3QQ7 A;  2NAP A;  4CS0 A;  2Z0Y A;  2VPW A;  3GTQ A;  4WFA S;  4V19 4;  5BNZ A;  4J3C A;  2RD2 A;  2V45 A;  1UHD A;  1PYU B;  3KW2 A;  3QWZ A; 
#chains in the Genus database with same CATH homology
 1OA7 A;  4FG2 A;  1E18 A;  1PT1 A;  3CF2 A;  1Y1V A;  2YUJ A;  3H0G A;  2IV2 X;  4AZD A;  2PI8 A;  3X2N A;  1HD5 A;  1L8F A;  4JP7 A;  3CQZ A;  1Y4Z A;  3SUK A;  1QDN A;  3HU2 A;  5GLF A;  3QC8 A;  5FTN A;  3X2H A;  1OA9 A;  5H4U A;  1CR5 A;  1YLE A;  1Y1W A;  1PQE A;  4DMR A;  1E60 A;  1SMY D;  3QQ8 A;  2E7Z A;  3HU3 A;  3HU1 A;  1CZ4 A;  2NVX A;  2JA7 A;  3GTK A;  2NYA A;  4C2M A;  4AAY A;  1EU1 A;  1VC3 B;  5B6C A;  1G8J A;  3IR5 A;  5DYI A;  3GTO A;  2ENG A;  4NOH A;  3GTG A;  5FTJ A;  1AA6 A;  1QCS A;  3X2O A;  1G8K A;  1CZ5 A;  5DYG A;  1H5N A;  5C18 A;  4KLN A;  3X2M A;  1I3Q A;  1BW3 A;  5C1B A;  5GLY A;  1AW8 B;  4AON B;  2C45 A;  2R93 A;  1E5V A;  2B63 A;  3CZB A;  3X2J A;  1WLF A;  3X2L A;  1ZC1 A;  3SUM A;  3ENG A;  4RV0 A;  4AYB A;  1E61 A;  5GM9 A;  4D7Z B;  1DMR A;  2VPZ A;  2BH0 A;  1TWA A;  3IR6 A;  2JIR A;  1YNJ D;  4FG4 A;  3GTM A;  1S3S A;  2A6E D;  3X2K A;  2G6G A;  2R92 A;  2A69 D;  1WC2 A;  1Q16 A;  1TWC A;  3HKZ A;  3OUG A;  2PIC A;  4ENG A;  2A6H D;  2G5D A;  2DMR A;  5T5M D;  2PJJ A;  2PJH B;  2PNW A;  1BW4 A;  2KI8 A;  3TM7 B;  4ZM7 A;  4JP6 A;  2JIQ A;  4KO8 A;  1PT0 A;  1OGY A;  1WCM A;  3DMR A;  1K83 A;  4JCW A;  4FER A;  2AE0 X;  1R7R A;  4KDL A;  3GTP A;  5T5I D;  3SUJ A;  3SUL A;  1R9T A;  2HCZ X;  1PQF A;  5EPP A;  3D30 A;  1PPY A;  1SIW A;  2JIP A;  1SFO A;  2GAE A;  4L48 A;  1E32 A;  2E2H A;  4AOK B;  1TWG A;  1Y5I A;  2JA5 A;  2CW0 D;  1TWH A;  2BE5 D;  2NVY A;  5GLX A;  4JJO A;  2V3V A;  3O5A A;  3M3G A;  3X2I A;  1PQH A;  2EEO B;  4KOD A;  3X2P A;  5FTK A;  4CRY G;  2JA6 A;  2E2I A;  4GA5 A;  2WB1 A;  1ZYR D;  2JIO A;  3ML1 A;  4CRZ A;  2YU9 A;  4JS7 A;  1N10 A;  4FFT A;  2WAQ A;  2VUM A;  3TIW A;  2JIM A;  4AVR A;  3FKI A;  4QIW A;  5FTM A;  3IR7 A;  1YNN D;  2VPX A;  4KDI A;  1I50 A;  3GTJ A;  3X2G A;  1TWF A;  1TMO A;  1KQF A;  2PMZ A;  2O5J D;  1R27 A;  3PLX B;  2R7Z A;  5FTL A;  2KQA A;  3GTL A;  2Y0S A;  1FDI A;  1H0H A;  1IW7 D;  2VPY A;  1FDO A;  1KQG A;  1DMS A;  4GA6 A;  1PYQ A;  1UHE A;  2A68 D;  3QQ7 A;  2NAP A;  4CS0 A;  2VPW A;  3GTQ A;  2V45 A;  1UHD A;  1PYU B;  3QWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...