2PJJA

E. coli lytic transglycosylase mlta-d308a in apo-1 form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 94
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pjjA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pjjA02
2PI8A 5GLYA 3CZBA 2KQAA 3SUKA 2ENGA 2GAEA 3X2MA 3X2OA 1OA7A 4JJOA 5H4UA 3SULA 1N10A 4JCWA 5GM9A 1HD5A 3X2LA 1L8FA 4ENGA 1BW3A 2BH0A 3ENGA 4FFTA 4FERA 2G6GA 3D30A 3X2PA 2AE0X 4JP7A 5GLXA 3X2KA 3X2IA 3X2GA 1WC2A 4FG4A 3SUJA 1BW4A 3X2HA 2PNWA 3SUMA 2PICA 2G5DA 3M3GA 2HCZX 2PJJA 4JP6A 4ZM7A 1OA9A 4FG2A 3X2JA 4L48A 4AVRA 4JS7A 3X2NA
chains in the Genus database with same CATH superfamily
2JIQA 1QRUA 3IR5A 1CR5A 2VPWA 5DYIA 1E32A 1TWGA 2KQAA 3HU1A 5T5MD 3X2MA 4C2MA 3GTPA 1OA7A 5IZNA 5H4UA 1NXZA 1FEUA 1N10A 3QC8A 4JYZA 3X2LA 1HD5A 3QQ7A 1L8FA 2PJHB 1BW3A 2NVXA 1B75A 3PIOS 2V45A 2O5JD 3J7ZV 2IV2X 1YNND 4AONB 1D6KA 1UHDA 1UDXA 2CX8A 2A6HD 1EU1A 4FG4A 4KDIA 4AYBA 4AAYA 4CS0A 1I50A 2R93A 3ML1A 3X2HA 1H5NA 1G8JA 1E5VA 1G8KA 4WFNS 5GAHW 3GTOA 1PPYA 1TWFA 2WAQA 2EEOB 2R7ZA 1UHEA 3AIIA 4U67S 3GTGA 2E7ZA 2NWAA 2RD2A 2VPYA 3KW2A 4H4KA 4JP6A 4WFBS 3IR6A 4KDLA 4D7ZB 2E2HA 1YNJD 4FG2A 4L48A 1PQFA 3X2JA 4JS7A 5DYGA 5JVHS 1WCMA 1EXDA 2ZJPS 4UY88 1PQHA 1R27A 3GTJA 1YLEA 3OUGA 2EGVA 2V3VA 2JA6A 2ENGA 5C1BA 3DMRA 1R9TA 3GTKA 5JVGS 1ZYRD 3QQ8A 1PYUB 1ZC1A 2C45A 2NYAA 4ENGA 3ENGA 4FFTA 4J3CA 2G6GA 4WF9S 1OGYA 1TMOA 2KI8A 5EPPA 5GLXA 1S3SA 4KLNA 5DM7S 3X2GA 4GA6A 5B6CA 2Y0SA 2R92A 4L69A 4NOHA 3TIWA 4P2BA 1DFUP 3GTMA 2PNWA 4AOKB 1DMSA 2JIRA 3FKIA 4RV0A 1SFOA 3SUMA 2VPXA 3CQZA 1NYLA 3HU2A 1FDOA 1TWAA 3DLLS 1SMYD 1WLFA 3HU3A 1QTQA 2G5DA 2HCZX 1KQFA 1Y5IA 2A68D 4CRYG 3PIPS 5FTLA 2VPZA 1EUYA 1VHKA 3IR7A 2PI8A 5GLYA 3CZBA 2JIOA 3SUKA 2YU9A 3X2OA 2JA5A 1EUQA 4AZDA 5GADW 4QIWA 4JCWA 2DMRA 5GM9A 1Q16A 3X1LB 1E60A 2BH0A 1FDIA 1PQEA 1VC3B 4FERA 1ZJWA 1O0BA 4JP7A 2WB1A 3X2KA 3X2IA 2JA7A 5BNZA 1GTSA 1E18A 1PT0A 1QDNA 1WC2A 4DMRA 1CZ4A 2E2IA 2JIMA 3O5AA 1KQGA 1GTRA 1K83A 2CW0D 2B63A 3PLXB 1E61A 1V6ZA 1O0CA 5GAEW 2PICA 2YUJA 4E8BA 1PT1A 1PYQA 3M3GA 2PMZA 4ZM7A 4H3SA 4AVRA 5HL7S 2ZJQS 4JXZA 2BE5D 3X2NA 1Z85A 4KO8A 5FTNA 2JIPA 1TWHA 4GA5A 1QRSA 2GAEA 2NAPA 4KODA 1DMRA 4JJOA 5GLFA 1R7RA 1Y4ZA 3SULA 3W2VB 3QWZA 1VHYA 2A6ED 3D30A 1I3QA 2A69D 3X2PA 2AE0X 2EGWA 4WFAS 4IOCS 1SIWA 3TM7B 3GTLA 3H0GA 2RE8A 3HKZA 1QRTA 3SUJA 1BW4A 1CZ5A 5C18A 5FTMA 2Z0YA 3W2WB 2HZ7A 5T5ID 1AW8B 1H0HA 1QCSA 5FTJA 2VUMA 4WCES 4CRZA 1IW7D 3CF2A 2ZJRS 4IO9S 1Y1WA 5GAGW 4JXXA 1AA6A 2PJJA 2NVYA 5DM6S 3CF5S 1OA9A 4V194 4IOAS 1Y1VA 1TWCA 5FTKA 3GTQA
chains in the Genus database with same CATH topology
2JIQA 3IR5A 1CR5A 2VPWA 5DYIA 2KQAA 1E32A 1TWGA 3HU1A 3X2MA 5T5MD 4C2MA 3GTPA 1OA7A 5H4UA 1N10A 3QC8A 3X2LA 1HD5A 3QQ7A 1L8FA 1BW3A 2PJHB 2NVXA 2V45A 2O5JD 2IV2X 1YNND 4AONB 1UHDA 2A6HD 1EU1A 4FG4A 4KDIA 4AYBA 4AAYA 4CS0A 1I50A 2R93A 3ML1A 3X2HA 1H5NA 1G8JA 1E5VA 1G8KA 3GTOA 1PPYA 1TWFA 2WAQA 2EEOB 2R7ZA 1UHEA 3GTGA 2E7ZA 2VPYA 4JP6A 3IR6A 4KDLA 4D7ZB 2E2HA 4FG2A 3X2JA 4L48A 1PQFA 1YNJD 4JS7A 5DYGA 1WCMA 1PQHA 1R27A 3GTJA 1YLEA 3OUGA 2V3VA 2JA6A 2ENGA 5C1BA 3DMRA 1R9TA 3GTKA 1ZYRD 3QQ8A 1PYUB 4ENGA 1ZC1A 2C45A 2NYAA 3ENGA 4FFTA 2G6GA 1OGYA 1TMOA 5GLXA 2KI8A 5EPPA 1S3SA 4KLNA 3X2GA 4GA6A 5B6CA 2Y0SA 2R92A 4NOHA 3TIWA 3GTMA 2PNWA 4AOKB 1DMSA 2JIRA 3FKIA 4RV0A 1SFOA 3SUMA 2VPXA 3CQZA 3HU2A 1FDOA 1TWAA 1SMYD 1WLFA 3HU3A 2G5DA 2HCZX 1KQFA 1Y5IA 2A68D 4CRYG 5FTLA 2VPZA 3IR7A 2PI8A 5GLYA 3CZBA 2JIOA 3SUKA 2YU9A 3X2OA 2JA5A 4AZDA 4QIWA 4JCWA 5GM9A 2DMRA 1Q16A 1E60A 2BH0A 1FDIA 4FERA 1PQEA 1VC3B 4JP7A 3X2KA 2WB1A 3X2IA 2JA7A 1E18A 1PT0A 1WC2A 1QDNA 4DMRA 1CZ4A 2E2IA 2JIMA 3O5AA 1KQGA 1K83A 2CW0D 2B63A 1TWCA 3PLXB 1E61A 2PICA 2YUJA 1PT1A 3M3GA 4ZM7A 2PMZA 4AVRA 2BE5D 3X2NA 4KO8A 5FTNA 2JIPA 1TWHA 4GA5A 2GAEA 2NAPA 4KODA 4JJOA 1DMRA 5GLFA 1R7RA 3SULA 1Y4ZA 3QWZA 2A6ED 3D30A 1I3QA 2A69D 3X2PA 2AE0X 1SIWA 3TM7B 3GTLA 3H0GA 3HKZA 3SUJA 1BW4A 1CZ5A 5C18A 5FTMA 5T5ID 1AW8B 1H0HA 1QCSA 5FTJA 2VUMA 4CRZA 1IW7D 3CF2A 1Y1WA 1AA6A 2PJJA 2NVYA 1OA9A 1Y1VA 1PYQA 5FTKA 3GTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI8 A;  5GLY A;  3CZB A;  2KQA A;  3SUK A;  2ENG A;  2GAE A;  3X2M A;  3X2O A;  1OA7 A;  4JJO A;  5H4U A;  3SUL A;  1N10 A;  4JCW A;  5GM9 A;  1HD5 A;  3X2L A;  1L8F A;  4ENG A;  1BW3 A;  2BH0 A;  3ENG A;  4FFT A;  4FER A;  2G6G A;  3D30 A;  3X2P A;  2AE0 X;  4JP7 A;  5GLX A;  3X2K A;  3X2I A;  3X2G A;  1WC2 A;  4FG4 A;  3SUJ A;  1BW4 A;  3X2H A;  2PNW A;  3SUM A;  2PIC A;  2G5D A;  3M3G A;  2HCZ X;  2PJJ A;  4JP6 A;  4ZM7 A;  1OA9 A;  4FG2 A;  3X2J A;  4L48 A;  4AVR A;  4JS7 A;  3X2N A; 
#chains in the Genus database with same CATH topology
 2JIQ A;  1QRU A;  3IR5 A;  1CR5 A;  2VPW A;  5DYI A;  1E32 A;  1TWG A;  2KQA A;  3HU1 A;  5T5M D;  3X2M A;  4C2M A;  3GTP A;  1OA7 A;  5IZN A;  5H4U A;  1NXZ A;  1FEU A;  1N10 A;  3QC8 A;  4JYZ A;  3X2L A;  1HD5 A;  3QQ7 A;  1L8F A;  2PJH B;  1BW3 A;  2NVX A;  1B75 A;  3PIO S;  2V45 A;  2O5J D;  3J7Z V;  2IV2 X;  1YNN D;  4AON B;  1D6K A;  1UHD A;  1UDX A;  2CX8 A;  2A6H D;  1EU1 A;  4FG4 A;  4KDI A;  4AYB A;  4AAY A;  4CS0 A;  1I50 A;  2R93 A;  3ML1 A;  3X2H A;  1H5N A;  1G8J A;  1E5V A;  1G8K A;  4WFN S;  5GAH W;  3GTO A;  1PPY A;  1TWF A;  2WAQ A;  2EEO B;  2R7Z A;  1UHE A;  3AII A;  4U67 S;  3GTG A;  2E7Z A;  2NWA A;  2RD2 A;  2VPY A;  3KW2 A;  4H4K A;  4JP6 A;  4WFB S;  3IR6 A;  4KDL A;  4D7Z B;  2E2H A;  1YNJ D;  4FG2 A;  4L48 A;  1PQF A;  3X2J A;  4JS7 A;  5DYG A;  5JVH S;  1WCM A;  1EXD A;  2ZJP S;  4UY8 8;  1PQH A;  1R27 A;  3GTJ A;  1YLE A;  3OUG A;  2EGV A;  2V3V A;  2JA6 A;  2ENG A;  5C1B A;  3DMR A;  1R9T A;  3GTK A;  5JVG S;  1ZYR D;  3QQ8 A;  1PYU B;  1ZC1 A;  2C45 A;  2NYA A;  4ENG A;  3ENG A;  4FFT A;  4J3C A;  2G6G A;  4WF9 S;  1OGY A;  1TMO A;  2KI8 A;  5EPP A;  5GLX A;  1S3S A;  4KLN A;  5DM7 S;  3X2G A;  4GA6 A;  5B6C A;  2Y0S A;  2R92 A;  4L69 A;  4NOH A;  3TIW A;  4P2B A;  1DFU P;  3GTM A;  2PNW A;  4AOK B;  1DMS A;  2JIR A;  3FKI A;  4RV0 A;  1SFO A;  3SUM A;  2VPX A;  3CQZ A;  1NYL A;  3HU2 A;  1FDO A;  1TWA A;  3DLL S;  1SMY D;  1WLF A;  3HU3 A;  1QTQ A;  2G5D A;  2HCZ X;  1KQF A;  1Y5I A;  2A68 D;  4CRY G;  3PIP S;  5FTL A;  2VPZ A;  1EUY A;  1VHK A;  3IR7 A;  2PI8 A;  5GLY A;  3CZB A;  2JIO A;  3SUK A;  2YU9 A;  3X2O A;  2JA5 A;  1EUQ A;  4AZD A;  5GAD W;  4QIW A;  4JCW A;  2DMR A;  5GM9 A;  1Q16 A;  3X1L B;  1E60 A;  2BH0 A;  1FDI A;  1PQE A;  1VC3 B;  4FER A;  1ZJW A;  1O0B A;  4JP7 A;  2WB1 A;  3X2K A;  3X2I A;  2JA7 A;  5BNZ A;  1GTS A;  1E18 A;  1PT0 A;  1QDN A;  1WC2 A;  4DMR A;  1CZ4 A;  2E2I A;  2JIM A;  3O5A A;  1KQG A;  1GTR A;  1K83 A;  2CW0 D;  2B63 A;  3PLX B;  1E61 A;  1V6Z A;  1O0C A;  5GAE W;  2PIC A;  2YUJ A;  4E8B A;  1PT1 A;  1PYQ A;  3M3G A;  2PMZ A;  4ZM7 A;  4H3S A;  4AVR A;  5HL7 S;  2ZJQ S;  4JXZ A;  2BE5 D;  3X2N A;  1Z85 A;  4KO8 A;  5FTN A;  2JIP A;  1TWH A;  4GA5 A;  1QRS A;  2GAE A;  2NAP A;  4KOD A;  1DMR A;  4JJO A;  5GLF A;  1R7R A;  1Y4Z A;  3SUL A;  3W2V B;  3QWZ A;  1VHY A;  2A6E D;  3D30 A;  1I3Q A;  2A69 D;  3X2P A;  2AE0 X;  2EGW A;  4WFA S;  4IOC S;  1SIW A;  3TM7 B;  3GTL A;  3H0G A;  2RE8 A;  3HKZ A;  1QRT A;  3SUJ A;  1BW4 A;  1CZ5 A;  5C18 A;  5FTM A;  2Z0Y A;  3W2W B;  2HZ7 A;  5T5I D;  1AW8 B;  1H0H A;  1QCS A;  5FTJ A;  2VUM A;  4WCE S;  4CRZ A;  1IW7 D;  3CF2 A;  2ZJR S;  4IO9 S;  1Y1W A;  5GAG W;  4JXX A;  1AA6 A;  2PJJ A;  2NVY A;  5DM6 S;  3CF5 S;  1OA9 A;  4V19 4;  4IOA S;  1Y1V A;  1TWC A;  5FTK A;  3GTQ A; 
#chains in the Genus database with same CATH homology
 2JIQ A;  3IR5 A;  1CR5 A;  2VPW A;  5DYI A;  2KQA A;  1E32 A;  1TWG A;  3HU1 A;  3X2M A;  5T5M D;  4C2M A;  3GTP A;  1OA7 A;  5H4U A;  1N10 A;  3QC8 A;  3X2L A;  1HD5 A;  3QQ7 A;  1L8F A;  1BW3 A;  2PJH B;  2NVX A;  2V45 A;  2O5J D;  2IV2 X;  1YNN D;  4AON B;  1UHD A;  2A6H D;  1EU1 A;  4FG4 A;  4KDI A;  4AYB A;  4AAY A;  4CS0 A;  1I50 A;  2R93 A;  3ML1 A;  3X2H A;  1H5N A;  1G8J A;  1E5V A;  1G8K A;  3GTO A;  1PPY A;  1TWF A;  2WAQ A;  2EEO B;  2R7Z A;  1UHE A;  3GTG A;  2E7Z A;  2VPY A;  4JP6 A;  3IR6 A;  4KDL A;  4D7Z B;  2E2H A;  4FG2 A;  3X2J A;  4L48 A;  1PQF A;  1YNJ D;  4JS7 A;  5DYG A;  1WCM A;  1PQH A;  1R27 A;  3GTJ A;  1YLE A;  3OUG A;  2V3V A;  2JA6 A;  2ENG A;  5C1B A;  3DMR A;  1R9T A;  3GTK A;  1ZYR D;  3QQ8 A;  1PYU B;  4ENG A;  1ZC1 A;  2C45 A;  2NYA A;  3ENG A;  4FFT A;  2G6G A;  1OGY A;  1TMO A;  5GLX A;  2KI8 A;  5EPP A;  1S3S A;  4KLN A;  3X2G A;  4GA6 A;  5B6C A;  2Y0S A;  2R92 A;  4NOH A;  3TIW A;  3GTM A;  2PNW A;  4AOK B;  1DMS A;  2JIR A;  3FKI A;  4RV0 A;  1SFO A;  3SUM A;  2VPX A;  3CQZ A;  3HU2 A;  1FDO A;  1TWA A;  1SMY D;  1WLF A;  3HU3 A;  2G5D A;  2HCZ X;  1KQF A;  1Y5I A;  2A68 D;  4CRY G;  5FTL A;  2VPZ A;  3IR7 A;  2PI8 A;  5GLY A;  3CZB A;  2JIO A;  3SUK A;  2YU9 A;  3X2O A;  2JA5 A;  4AZD A;  4QIW A;  4JCW A;  5GM9 A;  2DMR A;  1Q16 A;  1E60 A;  2BH0 A;  1FDI A;  4FER A;  1PQE A;  1VC3 B;  4JP7 A;  3X2K A;  2WB1 A;  3X2I A;  2JA7 A;  1E18 A;  1PT0 A;  1WC2 A;  1QDN A;  4DMR A;  1CZ4 A;  2E2I A;  2JIM A;  3O5A A;  1KQG A;  1K83 A;  2CW0 D;  2B63 A;  1TWC A;  3PLX B;  1E61 A;  2PIC A;  2YUJ A;  1PT1 A;  3M3G A;  4ZM7 A;  2PMZ A;  4AVR A;  2BE5 D;  3X2N A;  4KO8 A;  5FTN A;  2JIP A;  1TWH A;  4GA5 A;  2GAE A;  2NAP A;  4KOD A;  4JJO A;  1DMR A;  5GLF A;  1R7R A;  3SUL A;  1Y4Z A;  3QWZ A;  2A6E D;  3D30 A;  1I3Q A;  2A69 D;  3X2P A;  2AE0 X;  1SIW A;  3TM7 B;  3GTL A;  3H0G A;  3HKZ A;  3SUJ A;  1BW4 A;  1CZ5 A;  5C18 A;  5FTM A;  5T5I D;  1AW8 B;  1H0H A;  1QCS A;  5FTJ A;  2VUM A;  4CRZ A;  1IW7 D;  3CF2 A;  1Y1W A;  1AA6 A;  2PJJ A;  2NVY A;  1OA9 A;  1Y1V A;  1PYQ A;  5FTK A;  3GTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...