2PJJA

E. coli lytic transglycosylase mlta-d308a in apo-1 form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
335
structure length
335
Chain Sequence
b'SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pjjA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pjjA02
3SULA 3X2LA 2PNWA 5GM9A 3SUJA 3X2JA 4FG2A 3D30A 2AE0X 4JS7A 3SUKA 2G5DA 1N10A 2PI8A 4JJOA 5GLYA 4JP6A 4FG4A 3X2MA 2G6GA 4JP7A 3X2NA 4FERA 5GLXA 2PJJA 4ZM7A 3X2OA 4ENGA 2BH0A 2PICA 1BW4A 4FFTA 3X2GA 4AVRA 1BW3A 3X2KA 1HD5A 1OA7A 1OA9A 3ENGA 3M3GA 1L8FA 2HCZX 4L48A 5H4UA 3X2PA 2GAEA 3X2HA 3SUMA 3CZBA 4JCWA 1WC2A 2KQAA 2ENGA 3X2IA
chains in the Genus database with same CATH superfamily
3PIPS 2YU9A 2JA6A 4AONB 1E32A 3OUGA 3TM7B 5FTLA 3SUJA 3PIOS 4UY88 3IR7A 1PT1A 3CF5S 3IR6A 2AE0X 5C18A 1G8JA 2R93A 2EGVA 1TMOA 4IO9S 2E7ZA 5GAHW 5GLYA 1YLEA 2YUJA 1UHEA 4WFBS 5DM7S 3DLLS 5GLXA 2A6ED 1S3SA 4NOHA 2O5JD 2BH0A 1AW8B 1E5VA 2BE5D 2JIQA 2PICA 1TWCA 4AVRA 3GTGA 2Z0YA 1ZC1A 3CQZA 4AZDA 3X2PA 2E2HA 3W2WB 5GAEW 2HCZX 3FKIA 1B75A 2JIRA 2V3VA 2KI8A 2VUMA 4DMRA 1AA6A 1KQGA 4KODA 2C45A 2VPXA 2NVXA 3GTLA 2JA5A 2ENGA 1I3QA 2JIOA 1UDXA 1R9TA 4CRZA 2VPWA 2A69D 1V6ZA 1GTRA 2JIMA 4CRYG 2NAPA 4CS0A 4JYZA 1Z85A 4WF9S 2A68D 1Y1WA 4WFAS 5FTMA 2IV2X 3AIIA 4IOAS 2CX8A 1SIWA 1TWFA 4JS7A 2G5DA 3SUKA 5B6CA 4WCES 5FTNA 1ZJWA 3X1LB 1CZ4A 4JP6A 3QWZA 4FG4A 1SFOA 3GTPA 2DMRA 4JP7A 3X2NA 2RE8A 5JVGS 3HU3A 3J7ZV 1IW7D 2ZJPS 1SMYD 1YNND 2WB1A 1BW3A 2ZJRS 4FFTA 5FTKA 3X2GA 5BNZA 4QIWA 1GTSA 1D6KA 1HD5A 1OA7A 5H4UA 1L8FA 2E2IA 1QRTA 4H3SA 2NVYA 2EGWA 1DMSA 3SUMA 1WLFA 5GAGW 4H4KA 5DYGA 2B63A 4JCWA 1WC2A 2EEOB 1QCSA 4C2MA 4V194 4WFNS 3X2IA 2Y0SA 3SULA 3X2LA 4IOCS 1EUQA 4L69A 4JXXA 1PQEA 2RD2A 1FDIA 3X2JA 1NXZA 5IZNA 2ZJQS 1QDNA 1Q16A 3CF2A 3D30A 3TIWA 2NWAA 4E8BA 2NYAA 4AYBA 4AAYA 1UHDA 1N10A 1PQFA 2PI8A 4D7ZB 4JXZA 4GA6A 1VHYA 4GA5A 5EPPA 3GTOA 1TWHA 4FERA 1I50A 1H5NA 5JVHS 4ZM7A 1K83A 1NYLA 3W2VB 5T5ID 1CZ5A 3X2OA 1BW4A 4U67S 1CR5A 2R92A 1EUYA 1PPYA 5DYIA 4KLNA 4P2BA 1WCMA 3ENGA 2V45A 3M3GA 3O5AA 4L48A 2A6HD 1DMRA 3GTMA 3KW2A 5HL7S 2PJHB 3QQ7A 5DM6S 1O0CA 1OGYA 5GADW 1VC3B 3H0GA 1R27A 1E61A 1YNJD 3QC8A 1TWGA 2JA7A 1E60A 1DFUP 2HZ7A 2PNWA 3HU1A 2CW0D 5GLFA 3DMRA 5GM9A 2JIPA 3HKZA 4FG2A 1QTQA 3QQ8A 1H0HA 1Y1VA 5FTJA 1ZYRD 1PYUB 3HU2A 1PT0A 1EU1A 4JJOA 5T5MD 3GTJA 3X2MA 2G6GA 1PYQA 2PJJA 5C1BA 1EXDA 4KO8A 1KQFA 3PLXB 1O0BA 3ML1A 4RV0A 1G8KA 4ENGA 1Y5IA 2R7ZA 1QRSA 3GTKA 3X2KA 4AOKB 2VPZA 1OA9A 1VHKA 3IR5A 2GAEA 2VPYA 4KDIA 3X2HA 1Y4ZA 1TWAA 2PMZA 3CZBA 1FDOA 4KDLA 3GTQA 1QRUA 1FEUA 1PQHA 2WAQA 2KQAA 1R7RA 4J3CA 1E18A
chains in the Genus database with same CATH topology
2YU9A 2JA6A 4AONB 1E32A 3OUGA 3TM7B 5FTLA 3SUJA 3IR7A 1PT1A 3IR6A 2AE0X 5C18A 1G8JA 2R93A 1TMOA 2E7ZA 5GLYA 1YLEA 2YUJA 1UHEA 5GLXA 2A6ED 1S3SA 4NOHA 2O5JD 2BH0A 2PICA 1AW8B 4AVRA 1E5VA 2BE5D 1TWCA 2JIQA 3GTGA 1ZC1A 3CQZA 4AZDA 3X2PA 2E2HA 2HCZX 3FKIA 2JIRA 2V3VA 2KI8A 2VUMA 4DMRA 1AA6A 1KQGA 4KODA 2C45A 2VPXA 2NVXA 3GTLA 2JA5A 2ENGA 1I3QA 2JIOA 1R9TA 4CRZA 2VPWA 2A69D 2JIMA 4CRYG 2NAPA 4CS0A 2A68D 1Y1WA 5FTMA 2IV2X 1SIWA 4JS7A 3SUKA 2G5DA 1TWFA 5B6CA 5FTNA 1CZ4A 4JP6A 4FG4A 3QWZA 1SFOA 3GTPA 4JP7A 3X2NA 2DMRA 3HU3A 1IW7D 1SMYD 1YNND 1BW3A 2WB1A 4FFTA 3X2GA 5FTKA 4QIWA 1HD5A 1OA7A 5H4UA 1L8FA 2E2IA 2NVYA 1DMSA 3SUMA 1WLFA 5DYGA 2B63A 4JCWA 1WC2A 2EEOB 1QCSA 4C2MA 3X2IA 2Y0SA 3SULA 3X2LA 1PQEA 3X2JA 1FDIA 3D30A 1QDNA 1Q16A 3CF2A 3TIWA 2NYAA 4AYBA 4AAYA 1UHDA 1N10A 1PQFA 2PI8A 4D7ZB 4GA6A 4GA5A 5EPPA 3GTOA 1TWHA 4FERA 1I50A 1H5NA 4ZM7A 1K83A 5T5ID 1CZ5A 3X2OA 1BW4A 1CR5A 2R92A 1PPYA 5DYIA 4KLNA 3M3GA 3ENGA 4L48A 1WCMA 2V45A 3O5AA 2A6HD 1DMRA 3GTMA 2PJHB 3QQ7A 1OGYA 1VC3B 3H0GA 1E61A 1R27A 1YNJD 3QC8A 1TWGA 2JA7A 1E60A 2PNWA 5GM9A 2CW0D 3HU1A 3DMRA 5GLFA 2JIPA 3HKZA 4FG2A 3QQ8A 1H0HA 1Y1VA 5FTJA 1ZYRD 1PYUB 3HU2A 1PT0A 4JJOA 1EU1A 5T5MD 3GTJA 3X2MA 2G6GA 1PYQA 2PJJA 5C1BA 4KO8A 1KQFA 3PLXB 4ENGA 3ML1A 1G8KA 4RV0A 1Y5IA 2R7ZA 3GTKA 3X2KA 4AOKB 2VPZA 1OA9A 3IR5A 2GAEA 3X2HA 2VPYA 4KDIA 1Y4ZA 1TWAA 2PMZA 3CZBA 1FDOA 4KDLA 3GTQA 1PQHA 2WAQA 2KQAA 1R7RA 1E18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUL A;  3X2L A;  2PNW A;  5GM9 A;  3SUJ A;  3X2J A;  4FG2 A;  3D30 A;  2AE0 X;  4JS7 A;  3SUK A;  2G5D A;  1N10 A;  2PI8 A;  4JJO A;  5GLY A;  4JP6 A;  4FG4 A;  3X2M A;  2G6G A;  4JP7 A;  3X2N A;  4FER A;  5GLX A;  2PJJ A;  4ZM7 A;  3X2O A;  4ENG A;  2BH0 A;  2PIC A;  1BW4 A;  4FFT A;  3X2G A;  4AVR A;  1BW3 A;  3X2K A;  1HD5 A;  1OA7 A;  1OA9 A;  3ENG A;  3M3G A;  1L8F A;  2HCZ X;  4L48 A;  5H4U A;  3X2P A;  2GAE A;  3X2H A;  3SUM A;  3CZB A;  4JCW A;  1WC2 A;  2KQA A;  2ENG A;  3X2I A; 
#chains in the Genus database with same CATH topology
 3PIP S;  2YU9 A;  2JA6 A;  4AON B;  1E32 A;  3OUG A;  3TM7 B;  5FTL A;  3SUJ A;  3PIO S;  4UY8 8;  3IR7 A;  1PT1 A;  3CF5 S;  3IR6 A;  2AE0 X;  5C18 A;  1G8J A;  2R93 A;  2EGV A;  1TMO A;  4IO9 S;  2E7Z A;  5GAH W;  5GLY A;  1YLE A;  2YUJ A;  1UHE A;  4WFB S;  5DM7 S;  3DLL S;  5GLX A;  2A6E D;  1S3S A;  4NOH A;  2O5J D;  2BH0 A;  1AW8 B;  1E5V A;  2BE5 D;  2JIQ A;  2PIC A;  1TWC A;  4AVR A;  3GTG A;  2Z0Y A;  1ZC1 A;  3CQZ A;  4AZD A;  3X2P A;  2E2H A;  3W2W B;  5GAE W;  2HCZ X;  3FKI A;  1B75 A;  2JIR A;  2V3V A;  2KI8 A;  2VUM A;  4DMR A;  1AA6 A;  1KQG A;  4KOD A;  2C45 A;  2VPX A;  2NVX A;  3GTL A;  2JA5 A;  2ENG A;  1I3Q A;  2JIO A;  1UDX A;  1R9T A;  4CRZ A;  2VPW A;  2A69 D;  1V6Z A;  1GTR A;  2JIM A;  4CRY G;  2NAP A;  4CS0 A;  4JYZ A;  1Z85 A;  4WF9 S;  2A68 D;  1Y1W A;  4WFA S;  5FTM A;  2IV2 X;  3AII A;  4IOA S;  2CX8 A;  1SIW A;  1TWF A;  4JS7 A;  2G5D A;  3SUK A;  5B6C A;  4WCE S;  5FTN A;  1ZJW A;  3X1L B;  1CZ4 A;  4JP6 A;  3QWZ A;  4FG4 A;  1SFO A;  3GTP A;  2DMR A;  4JP7 A;  3X2N A;  2RE8 A;  5JVG S;  3HU3 A;  3J7Z V;  1IW7 D;  2ZJP S;  1SMY D;  1YNN D;  2WB1 A;  1BW3 A;  2ZJR S;  4FFT A;  5FTK A;  3X2G A;  5BNZ A;  4QIW A;  1GTS A;  1D6K A;  1HD5 A;  1OA7 A;  5H4U A;  1L8F A;  2E2I A;  1QRT A;  4H3S A;  2NVY A;  2EGW A;  1DMS A;  3SUM A;  1WLF A;  5GAG W;  4H4K A;  5DYG A;  2B63 A;  4JCW A;  1WC2 A;  2EEO B;  1QCS A;  4C2M A;  4V19 4;  4WFN S;  3X2I A;  2Y0S A;  3SUL A;  3X2L A;  4IOC S;  1EUQ A;  4L69 A;  4JXX A;  1PQE A;  2RD2 A;  1FDI A;  3X2J A;  1NXZ A;  5IZN A;  2ZJQ S;  1QDN A;  1Q16 A;  3CF2 A;  3D30 A;  3TIW A;  2NWA A;  4E8B A;  2NYA A;  4AYB A;  4AAY A;  1UHD A;  1N10 A;  1PQF A;  2PI8 A;  4D7Z B;  4JXZ A;  4GA6 A;  1VHY A;  4GA5 A;  5EPP A;  3GTO A;  1TWH A;  4FER A;  1I50 A;  1H5N A;  5JVH S;  4ZM7 A;  1K83 A;  1NYL A;  3W2V B;  5T5I D;  1CZ5 A;  3X2O A;  1BW4 A;  4U67 S;  1CR5 A;  2R92 A;  1EUY A;  1PPY A;  5DYI A;  4KLN A;  4P2B A;  1WCM A;  3ENG A;  2V45 A;  3M3G A;  3O5A A;  4L48 A;  2A6H D;  1DMR A;  3GTM A;  3KW2 A;  5HL7 S;  2PJH B;  3QQ7 A;  5DM6 S;  1O0C A;  1OGY A;  5GAD W;  1VC3 B;  3H0G A;  1R27 A;  1E61 A;  1YNJ D;  3QC8 A;  1TWG A;  2JA7 A;  1E60 A;  1DFU P;  2HZ7 A;  2PNW A;  3HU1 A;  2CW0 D;  5GLF A;  3DMR A;  5GM9 A;  2JIP A;  3HKZ A;  4FG2 A;  1QTQ A;  3QQ8 A;  1H0H A;  1Y1V A;  5FTJ A;  1ZYR D;  1PYU B;  3HU2 A;  1PT0 A;  1EU1 A;  4JJO A;  5T5M D;  3GTJ A;  3X2M A;  2G6G A;  1PYQ A;  2PJJ A;  5C1B A;  1EXD A;  4KO8 A;  1KQF A;  3PLX B;  1O0B A;  3ML1 A;  4RV0 A;  1G8K A;  4ENG A;  1Y5I A;  2R7Z A;  1QRS A;  3GTK A;  3X2K A;  4AOK B;  2VPZ A;  1OA9 A;  1VHK A;  3IR5 A;  2GAE A;  2VPY A;  4KDI A;  3X2H A;  1Y4Z A;  1TWA A;  2PMZ A;  3CZB A;  1FDO A;  4KDL A;  3GTQ A;  1QRU A;  1FEU A;  1PQH A;  2WAQ A;  2KQA A;  1R7R A;  4J3C A;  1E18 A; 
#chains in the Genus database with same CATH homology
 2YU9 A;  2JA6 A;  4AON B;  1E32 A;  3OUG A;  3TM7 B;  5FTL A;  3SUJ A;  3IR7 A;  1PT1 A;  3IR6 A;  2AE0 X;  5C18 A;  1G8J A;  2R93 A;  1TMO A;  2E7Z A;  5GLY A;  1YLE A;  2YUJ A;  1UHE A;  5GLX A;  2A6E D;  1S3S A;  4NOH A;  2O5J D;  2BH0 A;  2PIC A;  1AW8 B;  4AVR A;  1E5V A;  2BE5 D;  1TWC A;  2JIQ A;  3GTG A;  1ZC1 A;  3CQZ A;  4AZD A;  3X2P A;  2E2H A;  2HCZ X;  3FKI A;  2JIR A;  2V3V A;  2KI8 A;  2VUM A;  4DMR A;  1AA6 A;  1KQG A;  4KOD A;  2C45 A;  2VPX A;  2NVX A;  3GTL A;  2JA5 A;  2ENG A;  1I3Q A;  2JIO A;  1R9T A;  4CRZ A;  2VPW A;  2A69 D;  2JIM A;  4CRY G;  2NAP A;  4CS0 A;  2A68 D;  1Y1W A;  5FTM A;  2IV2 X;  1SIW A;  4JS7 A;  3SUK A;  2G5D A;  1TWF A;  5B6C A;  5FTN A;  1CZ4 A;  4JP6 A;  4FG4 A;  3QWZ A;  1SFO A;  3GTP A;  4JP7 A;  3X2N A;  2DMR A;  3HU3 A;  1IW7 D;  1SMY D;  1YNN D;  1BW3 A;  2WB1 A;  4FFT A;  3X2G A;  5FTK A;  4QIW A;  1HD5 A;  1OA7 A;  5H4U A;  1L8F A;  2E2I A;  2NVY A;  1DMS A;  3SUM A;  1WLF A;  5DYG A;  2B63 A;  4JCW A;  1WC2 A;  2EEO B;  1QCS A;  4C2M A;  3X2I A;  2Y0S A;  3SUL A;  3X2L A;  1PQE A;  3X2J A;  1FDI A;  3D30 A;  1QDN A;  1Q16 A;  3CF2 A;  3TIW A;  2NYA A;  4AYB A;  4AAY A;  1UHD A;  1N10 A;  1PQF A;  2PI8 A;  4D7Z B;  4GA6 A;  4GA5 A;  5EPP A;  3GTO A;  1TWH A;  4FER A;  1I50 A;  1H5N A;  4ZM7 A;  1K83 A;  5T5I D;  1CZ5 A;  3X2O A;  1BW4 A;  1CR5 A;  2R92 A;  1PPY A;  5DYI A;  4KLN A;  3M3G A;  3ENG A;  4L48 A;  1WCM A;  2V45 A;  3O5A A;  2A6H D;  1DMR A;  3GTM A;  2PJH B;  3QQ7 A;  1OGY A;  1VC3 B;  3H0G A;  1E61 A;  1R27 A;  1YNJ D;  3QC8 A;  1TWG A;  2JA7 A;  1E60 A;  2PNW A;  5GM9 A;  2CW0 D;  3HU1 A;  3DMR A;  5GLF A;  2JIP A;  3HKZ A;  4FG2 A;  3QQ8 A;  1H0H A;  1Y1V A;  5FTJ A;  1ZYR D;  1PYU B;  3HU2 A;  1PT0 A;  4JJO A;  1EU1 A;  5T5M D;  3GTJ A;  3X2M A;  2G6G A;  1PYQ A;  2PJJ A;  5C1B A;  4KO8 A;  1KQF A;  3PLX B;  4ENG A;  3ML1 A;  1G8K A;  4RV0 A;  1Y5I A;  2R7Z A;  3GTK A;  3X2K A;  4AOK B;  2VPZ A;  1OA9 A;  3IR5 A;  2GAE A;  3X2H A;  2VPY A;  4KDI A;  1Y4Z A;  1TWA A;  2PMZ A;  3CZB A;  1FDO A;  4KDL A;  3GTQ A;  1PQH A;  2WAQ A;  2KQA A;  1R7R A;  1E18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...