2PJJA

E. coli lytic transglycosylase mlta-d308a in apo-1 form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 94
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pjjA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pjjA02
3ENGA 3X2KA 1L8FA 1HD5A 2BH0A 3X2LA 3SULA 3X2GA 2G6GA 4JS7A 2KQAA 3X2IA 2ENGA 1OA7A 3M3GA 3SUKA 3X2OA 4ENGA 2PJJA 4FERA 2GAEA 4FG2A 1BW3A 3X2HA 4AVRA 4ZM7A 3SUMA 3X2MA 2PI8A 3X2JA 2HCZX 2PICA 3X2NA 3SUJA 2G5DA 1OA9A 3D30A 1WC2A 1BW4A 4JJOA 1N10A 5GLYA 4JP6A 3CZBA 4FG4A 5GLXA 4L48A 4JP7A 2PNWA 3X2PA 5GM9A 2AE0X 5H4UA 4FFTA 4JCWA
chains in the Genus database with same CATH superfamily
2JA6A 2E2IA 1D6KA 2JA5A 1QDNA 1Y1VA 4NOHA 4AOKB 1FDOA 2R93A 5DYGA 5IZNA 2V45A 3J7ZV 1QCSA 3X2OA 2A68D 3M3GA 4ENGA 1I3QA 1Y1WA 4WFBS 3GTMA 3CF5S 4IOAS 4JYZA 2VPXA 1YNND 2WAQA 1DFUP 3X2MA 1UHEA 1E18A 2Z0YA 3X2NA 3GTJA 1CZ5A 1TWAA 2EGVA 4IOCS 1BW4A 5JVHS 2EGWA 2E2HA 2VPYA 2ZJRS 5GADW 1DMRA 4D7ZB 4E8BA 1OGYA 1SIWA 3W2WB 1QTQA 3KW2A 4JP7A 1E60A 1PQFA 2PNWA 3X2PA 3IR5A 3X1LB 2YU9A 3HKZA 5H4UA 4FFTA 1Y4ZA 1O0CA 1H0HA 1WLFA 2BE5D 5T5ID 1L8FA 1HD5A 5DM6S 3ML1A 3SULA 1R7RA 1PYQA 2JIMA 2O5JD 1E5VA 4JS7A 2VPWA 3GTKA 2ENGA 1OA7A 2Y0SA 3SUKA 2JA7A 4J3CA 1ZC1A 2VUMA 1PT0A 2JIRA 2GAEA 2NWAA 1PPYA 1IW7D 1V6ZA 4AONB 4JXXA 4KODA 1ZJWA 1R27A 2PI8A 3PIOS 2HCZX 4CS0A 2PICA 5FTMA 4H4KA 1CR5A 4GA5A 1OA9A 1VHKA 1S3SA 2YUJA 3GTQA 5JVGS 5C18A 4V194 1PQEA 5GLYA 3CZBA 1K83A 1CZ4A 5GLXA 2KI8A 4L48A 1WCMA 1DMSA 3TIWA 3QC8A 3QWZA 2E7ZA 1PYUB 4JCWA 5FTKA 1GTRA 1FEUA 1G8KA 1KQFA 5GAHW 2PMZA 1YLEA 4CRYG 1QRUA 3HU2A 5DYIA 1EU1A 3X2GA 1VC3B 4WF9S 5FTLA 2KQAA 5C1BA 3CQZA 2C45A 3HU3A 2PJJA 2JIOA 5GAGW 5FTNA 4FG2A 3GTPA 3X2HA 1BW3A 1Q16A 4ZM7A 1EUQA 2NVYA 2VPZA 2A6ED 1AW8B 4H3SA 3GTGA 5EPPA 3W2VB 2G5DA 3GTLA 3HU1A 4GA6A 2JIPA 4WFNS 3D30A 1PT1A 1TWCA 2A69D 3PIPS 2NYAA 2R92A 1N10A 2V3VA 3IR7A 4JP6A 1TWGA 1NXZA 4P2BA 4WFAS 2ZJQS 4FG4A 3OUGA 4QIWA 1G8JA 5FTJA 1E32A 4RV0A 3QQ8A 4L69A 3PLXB 4U67S 5DM7S 5GM9A 4KLNA 1B75A 3IR6A 3DMRA 4C2MA 1R9TA 2DMRA 3ENGA 3X2KA 2PJHB 3FKIA 5HL7S 2BH0A 3X2LA 4WCES 2RE8A 2ZJPS 2G6GA 5T5MD 3X2IA 1VHYA 3DLLS 4JXZA 4AYBA 2CX8A 4KDLA 1KQGA 4FERA 4AAYA 2EEOB 4AVRA 2NVXA 3SUMA 1QRSA 4AZDA 2R7ZA 1NYLA 5B6CA 3AIIA 1GTSA 1SMYD 3X2JA 1EXDA 2IV2X 1TWFA 4UY88 3SUJA 5BNZA 3O5AA 1O0BA 1WC2A 2HZ7A 1TMOA 4JJOA 2RD2A 5GAEW 1Y5IA 3QQ7A 4CRZA 3CF2A 4DMRA 1QRTA 1AA6A 2A6HD 1I50A 1UDXA 1FDIA 2JIQA 1H5NA 1SFOA 5GLFA 3GTOA 4IO9S 1TWHA 1EUYA 1Z85A 2B63A 1ZYRD 1YNJD 2CW0D 2AE0X 2NAPA 2WB1A 1E61A 1PQHA 1UHDA 3H0GA 4KDIA 4KO8A 3TM7B
chains in the Genus database with same CATH topology
2JA6A 2E2IA 2JA5A 1QDNA 1Y1VA 4NOHA 4AOKB 1FDOA 2R93A 5DYGA 2V45A 3X2OA 1QCSA 2A68D 3M3GA 4ENGA 1I3QA 1Y1WA 3GTMA 2VPXA 1YNND 2WAQA 3X2MA 1UHEA 1E18A 3X2NA 3GTJA 1CZ5A 1TWAA 1BW4A 2E2HA 2VPYA 1DMRA 4D7ZB 1OGYA 1SIWA 4JP7A 1E60A 1PQFA 2PNWA 3X2PA 3IR5A 2YU9A 3HKZA 5H4UA 4FFTA 1Y4ZA 1H0HA 1WLFA 2BE5D 5T5ID 1L8FA 1HD5A 3ML1A 3SULA 1R7RA 1PYQA 2JIMA 2O5JD 1E5VA 4JS7A 2VPWA 3GTKA 2ENGA 1OA7A 3SUKA 2Y0SA 2JA7A 1ZC1A 2VUMA 1PT0A 2JIRA 2GAEA 1PPYA 1IW7D 4AONB 4KODA 1R27A 2PI8A 2HCZX 4CS0A 2PICA 5FTMA 1CR5A 4GA5A 1OA9A 1S3SA 2YUJA 3GTQA 5C18A 5GLYA 1PQEA 3CZBA 1K83A 5GLXA 1CZ4A 2KI8A 4L48A 1WCMA 1DMSA 3TIWA 3QC8A 3QWZA 2E7ZA 1PYUB 4JCWA 5FTKA 1G8KA 1KQFA 2PMZA 1YLEA 4CRYG 3HU2A 5DYIA 1EU1A 3X2GA 1VC3B 5FTLA 2KQAA 5C1BA 3CQZA 2C45A 3HU3A 2PJJA 2JIOA 1BW3A 4FG2A 5FTNA 3X2HA 3GTPA 4ZM7A 1Q16A 2NVYA 2VPZA 2A6ED 1AW8B 3GTGA 5EPPA 2G5DA 3GTLA 3HU1A 4GA6A 2JIPA 3D30A 1PT1A 1TWCA 2A69D 2NYAA 2R92A 1N10A 2V3VA 3IR7A 4JP6A 1TWGA 4FG4A 3OUGA 4QIWA 1G8JA 5FTJA 1E32A 4RV0A 3QQ8A 3PLXB 5GM9A 4KLNA 3IR6A 3DMRA 4C2MA 1R9TA 2DMRA 3ENGA 3X2KA 2PJHB 3FKIA 2BH0A 3X2LA 2G6GA 3X2IA 5T5MD 4AYBA 4KDLA 1KQGA 4FERA 4AAYA 2EEOB 4AVRA 2NVXA 3SUMA 4AZDA 2R7ZA 5B6CA 3X2JA 1SMYD 2IV2X 1TWFA 3SUJA 3O5AA 1WC2A 1TMOA 4JJOA 1Y5IA 3QQ7A 4CRZA 3CF2A 4DMRA 1AA6A 2A6HD 1I50A 1FDIA 2JIQA 1H5NA 1SFOA 5GLFA 3GTOA 1TWHA 2B63A 1ZYRD 1YNJD 2CW0D 2AE0X 2NAPA 2WB1A 1E61A 1PQHA 1UHDA 3H0GA 4KDIA 4KO8A 3TM7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ENG A;  3X2K A;  1L8F A;  1HD5 A;  2BH0 A;  3X2L A;  3SUL A;  3X2G A;  2G6G A;  4JS7 A;  2KQA A;  3X2I A;  2ENG A;  1OA7 A;  3M3G A;  3SUK A;  3X2O A;  4ENG A;  2PJJ A;  4FER A;  2GAE A;  4FG2 A;  1BW3 A;  3X2H A;  4AVR A;  4ZM7 A;  3SUM A;  3X2M A;  2PI8 A;  3X2J A;  2HCZ X;  2PIC A;  3X2N A;  3SUJ A;  2G5D A;  1OA9 A;  3D30 A;  1WC2 A;  1BW4 A;  4JJO A;  1N10 A;  5GLY A;  4JP6 A;  3CZB A;  4FG4 A;  5GLX A;  4L48 A;  4JP7 A;  2PNW A;  3X2P A;  5GM9 A;  2AE0 X;  5H4U A;  4FFT A;  4JCW A; 
#chains in the Genus database with same CATH topology
 2JA6 A;  2E2I A;  1D6K A;  2JA5 A;  1QDN A;  1Y1V A;  4NOH A;  4AOK B;  1FDO A;  2R93 A;  5DYG A;  5IZN A;  2V45 A;  3J7Z V;  1QCS A;  3X2O A;  2A68 D;  3M3G A;  4ENG A;  1I3Q A;  1Y1W A;  4WFB S;  3GTM A;  3CF5 S;  4IOA S;  4JYZ A;  2VPX A;  1YNN D;  2WAQ A;  1DFU P;  3X2M A;  1UHE A;  1E18 A;  2Z0Y A;  3X2N A;  3GTJ A;  1CZ5 A;  1TWA A;  2EGV A;  4IOC S;  1BW4 A;  5JVH S;  2EGW A;  2E2H A;  2VPY A;  2ZJR S;  5GAD W;  1DMR A;  4D7Z B;  4E8B A;  1OGY A;  1SIW A;  3W2W B;  1QTQ A;  3KW2 A;  4JP7 A;  1E60 A;  1PQF A;  2PNW A;  3X2P A;  3IR5 A;  3X1L B;  2YU9 A;  3HKZ A;  5H4U A;  4FFT A;  1Y4Z A;  1O0C A;  1H0H A;  1WLF A;  2BE5 D;  5T5I D;  1L8F A;  1HD5 A;  5DM6 S;  3ML1 A;  3SUL A;  1R7R A;  1PYQ A;  2JIM A;  2O5J D;  1E5V A;  4JS7 A;  2VPW A;  3GTK A;  2ENG A;  1OA7 A;  2Y0S A;  3SUK A;  2JA7 A;  4J3C A;  1ZC1 A;  2VUM A;  1PT0 A;  2JIR A;  2GAE A;  2NWA A;  1PPY A;  1IW7 D;  1V6Z A;  4AON B;  4JXX A;  4KOD A;  1ZJW A;  1R27 A;  2PI8 A;  3PIO S;  2HCZ X;  4CS0 A;  2PIC A;  5FTM A;  4H4K A;  1CR5 A;  4GA5 A;  1OA9 A;  1VHK A;  1S3S A;  2YUJ A;  3GTQ A;  5JVG S;  5C18 A;  4V19 4;  1PQE A;  5GLY A;  3CZB A;  1K83 A;  1CZ4 A;  5GLX A;  2KI8 A;  4L48 A;  1WCM A;  1DMS A;  3TIW A;  3QC8 A;  3QWZ A;  2E7Z A;  1PYU B;  4JCW A;  5FTK A;  1GTR A;  1FEU A;  1G8K A;  1KQF A;  5GAH W;  2PMZ A;  1YLE A;  4CRY G;  1QRU A;  3HU2 A;  5DYI A;  1EU1 A;  3X2G A;  1VC3 B;  4WF9 S;  5FTL A;  2KQA A;  5C1B A;  3CQZ A;  2C45 A;  3HU3 A;  2PJJ A;  2JIO A;  5GAG W;  5FTN A;  4FG2 A;  3GTP A;  3X2H A;  1BW3 A;  1Q16 A;  4ZM7 A;  1EUQ A;  2NVY A;  2VPZ A;  2A6E D;  1AW8 B;  4H3S A;  3GTG A;  5EPP A;  3W2V B;  2G5D A;  3GTL A;  3HU1 A;  4GA6 A;  2JIP A;  4WFN S;  3D30 A;  1PT1 A;  1TWC A;  2A69 D;  3PIP S;  2NYA A;  2R92 A;  1N10 A;  2V3V A;  3IR7 A;  4JP6 A;  1TWG A;  1NXZ A;  4P2B A;  4WFA S;  2ZJQ S;  4FG4 A;  3OUG A;  4QIW A;  1G8J A;  5FTJ A;  1E32 A;  4RV0 A;  3QQ8 A;  4L69 A;  3PLX B;  4U67 S;  5DM7 S;  5GM9 A;  4KLN A;  1B75 A;  3IR6 A;  3DMR A;  4C2M A;  1R9T A;  2DMR A;  3ENG A;  3X2K A;  2PJH B;  3FKI A;  5HL7 S;  2BH0 A;  3X2L A;  4WCE S;  2RE8 A;  2ZJP S;  2G6G A;  5T5M D;  3X2I A;  1VHY A;  3DLL S;  4JXZ A;  4AYB A;  2CX8 A;  4KDL A;  1KQG A;  4FER A;  4AAY A;  2EEO B;  4AVR A;  2NVX A;  3SUM A;  1QRS A;  4AZD A;  2R7Z A;  1NYL A;  5B6C A;  3AII A;  1GTS A;  1SMY D;  3X2J A;  1EXD A;  2IV2 X;  1TWF A;  4UY8 8;  3SUJ A;  5BNZ A;  3O5A A;  1O0B A;  1WC2 A;  2HZ7 A;  1TMO A;  4JJO A;  2RD2 A;  5GAE W;  1Y5I A;  3QQ7 A;  4CRZ A;  3CF2 A;  4DMR A;  1QRT A;  1AA6 A;  2A6H D;  1I50 A;  1UDX A;  1FDI A;  2JIQ A;  1H5N A;  1SFO A;  5GLF A;  3GTO A;  4IO9 S;  1TWH A;  1EUY A;  1Z85 A;  2B63 A;  1ZYR D;  1YNJ D;  2CW0 D;  2AE0 X;  2NAP A;  2WB1 A;  1E61 A;  1PQH A;  1UHD A;  3H0G A;  4KDI A;  4KO8 A;  3TM7 B; 
#chains in the Genus database with same CATH homology
 2JA6 A;  2E2I A;  2JA5 A;  1QDN A;  1Y1V A;  4NOH A;  4AOK B;  1FDO A;  2R93 A;  5DYG A;  2V45 A;  3X2O A;  1QCS A;  2A68 D;  3M3G A;  4ENG A;  1I3Q A;  1Y1W A;  3GTM A;  2VPX A;  1YNN D;  2WAQ A;  3X2M A;  1UHE A;  1E18 A;  3X2N A;  3GTJ A;  1CZ5 A;  1TWA A;  1BW4 A;  2E2H A;  2VPY A;  1DMR A;  4D7Z B;  1OGY A;  1SIW A;  4JP7 A;  1E60 A;  1PQF A;  2PNW A;  3X2P A;  3IR5 A;  2YU9 A;  3HKZ A;  5H4U A;  4FFT A;  1Y4Z A;  1H0H A;  1WLF A;  2BE5 D;  5T5I D;  1L8F A;  1HD5 A;  3ML1 A;  3SUL A;  1R7R A;  1PYQ A;  2JIM A;  2O5J D;  1E5V A;  4JS7 A;  2VPW A;  3GTK A;  2ENG A;  1OA7 A;  3SUK A;  2Y0S A;  2JA7 A;  1ZC1 A;  2VUM A;  1PT0 A;  2JIR A;  2GAE A;  1PPY A;  1IW7 D;  4AON B;  4KOD A;  1R27 A;  2PI8 A;  2HCZ X;  4CS0 A;  2PIC A;  5FTM A;  1CR5 A;  4GA5 A;  1OA9 A;  1S3S A;  2YUJ A;  3GTQ A;  5C18 A;  5GLY A;  1PQE A;  3CZB A;  1K83 A;  5GLX A;  1CZ4 A;  2KI8 A;  4L48 A;  1WCM A;  1DMS A;  3TIW A;  3QC8 A;  3QWZ A;  2E7Z A;  1PYU B;  4JCW A;  5FTK A;  1G8K A;  1KQF A;  2PMZ A;  1YLE A;  4CRY G;  3HU2 A;  5DYI A;  1EU1 A;  3X2G A;  1VC3 B;  5FTL A;  2KQA A;  5C1B A;  3CQZ A;  2C45 A;  3HU3 A;  2PJJ A;  2JIO A;  1BW3 A;  4FG2 A;  5FTN A;  3X2H A;  3GTP A;  4ZM7 A;  1Q16 A;  2NVY A;  2VPZ A;  2A6E D;  1AW8 B;  3GTG A;  5EPP A;  2G5D A;  3GTL A;  3HU1 A;  4GA6 A;  2JIP A;  3D30 A;  1PT1 A;  1TWC A;  2A69 D;  2NYA A;  2R92 A;  1N10 A;  2V3V A;  3IR7 A;  4JP6 A;  1TWG A;  4FG4 A;  3OUG A;  4QIW A;  1G8J A;  5FTJ A;  1E32 A;  4RV0 A;  3QQ8 A;  3PLX B;  5GM9 A;  4KLN A;  3IR6 A;  3DMR A;  4C2M A;  1R9T A;  2DMR A;  3ENG A;  3X2K A;  2PJH B;  3FKI A;  2BH0 A;  3X2L A;  2G6G A;  3X2I A;  5T5M D;  4AYB A;  4KDL A;  1KQG A;  4FER A;  4AAY A;  2EEO B;  4AVR A;  2NVX A;  3SUM A;  4AZD A;  2R7Z A;  5B6C A;  3X2J A;  1SMY D;  2IV2 X;  1TWF A;  3SUJ A;  3O5A A;  1WC2 A;  1TMO A;  4JJO A;  1Y5I A;  3QQ7 A;  4CRZ A;  3CF2 A;  4DMR A;  1AA6 A;  2A6H D;  1I50 A;  1FDI A;  2JIQ A;  1H5N A;  1SFO A;  5GLF A;  3GTO A;  1TWH A;  2B63 A;  1ZYR D;  1YNJ D;  2CW0 D;  2AE0 X;  2NAP A;  2WB1 A;  1E61 A;  1PQH A;  1UHD A;  3H0G A;  4KDI A;  4KO8 A;  3TM7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...