2AE0X

Crystal structure of mlta from escherichia coli reveals a unique lytic transglycosylase fold
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MltA from Escherichia coli Reveals a Unique Lytic Transglycosylase Fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 95
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03562 MltA MltA specific insert domain
X PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2ae0X01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2ae0X02
2KQAA 3SUMA 5H4UA 3SUJA 1WC2A 3CZBA 3X2OA 3X2LA 4ENGA 4ZM7A 2PNWA 3X2HA 1HD5A 3X2PA 1OA7A 2BH0A 3X2NA 3X2GA 3ENGA 4JCWA 3X2KA 2HCZX 3X2JA 3D30A 1BW3A 4JP7A 4AVRA 3M3GA 3SUKA 2PJJA 5GLXA 4FG2A 2PICA 5GM9A 1L8FA 4FERA 4JS7A 1N10A 2G6GA 1BW4A 2PI8A 2ENGA 4FG4A 4JJOA 4JP6A 5GLYA 1OA9A 3X2IA 3SULA 2G5DA 4L48A 3X2MA 2GAEA 2AE0X 4FFTA
chains in the Genus database with same CATH superfamily
2KQAA 3QQ7A 1AW8B 2R7ZA 1YLEA 1ZJWA 4DMRA 1QRUA 1WC2A 3CQZA 1TWFA 2NAPA 5FTMA 2A69D 1S3SA 3QQ8A 3QWZA 2WB1A 2CW0D 1Y1VA 2BH0A 2V45A 2R93A 3TIWA 3X2GA 1PPYA 5IZNA 4V194 5T5ID 1G8JA 1R27A 1TWAA 2JIPA 3GTMA 2A6ED 4AOKB 1O0CA 2HCZX 1DMSA 4KLNA 4H4KA 2YU9A 1ZC1A 3DLLS 2V3VA 3GTOA 2PICA 2Y0SA 2NYAA 5GM9A 1B75A 4AZDA 2VPYA 4RV0A 4JYZA 2KI8A 2BE5D 2PI8A 2ENGA 3ML1A 4JJOA 4JP6A 4KO8A 1R9TA 5C18A 2JA6A 4C2MA 1PT0A 2Z0YA 4AAYA 3GTPA 5BNZA 1YNND 4GA6A 4L48A 5C1BA 2GAEA 1TWCA 2EGVA 2EEOB 1DFUP 2RD2A 3SUMA 2NWAA 2EGWA 1Y5IA 4CS0A 3DMRA 3CZBA 3PLXB 1SIWA 4WCES 5FTNA 1GTRA 3X2HA 1CZ4A 2JIQA 1WLFA 2NVYA 2ZJQS 5JVHS 2VPXA 3AIIA 4J3CA 1QRSA 1SMYD 2YUJA 1FDIA 3ENGA 1H5NA 3HKZA 2C45A 3GTKA 1CZ5A 2ZJPS 1NXZA 2JIMA 2PMZA 3CF2A 1TWHA 3X2JA 1Q16A 1UHDA 2DMRA 1D6KA 3M3GA 3J7ZV 4FG2A 1QCSA 1L8FA 4JS7A 1N10A 4U67S 3CF5S 3IR5A 1BW4A 1I50A 1PYQA 3X2IA 4JXXA 4JXZA 2G5DA 3HU1A 1GTSA 1PQFA 2E7ZA 2JIRA 2E2HA 4E8BA 1QDNA 4FFTA 2E2IA 5H4UA 4WFNS 2VUMA 2JA7A 5GAEW 1IW7D 1E61A 1AA6A 2JA5A 3PIPS 4AYBA 5T5MD 1HD5A 1PQEA 3X2PA 1OA7A 3OUGA 5DYGA 1V6ZA 5B6CA 2HZ7A 1FEUA 5JVGS 4UY88 2R92A 2CX8A 4KDLA 4CRZA 1PT1A 3X2KA 3O5AA 3QC8A 1QTQA 2WAQA 1ZYRD 1FDOA 1H0HA 1VC3B 4JP7A 3GTJA 1BW3A 1E60A 4H3SA 1CR5A 1O0BA 1Z85A 2JIOA 1WCMA 2A6HD 2O5JD 3W2WB 4WFAS 5DM7S 1KQGA 1EU1A 2G6GA 1G8KA 1SFOA 2ZJRS 5EPPA 5GLYA 4P2BA 1YNJD 5GAGW 3KW2A 3PIOS 2AE0X 5FTJA 1UHEA 1DMRA 4NOHA 1NYLA 4WFBS 2NVXA 3SUJA 4D7ZB 1Y1WA 1VHYA 3FKIA 3X2OA 1TWGA 2IV2X 3H0GA 3X2LA 4ENGA 4ZM7A 3GTLA 1R7RA 2PNWA 1E32A 5GLFA 1UDXA 3HU2A 4AONB 4QIWA 5GAHW 1EUQA 5HL7S 1KQFA 1QRTA 1PQHA 3X2NA 4IOCS 1I3QA 2B63A 5FTLA 4L69A 4WF9S 2PJHB 4JCWA 4KODA 1K83A 3W2VB 5FTKA 1EXDA 2RE8A 3GTGA 3X1LB 3D30A 4AVRA 4GA5A 3SUKA 2PJJA 5GLXA 3GTQA 1E18A 2A68D 4CRYG 4FERA 5DM6S 3IR6A 5GADW 1Y4ZA 4IO9S 5DYIA 1TMOA 4FG4A 1VHKA 1OA9A 3HU3A 4KDIA 3SULA 1OGYA 2VPWA 3IR7A 1E5VA 3TM7B 3X2MA 4IOAS 1EUYA 1PYUB 2VPZA
chains in the Genus database with same CATH topology
2KQAA 3QQ7A 1AW8B 2R7ZA 1YLEA 4DMRA 1WC2A 3CQZA 1TWFA 2NAPA 5FTMA 2A69D 1S3SA 3QQ8A 3QWZA 2WB1A 2CW0D 1Y1VA 2BH0A 2V45A 2R93A 3TIWA 3X2GA 1PPYA 5T5ID 1G8JA 1R27A 1TWAA 2JIPA 3GTMA 2A6ED 4AOKB 2HCZX 1DMSA 4KLNA 2YU9A 1ZC1A 2V3VA 3GTOA 2PICA 5GM9A 2NYAA 2Y0SA 4AZDA 2VPYA 4RV0A 2KI8A 2BE5D 2PI8A 2ENGA 4JP6A 4JJOA 3ML1A 4KO8A 1R9TA 5C18A 2JA6A 4C2MA 1PT0A 4AAYA 3GTPA 1YNND 4L48A 4GA6A 5C1BA 2GAEA 1TWCA 2EEOB 3SUMA 1Y5IA 4CS0A 3DMRA 3CZBA 3PLXB 1SIWA 5FTNA 3X2HA 1CZ4A 2JIQA 1WLFA 2NVYA 2VPXA 1SMYD 3ENGA 1FDIA 2YUJA 1H5NA 3HKZA 2C45A 3GTKA 1CZ5A 2JIMA 2PMZA 3CF2A 3X2JA 1TWHA 1Q16A 1UHDA 2DMRA 3M3GA 4FG2A 1QCSA 1L8FA 4JS7A 1N10A 1BW4A 3IR5A 1I50A 1PYQA 3X2IA 2G5DA 3HU1A 1PQFA 2E7ZA 2JIRA 2E2HA 1QDNA 4FFTA 2E2IA 5H4UA 2VUMA 2JA7A 1IW7D 1E61A 1AA6A 2JA5A 4AYBA 5T5MD 1HD5A 3X2PA 1PQEA 1OA7A 3OUGA 5DYGA 5B6CA 2R92A 4KDLA 4CRZA 1PT1A 3X2KA 3O5AA 3QC8A 2WAQA 1ZYRD 1BW3A 1FDOA 4JP7A 1H0HA 1VC3B 3GTJA 1E60A 1CR5A 2JIOA 1WCMA 2A6HD 2O5JD 1KQGA 2G6GA 1EU1A 1G8KA 1SFOA 5EPPA 5GLYA 1YNJD 2AE0X 5FTJA 1UHEA 1DMRA 4NOHA 2NVXA 3SUJA 4D7ZB 1Y1WA 3FKIA 3X2OA 3X2LA 1TWGA 4ENGA 3H0GA 4ZM7A 2IV2X 3GTLA 2PNWA 1R7RA 1E32A 5GLFA 3HU2A 4AONB 4QIWA 1KQFA 1PQHA 3X2NA 1I3QA 2B63A 5FTLA 2PJHB 4JCWA 4KODA 1K83A 5FTKA 3GTGA 3D30A 4AVRA 4GA5A 3SUKA 2PJJA 5GLXA 3GTQA 1E18A 2A68D 4CRYG 4FERA 3IR6A 1Y4ZA 5DYIA 1TMOA 4FG4A 1OA9A 3HU3A 4KDIA 3SULA 1OGYA 2VPWA 3IR7A 1E5VA 3TM7B 3X2MA 1PYUB 2VPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQA A;  3SUM A;  5H4U A;  3SUJ A;  1WC2 A;  3CZB A;  3X2O A;  3X2L A;  4ENG A;  4ZM7 A;  2PNW A;  3X2H A;  1HD5 A;  3X2P A;  1OA7 A;  2BH0 A;  3X2N A;  3X2G A;  3ENG A;  4JCW A;  3X2K A;  2HCZ X;  3X2J A;  3D30 A;  1BW3 A;  4JP7 A;  4AVR A;  3M3G A;  3SUK A;  2PJJ A;  5GLX A;  4FG2 A;  2PIC A;  5GM9 A;  1L8F A;  4FER A;  4JS7 A;  1N10 A;  2G6G A;  1BW4 A;  2PI8 A;  2ENG A;  4FG4 A;  4JJO A;  4JP6 A;  5GLY A;  1OA9 A;  3X2I A;  3SUL A;  2G5D A;  4L48 A;  3X2M A;  2GAE A;  2AE0 X;  4FFT A; 
#chains in the Genus database with same CATH topology
 2KQA A;  3QQ7 A;  1AW8 B;  2R7Z A;  1YLE A;  1ZJW A;  4DMR A;  1QRU A;  1WC2 A;  3CQZ A;  1TWF A;  2NAP A;  5FTM A;  2A69 D;  1S3S A;  3QQ8 A;  3QWZ A;  2WB1 A;  2CW0 D;  1Y1V A;  2BH0 A;  2V45 A;  2R93 A;  3TIW A;  3X2G A;  1PPY A;  5IZN A;  4V19 4;  5T5I D;  1G8J A;  1R27 A;  1TWA A;  2JIP A;  3GTM A;  2A6E D;  4AOK B;  1O0C A;  2HCZ X;  1DMS A;  4KLN A;  4H4K A;  2YU9 A;  1ZC1 A;  3DLL S;  2V3V A;  3GTO A;  2PIC A;  2Y0S A;  2NYA A;  5GM9 A;  1B75 A;  4AZD A;  2VPY A;  4RV0 A;  4JYZ A;  2KI8 A;  2BE5 D;  2PI8 A;  2ENG A;  3ML1 A;  4JJO A;  4JP6 A;  4KO8 A;  1R9T A;  5C18 A;  2JA6 A;  4C2M A;  1PT0 A;  2Z0Y A;  4AAY A;  3GTP A;  5BNZ A;  1YNN D;  4GA6 A;  4L48 A;  5C1B A;  2GAE A;  1TWC A;  2EGV A;  2EEO B;  1DFU P;  2RD2 A;  3SUM A;  2NWA A;  2EGW A;  1Y5I A;  4CS0 A;  3DMR A;  3CZB A;  3PLX B;  1SIW A;  4WCE S;  5FTN A;  1GTR A;  3X2H A;  1CZ4 A;  2JIQ A;  1WLF A;  2NVY A;  2ZJQ S;  5JVH S;  2VPX A;  3AII A;  4J3C A;  1QRS A;  1SMY D;  2YUJ A;  1FDI A;  3ENG A;  1H5N A;  3HKZ A;  2C45 A;  3GTK A;  1CZ5 A;  2ZJP S;  1NXZ A;  2JIM A;  2PMZ A;  3CF2 A;  1TWH A;  3X2J A;  1Q16 A;  1UHD A;  2DMR A;  1D6K A;  3M3G A;  3J7Z V;  4FG2 A;  1QCS A;  1L8F A;  4JS7 A;  1N10 A;  4U67 S;  3CF5 S;  3IR5 A;  1BW4 A;  1I50 A;  1PYQ A;  3X2I A;  4JXX A;  4JXZ A;  2G5D A;  3HU1 A;  1GTS A;  1PQF A;  2E7Z A;  2JIR A;  2E2H A;  4E8B A;  1QDN A;  4FFT A;  2E2I A;  5H4U A;  4WFN S;  2VUM A;  2JA7 A;  5GAE W;  1IW7 D;  1E61 A;  1AA6 A;  2JA5 A;  3PIP S;  4AYB A;  5T5M D;  1HD5 A;  1PQE A;  3X2P A;  1OA7 A;  3OUG A;  5DYG A;  1V6Z A;  5B6C A;  2HZ7 A;  1FEU A;  5JVG S;  4UY8 8;  2R92 A;  2CX8 A;  4KDL A;  4CRZ A;  1PT1 A;  3X2K A;  3O5A A;  3QC8 A;  1QTQ A;  2WAQ A;  1ZYR D;  1FDO A;  1H0H A;  1VC3 B;  4JP7 A;  3GTJ A;  1BW3 A;  1E60 A;  4H3S A;  1CR5 A;  1O0B A;  1Z85 A;  2JIO A;  1WCM A;  2A6H D;  2O5J D;  3W2W B;  4WFA S;  5DM7 S;  1KQG A;  1EU1 A;  2G6G A;  1G8K A;  1SFO A;  2ZJR S;  5EPP A;  5GLY A;  4P2B A;  1YNJ D;  5GAG W;  3KW2 A;  3PIO S;  2AE0 X;  5FTJ A;  1UHE A;  1DMR A;  4NOH A;  1NYL A;  4WFB S;  2NVX A;  3SUJ A;  4D7Z B;  1Y1W A;  1VHY A;  3FKI A;  3X2O A;  1TWG A;  2IV2 X;  3H0G A;  3X2L A;  4ENG A;  4ZM7 A;  3GTL A;  1R7R A;  2PNW A;  1E32 A;  5GLF A;  1UDX A;  3HU2 A;  4AON B;  4QIW A;  5GAH W;  1EUQ A;  5HL7 S;  1KQF A;  1QRT A;  1PQH A;  3X2N A;  4IOC S;  1I3Q A;  2B63 A;  5FTL A;  4L69 A;  4WF9 S;  2PJH B;  4JCW A;  4KOD A;  1K83 A;  3W2V B;  5FTK A;  1EXD A;  2RE8 A;  3GTG A;  3X1L B;  3D30 A;  4AVR A;  4GA5 A;  3SUK A;  2PJJ A;  5GLX A;  3GTQ A;  1E18 A;  2A68 D;  4CRY G;  4FER A;  5DM6 S;  3IR6 A;  5GAD W;  1Y4Z A;  4IO9 S;  5DYI A;  1TMO A;  4FG4 A;  1VHK A;  1OA9 A;  3HU3 A;  4KDI A;  3SUL A;  1OGY A;  2VPW A;  3IR7 A;  1E5V A;  3TM7 B;  3X2M A;  4IOA S;  1EUY A;  1PYU B;  2VPZ A; 
#chains in the Genus database with same CATH homology
 2KQA A;  3QQ7 A;  1AW8 B;  2R7Z A;  1YLE A;  4DMR A;  1WC2 A;  3CQZ A;  1TWF A;  2NAP A;  5FTM A;  2A69 D;  1S3S A;  3QQ8 A;  3QWZ A;  2WB1 A;  2CW0 D;  1Y1V A;  2BH0 A;  2V45 A;  2R93 A;  3TIW A;  3X2G A;  1PPY A;  5T5I D;  1G8J A;  1R27 A;  1TWA A;  2JIP A;  3GTM A;  2A6E D;  4AOK B;  2HCZ X;  1DMS A;  4KLN A;  2YU9 A;  1ZC1 A;  2V3V A;  3GTO A;  2PIC A;  5GM9 A;  2NYA A;  2Y0S A;  4AZD A;  2VPY A;  4RV0 A;  2KI8 A;  2BE5 D;  2PI8 A;  2ENG A;  4JP6 A;  4JJO A;  3ML1 A;  4KO8 A;  1R9T A;  5C18 A;  2JA6 A;  4C2M A;  1PT0 A;  4AAY A;  3GTP A;  1YNN D;  4L48 A;  4GA6 A;  5C1B A;  2GAE A;  1TWC A;  2EEO B;  3SUM A;  1Y5I A;  4CS0 A;  3DMR A;  3CZB A;  3PLX B;  1SIW A;  5FTN A;  3X2H A;  1CZ4 A;  2JIQ A;  1WLF A;  2NVY A;  2VPX A;  1SMY D;  3ENG A;  1FDI A;  2YUJ A;  1H5N A;  3HKZ A;  2C45 A;  3GTK A;  1CZ5 A;  2JIM A;  2PMZ A;  3CF2 A;  3X2J A;  1TWH A;  1Q16 A;  1UHD A;  2DMR A;  3M3G A;  4FG2 A;  1QCS A;  1L8F A;  4JS7 A;  1N10 A;  1BW4 A;  3IR5 A;  1I50 A;  1PYQ A;  3X2I A;  2G5D A;  3HU1 A;  1PQF A;  2E7Z A;  2JIR A;  2E2H A;  1QDN A;  4FFT A;  2E2I A;  5H4U A;  2VUM A;  2JA7 A;  1IW7 D;  1E61 A;  1AA6 A;  2JA5 A;  4AYB A;  5T5M D;  1HD5 A;  3X2P A;  1PQE A;  1OA7 A;  3OUG A;  5DYG A;  5B6C A;  2R92 A;  4KDL A;  4CRZ A;  1PT1 A;  3X2K A;  3O5A A;  3QC8 A;  2WAQ A;  1ZYR D;  1BW3 A;  1FDO A;  4JP7 A;  1H0H A;  1VC3 B;  3GTJ A;  1E60 A;  1CR5 A;  2JIO A;  1WCM A;  2A6H D;  2O5J D;  1KQG A;  2G6G A;  1EU1 A;  1G8K A;  1SFO A;  5EPP A;  5GLY A;  1YNJ D;  2AE0 X;  5FTJ A;  1UHE A;  1DMR A;  4NOH A;  2NVX A;  3SUJ A;  4D7Z B;  1Y1W A;  3FKI A;  3X2O A;  3X2L A;  1TWG A;  4ENG A;  3H0G A;  4ZM7 A;  2IV2 X;  3GTL A;  2PNW A;  1R7R A;  1E32 A;  5GLF A;  3HU2 A;  4AON B;  4QIW A;  1KQF A;  1PQH A;  3X2N A;  1I3Q A;  2B63 A;  5FTL A;  2PJH B;  4JCW A;  4KOD A;  1K83 A;  5FTK A;  3GTG A;  3D30 A;  4AVR A;  4GA5 A;  3SUK A;  2PJJ A;  5GLX A;  3GTQ A;  1E18 A;  2A68 D;  4CRY G;  4FER A;  3IR6 A;  1Y4Z A;  5DYI A;  1TMO A;  4FG4 A;  1OA9 A;  3HU3 A;  4KDI A;  3SUL A;  1OGY A;  2VPW A;  3IR7 A;  1E5V A;  3TM7 B;  3X2M A;  1PYU B;  2VPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...