2AE0X

Crystal structure of mlta from escherichia coli reveals a unique lytic transglycosylase fold
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Crystal Structure of MltA from Escherichia coli Reveals a Unique Lytic Transglycosylase Fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03562 MltA MltA specific insert domain
X PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2ae0X01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2ae0X02
2BH0A 4ZM7A 3X2PA 2HCZX 3X2JA 3SUJA 5H4UA 1BW4A 3X2HA 2PI8A 4JP6A 1WC2A 3ENGA 3CZBA 4JS7A 3X2NA 3X2MA 4JJOA 3X2GA 2PNWA 4FFTA 3SUMA 3SULA 5GLXA 2AE0X 2PICA 2G5DA 3M3GA 5GM9A 2KQAA 3SUKA 3X2IA 4ENGA 4FG4A 5GLYA 4L48A 4FERA 2ENGA 1OA9A 1HD5A 1N10A 4JCWA 1BW3A 4JP7A 3D30A 3X2LA 3X2OA 2PJJA 1L8FA 4FG2A 2GAEA 3X2KA 1OA7A 2G6GA 4AVRA
chains in the Genus database with same CATH superfamily
4ZM7A 3X2PA 2HCZX 4AOKB 4DMRA 2V45A 5FTNA 5C18A 2Y0SA 3SUJA 1AA6A 1SFOA 1KQGA 1BW4A 4J3CA 2B63A 5DM6S 5HL7S 5JVHS 1EXDA 1PQEA 4JP6A 3ENGA 1CR5A 1WCMA 1NXZA 2RD2A 3X2MA 4JJOA 1O0BA 5GAEW 4WFAS 1R7RA 2NAPA 3W2VB 2NYAA 2PMZA 1Y4ZA 3OUGA 2O5JD 4GA6A 1QRUA 1I50A 1EU1A 1TWAA 1E60A 1ZC1A 3SUKA 3DMRA 2PJHB 1UHEA 4H4KA 3W2WB 2V3VA 4D7ZB 4KODA 3GTKA 4KDLA 4FERA 4P2BA 1OGYA 5C1BA 2VPWA 1QDNA 4CRZA 2JA7A 4JP7A 3D30A 1UDXA 1R27A 1EUYA 1TWFA 1PYQA 4U67S 5DYGA 3QWZA 3CF5S 4WF9S 2CW0D 5B6CA 1Y1WA 1NYLA 1E32A 5EPPA 2ZJPS 3X2HA 2IV2X 3TM7B 2VPYA 5FTKA 3GTGA 1DMRA 3GTQA 3IR6A 2VPXA 4H3SA 4V194 2RE8A 3GTJA 4RV0A 2JIRA 3SULA 4QIWA 1TWCA 2AE0X 4JXZA 3GTPA 1H5NA 1YNND 1Y1VA 1DMSA 4KO8A 4L48A 1VC3B 2BE5D 2ENGA 4JCWA 1N10A 2EEOB 2DMRA 4CS0A 1PQHA 2ZJQS 4IOAS 3X2LA 1DFUP 3CQZA 1CZ5A 2PJJA 2R93A 5FTJA 2EGWA 4CRYG 5BNZA 5GADW 3X2KA 1ZJWA 1OA7A 3O5AA 4C2MA 1K83A 2JIMA 2NVYA 5FTLA 2A69D 3X2JA 1FEUA 3HKZA 1G8JA 5H4UA 4KLNA 1QCSA 2JIPA 2PI8A 1PQFA 3FKIA 1KQFA 1WC2A 1PT0A 1YNJD 5GLFA 3CZBA 4AAYA 3X2NA 3QQ8A 2EGVA 5T5ID 1AW8B 3J7ZV 3X2GA 2A68D 4E8BA 2C45A 1Z85A 4FFTA 1GTRA 5GAHW 1FDOA 2VPZA 3SUMA 1QRTA 1TWGA 1Q16A 4AYBA 3KW2A 1FDIA 5GLXA 5DYIA 3DLLS 2ZJRS 4IO9S 1QTQA 2PICA 3H0GA 3PLXB 4NOHA 1CZ4A 1E61A 1G8KA 1WLFA 1TWHA 2WB1A 3HU1A 4KDIA 1S3SA 3TIWA 3X2IA 4ENGA 4JXXA 1B75A 5GLYA 3GTLA 4WFNS 1EUQA 1OA9A 1HD5A 1GTSA 4AONB 2E2HA 2VUMA 1YLEA 2R7ZA 3X2OA 1E18A 1ZYRD 2HZ7A 3IR7A 4FG2A 1PT1A 1I3QA 1V6ZA 1O0CA 2G6GA 3GTMA 2E2IA 2BH0A 1SMYD 2JIQA 2JA5A 4L69A 2CX8A 3PIOS 2JA6A 1IW7D 1QRSA 3X1LB 3GTOA 4JS7A 2NWAA 2YU9A 3AIIA 5T5MD 2PNWA 5DM7S 4WCES 1SIWA 1VHKA 1PPYA 4JYZA 3HU2A 2Z0YA 4IOCS 4WFBS 2R92A 1PYUB 2E7ZA 2G5DA 3M3GA 2A6ED 2A6HD 2KQAA 1E5VA 3IR5A 1UHDA 3QC8A 5GM9A 3PIPS 4FG4A 2KI8A 1Y5IA 2WAQA 2YUJA 3ML1A 5FTMA 4AZDA 5IZNA 1D6KA 1TMOA 3CF2A 1BW3A 1R9TA 2NVXA 2JIOA 1VHYA 5GAGW 1H0HA 3QQ7A 4GA5A 1L8FA 4UY88 2GAEA 5JVGS 3HU3A 4AVRA
chains in the Genus database with same CATH topology
4ZM7A 3X2PA 2HCZX 4AOKB 4DMRA 2V45A 5FTNA 5C18A 3SUJA 2Y0SA 1AA6A 1SFOA 1KQGA 1BW4A 2B63A 4JP6A 1PQEA 3ENGA 1CR5A 1WCMA 3X2MA 4JJOA 1R7RA 2NAPA 2NYAA 2PMZA 1Y4ZA 3OUGA 2O5JD 4GA6A 1I50A 1EU1A 1TWAA 1E60A 1ZC1A 3SUKA 3DMRA 2PJHB 1UHEA 2V3VA 4D7ZB 4KODA 3GTKA 4KDLA 4FERA 1OGYA 5C1BA 2VPWA 1QDNA 4CRZA 2JA7A 4JP7A 3D30A 1R27A 1TWFA 1PYQA 5DYGA 3QWZA 2CW0D 5B6CA 1Y1WA 1E32A 5EPPA 3X2HA 2IV2X 3TM7B 2VPYA 5FTKA 3GTGA 1DMRA 3GTQA 3IR6A 2VPXA 3GTJA 4RV0A 2JIRA 3SULA 4QIWA 1TWCA 2AE0X 3GTPA 1H5NA 1YNND 1Y1VA 1DMSA 4L48A 4KO8A 1VC3B 2ENGA 4JCWA 2BE5D 1N10A 2EEOB 2DMRA 4CS0A 1PQHA 3X2LA 3CQZA 1CZ5A 2PJJA 2R93A 5FTJA 4CRYG 3X2KA 1OA7A 3O5AA 4C2MA 1K83A 2JIMA 2NVYA 5FTLA 3X2JA 2A69D 3HKZA 5H4UA 1G8JA 4KLNA 1QCSA 2JIPA 2PI8A 1PQFA 3FKIA 1KQFA 1WC2A 1PT0A 1YNJD 5GLFA 3CZBA 4AAYA 3X2NA 3QQ8A 5T5ID 1AW8B 3X2GA 2A68D 2C45A 4FFTA 3TIWA 1FDOA 2VPZA 3SUMA 1TWGA 1Q16A 4AYBA 1FDIA 5GLXA 5DYIA 2PICA 3H0GA 3PLXB 4NOHA 1CZ4A 1E61A 1G8KA 1WLFA 3X2IA 1TWHA 2WB1A 4ENGA 1S3SA 3HU1A 4KDIA 5GLYA 3GTLA 1OA9A 1HD5A 4AONB 2E2HA 2VUMA 1YLEA 2R7ZA 3X2OA 1E18A 1ZYRD 4FG2A 3IR7A 1PT1A 1I3QA 2G6GA 3GTMA 2E2IA 2BH0A 1SMYD 2JIQA 2JA5A 2JA6A 1IW7D 3GTOA 4JS7A 2YU9A 5T5MD 2PNWA 1SIWA 1PPYA 3HU2A 2R92A 1PYUB 2E7ZA 2G5DA 3M3GA 5GM9A 2A6HD 2KQAA 1E5VA 2A6ED 1UHDA 3IR5A 3QC8A 4FG4A 2KI8A 1Y5IA 2WAQA 2YUJA 3ML1A 5FTMA 4AZDA 1TMOA 3CF2A 1BW3A 1R9TA 2NVXA 2JIOA 1H0HA 3QQ7A 4GA5A 1L8FA 2GAEA 3HU3A 4AVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH0 A;  4ZM7 A;  3X2P A;  2HCZ X;  3X2J A;  3SUJ A;  5H4U A;  1BW4 A;  3X2H A;  2PI8 A;  4JP6 A;  1WC2 A;  3ENG A;  3CZB A;  4JS7 A;  3X2N A;  3X2M A;  4JJO A;  3X2G A;  2PNW A;  4FFT A;  3SUM A;  3SUL A;  5GLX A;  2AE0 X;  2PIC A;  2G5D A;  3M3G A;  5GM9 A;  2KQA A;  3SUK A;  3X2I A;  4ENG A;  4FG4 A;  5GLY A;  4L48 A;  4FER A;  2ENG A;  1OA9 A;  1HD5 A;  1N10 A;  4JCW A;  1BW3 A;  4JP7 A;  3D30 A;  3X2L A;  3X2O A;  2PJJ A;  1L8F A;  4FG2 A;  2GAE A;  3X2K A;  1OA7 A;  2G6G A;  4AVR A; 
#chains in the Genus database with same CATH topology
 4ZM7 A;  3X2P A;  2HCZ X;  4AOK B;  4DMR A;  2V45 A;  5FTN A;  5C18 A;  2Y0S A;  3SUJ A;  1AA6 A;  1SFO A;  1KQG A;  1BW4 A;  4J3C A;  2B63 A;  5DM6 S;  5HL7 S;  5JVH S;  1EXD A;  1PQE A;  4JP6 A;  3ENG A;  1CR5 A;  1WCM A;  1NXZ A;  2RD2 A;  3X2M A;  4JJO A;  1O0B A;  5GAE W;  4WFA S;  1R7R A;  2NAP A;  3W2V B;  2NYA A;  2PMZ A;  1Y4Z A;  3OUG A;  2O5J D;  4GA6 A;  1QRU A;  1I50 A;  1EU1 A;  1TWA A;  1E60 A;  1ZC1 A;  3SUK A;  3DMR A;  2PJH B;  1UHE A;  4H4K A;  3W2W B;  2V3V A;  4D7Z B;  4KOD A;  3GTK A;  4KDL A;  4FER A;  4P2B A;  1OGY A;  5C1B A;  2VPW A;  1QDN A;  4CRZ A;  2JA7 A;  4JP7 A;  3D30 A;  1UDX A;  1R27 A;  1EUY A;  1TWF A;  1PYQ A;  4U67 S;  5DYG A;  3QWZ A;  3CF5 S;  4WF9 S;  2CW0 D;  5B6C A;  1Y1W A;  1NYL A;  1E32 A;  5EPP A;  2ZJP S;  3X2H A;  2IV2 X;  3TM7 B;  2VPY A;  5FTK A;  3GTG A;  1DMR A;  3GTQ A;  3IR6 A;  2VPX A;  4H3S A;  4V19 4;  2RE8 A;  3GTJ A;  4RV0 A;  2JIR A;  3SUL A;  4QIW A;  1TWC A;  2AE0 X;  4JXZ A;  3GTP A;  1H5N A;  1YNN D;  1Y1V A;  1DMS A;  4KO8 A;  4L48 A;  1VC3 B;  2BE5 D;  2ENG A;  4JCW A;  1N10 A;  2EEO B;  2DMR A;  4CS0 A;  1PQH A;  2ZJQ S;  4IOA S;  3X2L A;  1DFU P;  3CQZ A;  1CZ5 A;  2PJJ A;  2R93 A;  5FTJ A;  2EGW A;  4CRY G;  5BNZ A;  5GAD W;  3X2K A;  1ZJW A;  1OA7 A;  3O5A A;  4C2M A;  1K83 A;  2JIM A;  2NVY A;  5FTL A;  2A69 D;  3X2J A;  1FEU A;  3HKZ A;  1G8J A;  5H4U A;  4KLN A;  1QCS A;  2JIP A;  2PI8 A;  1PQF A;  3FKI A;  1KQF A;  1WC2 A;  1PT0 A;  1YNJ D;  5GLF A;  3CZB A;  4AAY A;  3X2N A;  3QQ8 A;  2EGV A;  5T5I D;  1AW8 B;  3J7Z V;  3X2G A;  2A68 D;  4E8B A;  2C45 A;  1Z85 A;  4FFT A;  1GTR A;  5GAH W;  1FDO A;  2VPZ A;  3SUM A;  1QRT A;  1TWG A;  1Q16 A;  4AYB A;  3KW2 A;  1FDI A;  5GLX A;  5DYI A;  3DLL S;  2ZJR S;  4IO9 S;  1QTQ A;  2PIC A;  3H0G A;  3PLX B;  4NOH A;  1CZ4 A;  1E61 A;  1G8K A;  1WLF A;  1TWH A;  2WB1 A;  3HU1 A;  4KDI A;  1S3S A;  3TIW A;  3X2I A;  4ENG A;  4JXX A;  1B75 A;  5GLY A;  3GTL A;  4WFN S;  1EUQ A;  1OA9 A;  1HD5 A;  1GTS A;  4AON B;  2E2H A;  2VUM A;  1YLE A;  2R7Z A;  3X2O A;  1E18 A;  1ZYR D;  2HZ7 A;  3IR7 A;  4FG2 A;  1PT1 A;  1I3Q A;  1V6Z A;  1O0C A;  2G6G A;  3GTM A;  2E2I A;  2BH0 A;  1SMY D;  2JIQ A;  2JA5 A;  4L69 A;  2CX8 A;  3PIO S;  2JA6 A;  1IW7 D;  1QRS A;  3X1L B;  3GTO A;  4JS7 A;  2NWA A;  2YU9 A;  3AII A;  5T5M D;  2PNW A;  5DM7 S;  4WCE S;  1SIW A;  1VHK A;  1PPY A;  4JYZ A;  3HU2 A;  2Z0Y A;  4IOC S;  4WFB S;  2R92 A;  1PYU B;  2E7Z A;  2G5D A;  3M3G A;  2A6E D;  2A6H D;  2KQA A;  1E5V A;  3IR5 A;  1UHD A;  3QC8 A;  5GM9 A;  3PIP S;  4FG4 A;  2KI8 A;  1Y5I A;  2WAQ A;  2YUJ A;  3ML1 A;  5FTM A;  4AZD A;  5IZN A;  1D6K A;  1TMO A;  3CF2 A;  1BW3 A;  1R9T A;  2NVX A;  2JIO A;  1VHY A;  5GAG W;  1H0H A;  3QQ7 A;  4GA5 A;  1L8F A;  4UY8 8;  2GAE A;  5JVG S;  3HU3 A;  4AVR A; 
#chains in the Genus database with same CATH homology
 4ZM7 A;  3X2P A;  2HCZ X;  4AOK B;  4DMR A;  2V45 A;  5FTN A;  5C18 A;  3SUJ A;  2Y0S A;  1AA6 A;  1SFO A;  1KQG A;  1BW4 A;  2B63 A;  4JP6 A;  1PQE A;  3ENG A;  1CR5 A;  1WCM A;  3X2M A;  4JJO A;  1R7R A;  2NAP A;  2NYA A;  2PMZ A;  1Y4Z A;  3OUG A;  2O5J D;  4GA6 A;  1I50 A;  1EU1 A;  1TWA A;  1E60 A;  1ZC1 A;  3SUK A;  3DMR A;  2PJH B;  1UHE A;  2V3V A;  4D7Z B;  4KOD A;  3GTK A;  4KDL A;  4FER A;  1OGY A;  5C1B A;  2VPW A;  1QDN A;  4CRZ A;  2JA7 A;  4JP7 A;  3D30 A;  1R27 A;  1TWF A;  1PYQ A;  5DYG A;  3QWZ A;  2CW0 D;  5B6C A;  1Y1W A;  1E32 A;  5EPP A;  3X2H A;  2IV2 X;  3TM7 B;  2VPY A;  5FTK A;  3GTG A;  1DMR A;  3GTQ A;  3IR6 A;  2VPX A;  3GTJ A;  4RV0 A;  2JIR A;  3SUL A;  4QIW A;  1TWC A;  2AE0 X;  3GTP A;  1H5N A;  1YNN D;  1Y1V A;  1DMS A;  4L48 A;  4KO8 A;  1VC3 B;  2ENG A;  4JCW A;  2BE5 D;  1N10 A;  2EEO B;  2DMR A;  4CS0 A;  1PQH A;  3X2L A;  3CQZ A;  1CZ5 A;  2PJJ A;  2R93 A;  5FTJ A;  4CRY G;  3X2K A;  1OA7 A;  3O5A A;  4C2M A;  1K83 A;  2JIM A;  2NVY A;  5FTL A;  3X2J A;  2A69 D;  3HKZ A;  5H4U A;  1G8J A;  4KLN A;  1QCS A;  2JIP A;  2PI8 A;  1PQF A;  3FKI A;  1KQF A;  1WC2 A;  1PT0 A;  1YNJ D;  5GLF A;  3CZB A;  4AAY A;  3X2N A;  3QQ8 A;  5T5I D;  1AW8 B;  3X2G A;  2A68 D;  2C45 A;  4FFT A;  3TIW A;  1FDO A;  2VPZ A;  3SUM A;  1TWG A;  1Q16 A;  4AYB A;  1FDI A;  5GLX A;  5DYI A;  2PIC A;  3H0G A;  3PLX B;  4NOH A;  1CZ4 A;  1E61 A;  1G8K A;  1WLF A;  3X2I A;  1TWH A;  2WB1 A;  4ENG A;  1S3S A;  3HU1 A;  4KDI A;  5GLY A;  3GTL A;  1OA9 A;  1HD5 A;  4AON B;  2E2H A;  2VUM A;  1YLE A;  2R7Z A;  3X2O A;  1E18 A;  1ZYR D;  4FG2 A;  3IR7 A;  1PT1 A;  1I3Q A;  2G6G A;  3GTM A;  2E2I A;  2BH0 A;  1SMY D;  2JIQ A;  2JA5 A;  2JA6 A;  1IW7 D;  3GTO A;  4JS7 A;  2YU9 A;  5T5M D;  2PNW A;  1SIW A;  1PPY A;  3HU2 A;  2R92 A;  1PYU B;  2E7Z A;  2G5D A;  3M3G A;  5GM9 A;  2A6H D;  2KQA A;  1E5V A;  2A6E D;  1UHD A;  3IR5 A;  3QC8 A;  4FG4 A;  2KI8 A;  1Y5I A;  2WAQ A;  2YUJ A;  3ML1 A;  5FTM A;  4AZD A;  1TMO A;  3CF2 A;  1BW3 A;  1R9T A;  2NVX A;  2JIO A;  1H0H A;  3QQ7 A;  4GA5 A;  1L8F A;  2GAE A;  3HU3 A;  4AVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...