2AE0X

Crystal structure of mlta from escherichia coli reveals a unique lytic transglycosylase fold
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MltA from Escherichia coli Reveals a Unique Lytic Transglycosylase Fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 95
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03562 MltA MltA specific insert domain
X PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2ae0X01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2ae0X02
2HCZX 3SUMA 5GLYA 4FG4A 3SUJA 1HD5A 2PJJA 4AVRA 3X2LA 3SUKA 3SULA 3X2PA 4L48A 1L8FA 4JJOA 1OA9A 3X2NA 2G6GA 4FERA 5GM9A 2GAEA 1BW3A 3X2KA 2PICA 3ENGA 2G5DA 1WC2A 3X2MA 4JS7A 3CZBA 2PNWA 4JP6A 3X2IA 3X2JA 3X2GA 3D30A 4ZM7A 2BH0A 4JP7A 1OA7A 2AE0X 5H4UA 3X2OA 4FG2A 4ENGA 2ENGA 5GLXA 3X2HA 2PI8A 1N10A 1BW4A 4FFTA 4JCWA 2KQAA 3M3GA
chains in the Genus database with same CATH superfamily
2JIMA 1R7RA 2CX8A 3AIIA 4KODA 2NAPA 2A6ED 3IR6A 1QTQA 1V6ZA 3X2LA 3QC8A 1SFOA 1QRTA 2B63A 5FTLA 1IW7D 1QDNA 3TIWA 4L48A 5B6CA 4IO9S 3KW2A 1DMSA 3X2NA 1DMRA 2G6GA 4FERA 2YU9A 4JXXA 2GAEA 4L69A 1QRSA 1FEUA 3ENGA 1QCSA 1H5NA 2G5DA 3H0GA 4CS0A 3GTLA 1GTRA 4JS7A 3CZBA 1CR5A 1Y4ZA 4JP6A 3W2WB 1Q16A 1OA7A 5GAGW 5T5ID 5H4UA 2NVYA 1PQEA 3X2OA 1KQGA 1ZC1A 2JIQA 3GTPA 2NWAA 1R27A 1G8KA 3GTOA 1PQFA 2EGVA 2V45A 4KDLA 2R93A 2PI8A 1Y1WA 5GAEW 1UHDA 4KO8A 4JXZA 2ZJPS 1EXDA 1YNND 4FFTA 3GTKA 4V194 3PLXB 3M3GA 4WFBS 2VUMA 1GTSA 2NVXA 3HU1A 4CRZA 5FTMA 1UDXA 1PPYA 3ML1A 5FTJA 4AONB 5DM7S 4H4KA 3OUGA 2WAQA 2R7ZA 5HL7S 2E2IA 3SULA 5DYIA 4JYZA 2VPZA 1EU1A 5JVHS 1CZ4A 1I50A 4RV0A 1K83A 2VPWA 3X1LB 2PICA 4J3CA 1YLEA 5C18A 2JIOA 1UHEA 4E8BA 1OGYA 2PNWA 3X2JA 3X2IA 2NYAA 4ZM7A 2R92A 2JA5A 4U67S 2C45A 1VHKA 4FG2A 1PT1A 2KI8A 1WLFA 4ENGA 1E61A 1NYLA 2ZJRS 1EUQA 2KQAA 1TWCA 4AOKB 2PJHB 3QWZA 2CW0D 3GTMA 2O5JD 4P2BA 5BNZA 1QRUA 2JIRA 1CZ5A 2ZJQS 1E60A 5DYGA 3GTJA 1Z85A 1G8JA 1Y5IA 2Y0SA 3SUMA 2RD2A 5GLYA 3FKIA 1E18A 2JIPA 1HD5A 4H3SA 1H0HA 2YUJA 4WFNS 3PIOS 4D7ZB 3X2PA 4WFAS 1L8FA 3CF5S 1D6KA 1O0BA 1BW3A 3HU3A 5JVGS 3QQ7A 1PQHA 2A68D 1WC2A 3X2MA 5FTNA 2HZ7A 2Z0YA 1VHYA 4UY88 3D30A 4GA5A 4JP7A 3IR5A 4AZDA 5IZNA 1SMYD 1TWFA 1S3SA 3QQ8A 3TM7B 5DM6S 5GAHW 5C1BA 2EEOB 3HU2A 5GLXA 3O5AA 2PMZA 3X2HA 1FDOA 1WCMA 2E7ZA 1NXZA 1TWHA 5GADW 4WF9S 4QIWA 4IOAS 1AW8B 5EPPA 2BE5D 1VC3B 2V3VA 1SIWA 4JCWA 2DMRA 2HCZX 3SUJA 2E2HA 4FG4A 1R9TA 5FTKA 1B75A 2PJJA 2IV2X 1YNJD 1I3QA 4AVRA 1O0CA 3GTGA 2EGWA 3SUKA 1TWGA 2VPXA 1TWAA 4JJOA 1OA9A 1E32A 1E5VA 5GM9A 3X2KA 3DMRA 2JA7A 1KQFA 3W2VB 1EUYA 2RE8A 4KLNA 4NOHA 3CF2A 2VPYA 4DMRA 1TMOA 3X2GA 3PIPS 2BH0A 1DFUP 2A69D 2WB1A 2AE0X 3CQZA 5T5MD 2JA6A 1PYQA 3HKZA 4GA6A 1PT0A 4CRYG 3DLLS 1AA6A 2ENGA 1ZJWA 4AYBA 4AAYA 3IR7A 4KDIA 1N10A 1Y1VA 4C2MA 5GLFA 3J7ZV 1BW4A 3GTQA 1PYUB 1FDIA 4IOCS 4WCES 1ZYRD 2A6HD
chains in the Genus database with same CATH topology
2JIMA 1R7RA 4KODA 2NAPA 2A6ED 3IR6A 3X2LA 3QC8A 1SFOA 2B63A 5FTLA 1IW7D 1QDNA 3TIWA 4L48A 5B6CA 3X2NA 1DMSA 2G6GA 4FERA 1DMRA 2YU9A 2GAEA 3ENGA 1QCSA 1H5NA 2G5DA 3H0GA 4CS0A 3GTLA 4JS7A 3CZBA 4JP6A 1CR5A 1Y4ZA 1Q16A 1OA7A 5T5ID 5H4UA 2NVYA 3X2OA 1PQEA 1KQGA 1ZC1A 2JIQA 3GTPA 1R27A 1G8KA 3GTOA 1PQFA 2V45A 4KDLA 2R93A 2PI8A 1Y1WA 1UHDA 4KO8A 4FFTA 1YNND 3GTKA 3PLXB 3M3GA 2VUMA 2NVXA 3HU1A 4CRZA 5FTMA 1PPYA 3ML1A 5FTJA 4AONB 3OUGA 2WAQA 2R7ZA 2E2IA 3SULA 5DYIA 2VPZA 1EU1A 1CZ4A 1I50A 4RV0A 1K83A 2VPWA 2PICA 1YLEA 5C18A 2JIOA 1UHEA 1OGYA 2PNWA 3X2JA 3X2IA 4ZM7A 2NYAA 2R92A 2JA5A 2C45A 4FG2A 1PT1A 2KI8A 4ENGA 1WLFA 1E61A 1TWCA 4AOKB 2PJHB 3QWZA 2CW0D 3GTMA 2O5JD 2JIRA 1CZ5A 1E60A 5DYGA 3GTJA 1G8JA 1Y5IA 2Y0SA 3SUMA 5GLYA 3FKIA 1E18A 2JIPA 1HD5A 1H0HA 2YUJA 4D7ZB 3X2PA 1L8FA 1BW3A 3HU3A 3QQ7A 1PQHA 2A68D 1WC2A 3X2MA 5FTNA 3D30A 4GA5A 4JP7A 3IR5A 4AZDA 1SMYD 1TWFA 1S3SA 3QQ8A 3TM7B 5C1BA 2EEOB 3HU2A 5GLXA 3O5AA 2PMZA 3X2HA 1FDOA 1WCMA 2E7ZA 1TWHA 4QIWA 1AW8B 5EPPA 2BE5D 4JCWA 3SUJA 1VC3B 1SIWA 2HCZX 2DMRA 2V3VA 2E2HA 4FG4A 1R9TA 5FTKA 2PJJA 2IV2X 1YNJD 1I3QA 4AVRA 3GTGA 3SUKA 1TWGA 2VPXA 4JJOA 1TWAA 1OA9A 1E32A 5GM9A 1E5VA 3X2KA 3DMRA 2JA7A 1KQFA 4KLNA 4NOHA 3CF2A 2VPYA 4DMRA 3X2GA 1TMOA 2BH0A 2A69D 2WB1A 2AE0X 3CQZA 5T5MD 2JA6A 1PYQA 3HKZA 4GA6A 1PT0A 4CRYG 1AA6A 2ENGA 4AYBA 4AAYA 1ZYRD 3IR7A 4KDIA 1N10A 1Y1VA 4C2MA 5GLFA 1BW4A 3GTQA 1PYUB 1FDIA 2KQAA 2A6HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCZ X;  3SUM A;  5GLY A;  4FG4 A;  3SUJ A;  1HD5 A;  2PJJ A;  4AVR A;  3X2L A;  3SUK A;  3SUL A;  3X2P A;  4L48 A;  1L8F A;  4JJO A;  1OA9 A;  3X2N A;  2G6G A;  4FER A;  5GM9 A;  2GAE A;  1BW3 A;  3X2K A;  2PIC A;  3ENG A;  2G5D A;  1WC2 A;  3X2M A;  4JS7 A;  3CZB A;  2PNW A;  4JP6 A;  3X2I A;  3X2J A;  3X2G A;  3D30 A;  4ZM7 A;  2BH0 A;  4JP7 A;  1OA7 A;  2AE0 X;  5H4U A;  3X2O A;  4FG2 A;  4ENG A;  2ENG A;  5GLX A;  3X2H A;  2PI8 A;  1N10 A;  1BW4 A;  4FFT A;  4JCW A;  2KQA A;  3M3G A; 
#chains in the Genus database with same CATH topology
 2JIM A;  1R7R A;  2CX8 A;  3AII A;  4KOD A;  2NAP A;  2A6E D;  3IR6 A;  1QTQ A;  1V6Z A;  3X2L A;  3QC8 A;  1SFO A;  1QRT A;  2B63 A;  5FTL A;  1IW7 D;  1QDN A;  3TIW A;  4L48 A;  5B6C A;  4IO9 S;  3KW2 A;  1DMS A;  3X2N A;  1DMR A;  2G6G A;  4FER A;  2YU9 A;  4JXX A;  2GAE A;  4L69 A;  1QRS A;  1FEU A;  3ENG A;  1QCS A;  1H5N A;  2G5D A;  3H0G A;  4CS0 A;  3GTL A;  1GTR A;  4JS7 A;  3CZB A;  1CR5 A;  1Y4Z A;  4JP6 A;  3W2W B;  1Q16 A;  1OA7 A;  5GAG W;  5T5I D;  5H4U A;  2NVY A;  1PQE A;  3X2O A;  1KQG A;  1ZC1 A;  2JIQ A;  3GTP A;  2NWA A;  1R27 A;  1G8K A;  3GTO A;  1PQF A;  2EGV A;  2V45 A;  4KDL A;  2R93 A;  2PI8 A;  1Y1W A;  5GAE W;  1UHD A;  4KO8 A;  4JXZ A;  2ZJP S;  1EXD A;  1YNN D;  4FFT A;  3GTK A;  4V19 4;  3PLX B;  3M3G A;  4WFB S;  2VUM A;  1GTS A;  2NVX A;  3HU1 A;  4CRZ A;  5FTM A;  1UDX A;  1PPY A;  3ML1 A;  5FTJ A;  4AON B;  5DM7 S;  4H4K A;  3OUG A;  2WAQ A;  2R7Z A;  5HL7 S;  2E2I A;  3SUL A;  5DYI A;  4JYZ A;  2VPZ A;  1EU1 A;  5JVH S;  1CZ4 A;  1I50 A;  4RV0 A;  1K83 A;  2VPW A;  3X1L B;  2PIC A;  4J3C A;  1YLE A;  5C18 A;  2JIO A;  1UHE A;  4E8B A;  1OGY A;  2PNW A;  3X2J A;  3X2I A;  2NYA A;  4ZM7 A;  2R92 A;  2JA5 A;  4U67 S;  2C45 A;  1VHK A;  4FG2 A;  1PT1 A;  2KI8 A;  1WLF A;  4ENG A;  1E61 A;  1NYL A;  2ZJR S;  1EUQ A;  2KQA A;  1TWC A;  4AOK B;  2PJH B;  3QWZ A;  2CW0 D;  3GTM A;  2O5J D;  4P2B A;  5BNZ A;  1QRU A;  2JIR A;  1CZ5 A;  2ZJQ S;  1E60 A;  5DYG A;  3GTJ A;  1Z85 A;  1G8J A;  1Y5I A;  2Y0S A;  3SUM A;  2RD2 A;  5GLY A;  3FKI A;  1E18 A;  2JIP A;  1HD5 A;  4H3S A;  1H0H A;  2YUJ A;  4WFN S;  3PIO S;  4D7Z B;  3X2P A;  4WFA S;  1L8F A;  3CF5 S;  1D6K A;  1O0B A;  1BW3 A;  3HU3 A;  5JVG S;  3QQ7 A;  1PQH A;  2A68 D;  1WC2 A;  3X2M A;  5FTN A;  2HZ7 A;  2Z0Y A;  1VHY A;  4UY8 8;  3D30 A;  4GA5 A;  4JP7 A;  3IR5 A;  4AZD A;  5IZN A;  1SMY D;  1TWF A;  1S3S A;  3QQ8 A;  3TM7 B;  5DM6 S;  5GAH W;  5C1B A;  2EEO B;  3HU2 A;  5GLX A;  3O5A A;  2PMZ A;  3X2H A;  1FDO A;  1WCM A;  2E7Z A;  1NXZ A;  1TWH A;  5GAD W;  4WF9 S;  4QIW A;  4IOA S;  1AW8 B;  5EPP A;  2BE5 D;  1VC3 B;  2V3V A;  1SIW A;  4JCW A;  2DMR A;  2HCZ X;  3SUJ A;  2E2H A;  4FG4 A;  1R9T A;  5FTK A;  1B75 A;  2PJJ A;  2IV2 X;  1YNJ D;  1I3Q A;  4AVR A;  1O0C A;  3GTG A;  2EGW A;  3SUK A;  1TWG A;  2VPX A;  1TWA A;  4JJO A;  1OA9 A;  1E32 A;  1E5V A;  5GM9 A;  3X2K A;  3DMR A;  2JA7 A;  1KQF A;  3W2V B;  1EUY A;  2RE8 A;  4KLN A;  4NOH A;  3CF2 A;  2VPY A;  4DMR A;  1TMO A;  3X2G A;  3PIP S;  2BH0 A;  1DFU P;  2A69 D;  2WB1 A;  2AE0 X;  3CQZ A;  5T5M D;  2JA6 A;  1PYQ A;  3HKZ A;  4GA6 A;  1PT0 A;  4CRY G;  3DLL S;  1AA6 A;  2ENG A;  1ZJW A;  4AYB A;  4AAY A;  3IR7 A;  4KDI A;  1N10 A;  1Y1V A;  4C2M A;  5GLF A;  3J7Z V;  1BW4 A;  3GTQ A;  1PYU B;  1FDI A;  4IOC S;  4WCE S;  1ZYR D;  2A6H D; 
#chains in the Genus database with same CATH homology
 2JIM A;  1R7R A;  4KOD A;  2NAP A;  2A6E D;  3IR6 A;  3X2L A;  3QC8 A;  1SFO A;  2B63 A;  5FTL A;  1IW7 D;  1QDN A;  3TIW A;  4L48 A;  5B6C A;  3X2N A;  1DMS A;  2G6G A;  4FER A;  1DMR A;  2YU9 A;  2GAE A;  3ENG A;  1QCS A;  1H5N A;  2G5D A;  3H0G A;  4CS0 A;  3GTL A;  4JS7 A;  3CZB A;  4JP6 A;  1CR5 A;  1Y4Z A;  1Q16 A;  1OA7 A;  5T5I D;  5H4U A;  2NVY A;  3X2O A;  1PQE A;  1KQG A;  1ZC1 A;  2JIQ A;  3GTP A;  1R27 A;  1G8K A;  3GTO A;  1PQF A;  2V45 A;  4KDL A;  2R93 A;  2PI8 A;  1Y1W A;  1UHD A;  4KO8 A;  4FFT A;  1YNN D;  3GTK A;  3PLX B;  3M3G A;  2VUM A;  2NVX A;  3HU1 A;  4CRZ A;  5FTM A;  1PPY A;  3ML1 A;  5FTJ A;  4AON B;  3OUG A;  2WAQ A;  2R7Z A;  2E2I A;  3SUL A;  5DYI A;  2VPZ A;  1EU1 A;  1CZ4 A;  1I50 A;  4RV0 A;  1K83 A;  2VPW A;  2PIC A;  1YLE A;  5C18 A;  2JIO A;  1UHE A;  1OGY A;  2PNW A;  3X2J A;  3X2I A;  4ZM7 A;  2NYA A;  2R92 A;  2JA5 A;  2C45 A;  4FG2 A;  1PT1 A;  2KI8 A;  4ENG A;  1WLF A;  1E61 A;  1TWC A;  4AOK B;  2PJH B;  3QWZ A;  2CW0 D;  3GTM A;  2O5J D;  2JIR A;  1CZ5 A;  1E60 A;  5DYG A;  3GTJ A;  1G8J A;  1Y5I A;  2Y0S A;  3SUM A;  5GLY A;  3FKI A;  1E18 A;  2JIP A;  1HD5 A;  1H0H A;  2YUJ A;  4D7Z B;  3X2P A;  1L8F A;  1BW3 A;  3HU3 A;  3QQ7 A;  1PQH A;  2A68 D;  1WC2 A;  3X2M A;  5FTN A;  3D30 A;  4GA5 A;  4JP7 A;  3IR5 A;  4AZD A;  1SMY D;  1TWF A;  1S3S A;  3QQ8 A;  3TM7 B;  5C1B A;  2EEO B;  3HU2 A;  5GLX A;  3O5A A;  2PMZ A;  3X2H A;  1FDO A;  1WCM A;  2E7Z A;  1TWH A;  4QIW A;  1AW8 B;  5EPP A;  2BE5 D;  4JCW A;  3SUJ A;  1VC3 B;  1SIW A;  2HCZ X;  2DMR A;  2V3V A;  2E2H A;  4FG4 A;  1R9T A;  5FTK A;  2PJJ A;  2IV2 X;  1YNJ D;  1I3Q A;  4AVR A;  3GTG A;  3SUK A;  1TWG A;  2VPX A;  4JJO A;  1TWA A;  1OA9 A;  1E32 A;  5GM9 A;  1E5V A;  3X2K A;  3DMR A;  2JA7 A;  1KQF A;  4KLN A;  4NOH A;  3CF2 A;  2VPY A;  4DMR A;  3X2G A;  1TMO A;  2BH0 A;  2A69 D;  2WB1 A;  2AE0 X;  3CQZ A;  5T5M D;  2JA6 A;  1PYQ A;  3HKZ A;  4GA6 A;  1PT0 A;  4CRY G;  1AA6 A;  2ENG A;  4AYB A;  4AAY A;  1ZYR D;  3IR7 A;  4KDI A;  1N10 A;  1Y1V A;  4C2M A;  5GLF A;  1BW4 A;  3GTQ A;  1PYU B;  1FDI A;  2KQA A;  2A6H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...