2AE0X

Crystal structure of mlta from escherichia coli reveals a unique lytic transglycosylase fold
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Crystal Structure of MltA from Escherichia coli Reveals a Unique Lytic Transglycosylase Fold
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03562 MltA MltA specific insert domain
X PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2ae0X01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2ae0X02
2ENGA 1WC2A 2PI8A 3ENGA 3M3GA 3X2IA 3X2NA 3CZBA 2PJJA 4FERA 4AVRA 3SUKA 2G6GA 3SULA 1OA7A 1BW4A 4ENGA 4JP7A 4JJOA 3X2MA 3X2PA 1OA9A 3X2OA 2G5DA 4JS7A 4ZM7A 5GLXA 2PNWA 3SUMA 4JCWA 3X2KA 3D30A 4FG2A 3X2LA 4L48A 3X2JA 4FG4A 3SUJA 3X2GA 3X2HA 2KQAA 1N10A 4FFTA 2GAEA 5GLYA 5H4UA 1L8FA 1BW3A 5GM9A 1HD5A 2AE0X 2PICA 2BH0A 4JP6A 2HCZX
chains in the Genus database with same CATH superfamily
2NAPA 1WLFA 1WC2A 1YNJD 2ENGA 3M3GA 4QIWA 1KQFA 1CZ5A 4AOKB 2Z0YA 1K83A 1WCMA 1VHYA 1E18A 2PJJA 3IR6A 2G6GA 1E32A 1G8KA 4WFBS 1PPYA 2V45A 1QCSA 4JYZA 3GTQA 5B6CA 2KI8A 1PYQA 4E8BA 1DFUP 4CRYG 5C1BA 5FTMA 4V194 1B75A 4L69A 1FDOA 1O0BA 4CS0A 5HL7S 1YLEA 1CZ4A 4FG4A 3SUJA 2NYAA 3ML1A 1Y5IA 3HU2A 2JIRA 1VC3B 1NYLA 2GAEA 1UDXA 1H0HA 2BE5D 4WCES 1I3QA 1L8FA 1H5NA 2VUMA 4H3SA 2AE0X 1VHKA 4H4KA 4U67S 4IOCS 2BH0A 1UHDA 1FEUA 4C2MA 3GTLA 2VPXA 4RV0A 3AIIA 5T5ID 3GTPA 3X2IA 4J3CA 2DMRA 3QQ7A 5DM7S 3CF2A 4DMRA 5JVHS 3X2NA 3HU3A 4AVRA 1DMRA 5DM6S 2ZJRS 3SULA 5FTJA 3GTJA 1BW4A 4GA5A 3DLLS 2Y0SA 4JP7A 1OGYA 5DYIA 2PJHB 1UHEA 2IV2X 3X2MA 1R27A 1PT0A 3DMRA 2NWAA 3X2OA 4JS7A 1AA6A 2R7ZA 1TWFA 1KQGA 2VPWA 4GA6A 4AZDA 1S3SA 2EEOB 1PT1A 3QQ8A 5GLXA 3TIWA 1GTSA 5IZNA 1PQHA 3IR5A 4KLNA 3X2LA 3X2JA 1NXZA 2YUJA 3X2HA 2EGVA 5GAGW 1EUQA 1DMSA 1TWGA 3GTGA 2JIPA 1N10A 2O5JD 3PIOS 1ZC1A 3X1LB 3OUGA 4D7ZB 5H4UA 3GTMA 4JXXA 2JIQA 1TWAA 1QDNA 3HKZA 3PLXB 1ZJWA 1Y4ZA 1SIWA 2CW0D 3ENGA 2PI8A 1G8JA 2WAQA 4IO9S 5GAEW 4AAYA 5BNZA 2R92A 1ZYRD 3CZBA 2JIOA 2B63A 3SUKA 4KDIA 1TWHA 5FTLA 4JJOA 3X2PA 3W2VB 2RD2A 5DYGA 3PIPS 1FDIA 2VPYA 5C18A 2G5DA 5FTKA 4AONB 1Y1WA 2A6HD 1SFOA 2E2HA 4UY88 4KODA 4CRZA 4WFAS 2R93A 3X2KA 1Y1VA 2E7ZA 3D30A 4FG2A 2HZ7A 2JA5A 1TMOA 2CX8A 2PMZA 5EPPA 2WB1A 3GTKA 5GAHW 1QRSA 1D6KA 1PQEA 2ZJQS 1GTRA 1R7RA 4WFNS 4JXZA 1BW3A 2NVYA 1E60A 2PICA 3CQZA 2HCZX 3TM7B 3FKIA 3J7ZV 2C45A 3H0GA 3CF5S 3KW2A 2A6ED 2ZJPS 5JVGS 4FERA 4KDLA 3QWZA 1R9TA 1AW8B 1Q16A 1OA7A 2YU9A 1E5VA 1Z85A 1IW7D 2RE8A 4ENGA 2JA6A 1CR5A 2A69D 3W2WB 1OA9A 5FTNA 2JIMA 2VPZA 3QC8A 4ZM7A 2E2IA 1EXDA 2A68D 3SUMA 2PNWA 3O5AA 4IOAS 4AYBA 4JCWA 1SMYD 4WF9S 1E61A 4KO8A 1YNND 4L48A 2NVXA 1TWCA 5T5MD 3X2GA 1EU1A 2KQAA 3IR7A 5GLFA 1O0CA 4NOHA 2V3VA 1EUYA 4FFTA 1QTQA 3GTOA 2JA7A 1V6ZA 3HU1A 5GLYA 2EGWA 1PQFA 5GADW 5GM9A 1HD5A 1I50A 4P2BA 1QRUA 1QRTA 1PYUB 4JP6A
chains in the Genus database with same CATH topology
2NAPA 2ENGA 1WC2A 3M3GA 1WLFA 1YNJD 4QIWA 1KQFA 1CZ5A 4AOKB 1K83A 1WCMA 1E18A 2PJJA 3IR6A 2G6GA 1E32A 1G8KA 1PPYA 2V45A 1QCSA 3GTQA 5B6CA 2KI8A 1PYQA 4CRYG 5C1BA 5FTMA 1FDOA 4CS0A 1YLEA 1CZ4A 4FG4A 3SUJA 2NYAA 3ML1A 1Y5IA 3HU2A 2JIRA 1VC3B 2GAEA 1H0HA 2BE5D 1I3QA 1L8FA 1H5NA 2VUMA 2AE0X 2BH0A 1UHDA 4C2MA 3GTLA 2VPXA 4RV0A 5T5ID 3GTPA 3X2IA 2DMRA 3QQ7A 3CF2A 4DMRA 3X2NA 3HU3A 4AVRA 1DMRA 3SULA 1BW4A 5FTJA 3GTJA 4GA5A 2Y0SA 4JP7A 1OGYA 3X2MA 2PJHB 1UHEA 5DYIA 2IV2X 1R27A 1PT0A 3DMRA 3X2OA 4JS7A 1AA6A 2R7ZA 1TWFA 1KQGA 2VPWA 4GA6A 4AZDA 5GLXA 1S3SA 1PT1A 2EEOB 3QQ8A 3TIWA 1PQHA 3X2LA 3X2JA 3IR5A 4KLNA 3X2HA 2YUJA 1DMSA 1TWGA 3GTGA 2JIPA 1N10A 2O5JD 1ZC1A 3OUGA 4D7ZB 5H4UA 3GTMA 2JIQA 1TWAA 1QDNA 3HKZA 3PLXB 1Y4ZA 1SIWA 2CW0D 3ENGA 2PI8A 1G8JA 2WAQA 4AAYA 2R92A 1ZYRD 3CZBA 2JIOA 2B63A 3SUKA 4KDIA 1TWHA 5FTLA 4JJOA 3X2PA 5DYGA 1FDIA 2VPYA 5C18A 2G5DA 5FTKA 4AONB 1Y1WA 2A6HD 1SFOA 2E2HA 4KODA 4CRZA 2R93A 3X2KA 1Y1VA 2E7ZA 3D30A 4FG2A 2JA5A 1TMOA 2PMZA 5EPPA 2WB1A 3GTKA 1PQEA 1R7RA 1BW3A 2NVYA 1E60A 2PICA 3CQZA 2HCZX 3TM7B 3FKIA 2C45A 3H0GA 2A6ED 4FERA 4KDLA 3QWZA 1R9TA 1AW8B 1Q16A 1OA7A 2YU9A 1E5VA 1IW7D 4ENGA 2JA6A 1CR5A 2A69D 1OA9A 5FTNA 2JIMA 2VPZA 3QC8A 4ZM7A 2E2IA 2A68D 3SUMA 2PNWA 3O5AA 4AYBA 4JCWA 1SMYD 1E61A 4KO8A 1YNND 4L48A 2NVXA 1TWCA 5T5MD 3X2GA 1EU1A 2KQAA 3IR7A 5GLFA 4NOHA 2V3VA 4FFTA 3GTOA 2JA7A 5GLYA 3HU1A 1PQFA 5GM9A 1HD5A 1I50A 1PYUB 4JP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENG A;  1WC2 A;  2PI8 A;  3ENG A;  3M3G A;  3X2I A;  3X2N A;  3CZB A;  2PJJ A;  4FER A;  4AVR A;  3SUK A;  2G6G A;  3SUL A;  1OA7 A;  1BW4 A;  4ENG A;  4JP7 A;  4JJO A;  3X2M A;  3X2P A;  1OA9 A;  3X2O A;  2G5D A;  4JS7 A;  4ZM7 A;  5GLX A;  2PNW A;  3SUM A;  4JCW A;  3X2K A;  3D30 A;  4FG2 A;  3X2L A;  4L48 A;  3X2J A;  4FG4 A;  3SUJ A;  3X2G A;  3X2H A;  2KQA A;  1N10 A;  4FFT A;  2GAE A;  5GLY A;  5H4U A;  1L8F A;  1BW3 A;  5GM9 A;  1HD5 A;  2AE0 X;  2PIC A;  2BH0 A;  4JP6 A;  2HCZ X; 
#chains in the Genus database with same CATH topology
 2NAP A;  1WLF A;  1WC2 A;  1YNJ D;  2ENG A;  3M3G A;  4QIW A;  1KQF A;  1CZ5 A;  4AOK B;  2Z0Y A;  1K83 A;  1WCM A;  1VHY A;  1E18 A;  2PJJ A;  3IR6 A;  2G6G A;  1E32 A;  1G8K A;  4WFB S;  1PPY A;  2V45 A;  1QCS A;  4JYZ A;  3GTQ A;  5B6C A;  2KI8 A;  1PYQ A;  4E8B A;  1DFU P;  4CRY G;  5C1B A;  5FTM A;  4V19 4;  1B75 A;  4L69 A;  1FDO A;  1O0B A;  4CS0 A;  5HL7 S;  1YLE A;  1CZ4 A;  4FG4 A;  3SUJ A;  2NYA A;  3ML1 A;  1Y5I A;  3HU2 A;  2JIR A;  1VC3 B;  1NYL A;  2GAE A;  1UDX A;  1H0H A;  2BE5 D;  4WCE S;  1I3Q A;  1L8F A;  1H5N A;  2VUM A;  4H3S A;  2AE0 X;  1VHK A;  4H4K A;  4U67 S;  4IOC S;  2BH0 A;  1UHD A;  1FEU A;  4C2M A;  3GTL A;  2VPX A;  4RV0 A;  3AII A;  5T5I D;  3GTP A;  3X2I A;  4J3C A;  2DMR A;  3QQ7 A;  5DM7 S;  3CF2 A;  4DMR A;  5JVH S;  3X2N A;  3HU3 A;  4AVR A;  1DMR A;  5DM6 S;  2ZJR S;  3SUL A;  5FTJ A;  3GTJ A;  1BW4 A;  4GA5 A;  3DLL S;  2Y0S A;  4JP7 A;  1OGY A;  5DYI A;  2PJH B;  1UHE A;  2IV2 X;  3X2M A;  1R27 A;  1PT0 A;  3DMR A;  2NWA A;  3X2O A;  4JS7 A;  1AA6 A;  2R7Z A;  1TWF A;  1KQG A;  2VPW A;  4GA6 A;  4AZD A;  1S3S A;  2EEO B;  1PT1 A;  3QQ8 A;  5GLX A;  3TIW A;  1GTS A;  5IZN A;  1PQH A;  3IR5 A;  4KLN A;  3X2L A;  3X2J A;  1NXZ A;  2YUJ A;  3X2H A;  2EGV A;  5GAG W;  1EUQ A;  1DMS A;  1TWG A;  3GTG A;  2JIP A;  1N10 A;  2O5J D;  3PIO S;  1ZC1 A;  3X1L B;  3OUG A;  4D7Z B;  5H4U A;  3GTM A;  4JXX A;  2JIQ A;  1TWA A;  1QDN A;  3HKZ A;  3PLX B;  1ZJW A;  1Y4Z A;  1SIW A;  2CW0 D;  3ENG A;  2PI8 A;  1G8J A;  2WAQ A;  4IO9 S;  5GAE W;  4AAY A;  5BNZ A;  2R92 A;  1ZYR D;  3CZB A;  2JIO A;  2B63 A;  3SUK A;  4KDI A;  1TWH A;  5FTL A;  4JJO A;  3X2P A;  3W2V B;  2RD2 A;  5DYG A;  3PIP S;  1FDI A;  2VPY A;  5C18 A;  2G5D A;  5FTK A;  4AON B;  1Y1W A;  2A6H D;  1SFO A;  2E2H A;  4UY8 8;  4KOD A;  4CRZ A;  4WFA S;  2R93 A;  3X2K A;  1Y1V A;  2E7Z A;  3D30 A;  4FG2 A;  2HZ7 A;  2JA5 A;  1TMO A;  2CX8 A;  2PMZ A;  5EPP A;  2WB1 A;  3GTK A;  5GAH W;  1QRS A;  1D6K A;  1PQE A;  2ZJQ S;  1GTR A;  1R7R A;  4WFN S;  4JXZ A;  1BW3 A;  2NVY A;  1E60 A;  2PIC A;  3CQZ A;  2HCZ X;  3TM7 B;  3FKI A;  3J7Z V;  2C45 A;  3H0G A;  3CF5 S;  3KW2 A;  2A6E D;  2ZJP S;  5JVG S;  4FER A;  4KDL A;  3QWZ A;  1R9T A;  1AW8 B;  1Q16 A;  1OA7 A;  2YU9 A;  1E5V A;  1Z85 A;  1IW7 D;  2RE8 A;  4ENG A;  2JA6 A;  1CR5 A;  2A69 D;  3W2W B;  1OA9 A;  5FTN A;  2JIM A;  2VPZ A;  3QC8 A;  4ZM7 A;  2E2I A;  1EXD A;  2A68 D;  3SUM A;  2PNW A;  3O5A A;  4IOA S;  4AYB A;  4JCW A;  1SMY D;  4WF9 S;  1E61 A;  4KO8 A;  1YNN D;  4L48 A;  2NVX A;  1TWC A;  5T5M D;  3X2G A;  1EU1 A;  2KQA A;  3IR7 A;  5GLF A;  1O0C A;  4NOH A;  2V3V A;  1EUY A;  4FFT A;  1QTQ A;  3GTO A;  2JA7 A;  1V6Z A;  3HU1 A;  5GLY A;  2EGW A;  1PQF A;  5GAD W;  5GM9 A;  1HD5 A;  1I50 A;  4P2B A;  1QRU A;  1QRT A;  1PYU B;  4JP6 A; 
#chains in the Genus database with same CATH homology
 2NAP A;  2ENG A;  1WC2 A;  3M3G A;  1WLF A;  1YNJ D;  4QIW A;  1KQF A;  1CZ5 A;  4AOK B;  1K83 A;  1WCM A;  1E18 A;  2PJJ A;  3IR6 A;  2G6G A;  1E32 A;  1G8K A;  1PPY A;  2V45 A;  1QCS A;  3GTQ A;  5B6C A;  2KI8 A;  1PYQ A;  4CRY G;  5C1B A;  5FTM A;  1FDO A;  4CS0 A;  1YLE A;  1CZ4 A;  4FG4 A;  3SUJ A;  2NYA A;  3ML1 A;  1Y5I A;  3HU2 A;  2JIR A;  1VC3 B;  2GAE A;  1H0H A;  2BE5 D;  1I3Q A;  1L8F A;  1H5N A;  2VUM A;  2AE0 X;  2BH0 A;  1UHD A;  4C2M A;  3GTL A;  2VPX A;  4RV0 A;  5T5I D;  3GTP A;  3X2I A;  2DMR A;  3QQ7 A;  3CF2 A;  4DMR A;  3X2N A;  3HU3 A;  4AVR A;  1DMR A;  3SUL A;  1BW4 A;  5FTJ A;  3GTJ A;  4GA5 A;  2Y0S A;  4JP7 A;  1OGY A;  3X2M A;  2PJH B;  1UHE A;  5DYI A;  2IV2 X;  1R27 A;  1PT0 A;  3DMR A;  3X2O A;  4JS7 A;  1AA6 A;  2R7Z A;  1TWF A;  1KQG A;  2VPW A;  4GA6 A;  4AZD A;  5GLX A;  1S3S A;  1PT1 A;  2EEO B;  3QQ8 A;  3TIW A;  1PQH A;  3X2L A;  3X2J A;  3IR5 A;  4KLN A;  3X2H A;  2YUJ A;  1DMS A;  1TWG A;  3GTG A;  2JIP A;  1N10 A;  2O5J D;  1ZC1 A;  3OUG A;  4D7Z B;  5H4U A;  3GTM A;  2JIQ A;  1TWA A;  1QDN A;  3HKZ A;  3PLX B;  1Y4Z A;  1SIW A;  2CW0 D;  3ENG A;  2PI8 A;  1G8J A;  2WAQ A;  4AAY A;  2R92 A;  1ZYR D;  3CZB A;  2JIO A;  2B63 A;  3SUK A;  4KDI A;  1TWH A;  5FTL A;  4JJO A;  3X2P A;  5DYG A;  1FDI A;  2VPY A;  5C18 A;  2G5D A;  5FTK A;  4AON B;  1Y1W A;  2A6H D;  1SFO A;  2E2H A;  4KOD A;  4CRZ A;  2R93 A;  3X2K A;  1Y1V A;  2E7Z A;  3D30 A;  4FG2 A;  2JA5 A;  1TMO A;  2PMZ A;  5EPP A;  2WB1 A;  3GTK A;  1PQE A;  1R7R A;  1BW3 A;  2NVY A;  1E60 A;  2PIC A;  3CQZ A;  2HCZ X;  3TM7 B;  3FKI A;  2C45 A;  3H0G A;  2A6E D;  4FER A;  4KDL A;  3QWZ A;  1R9T A;  1AW8 B;  1Q16 A;  1OA7 A;  2YU9 A;  1E5V A;  1IW7 D;  4ENG A;  2JA6 A;  1CR5 A;  2A69 D;  1OA9 A;  5FTN A;  2JIM A;  2VPZ A;  3QC8 A;  4ZM7 A;  2E2I A;  2A68 D;  3SUM A;  2PNW A;  3O5A A;  4AYB A;  4JCW A;  1SMY D;  1E61 A;  4KO8 A;  1YNN D;  4L48 A;  2NVX A;  1TWC A;  5T5M D;  3X2G A;  1EU1 A;  2KQA A;  3IR7 A;  5GLF A;  4NOH A;  2V3V A;  4FFT A;  3GTO A;  2JA7 A;  5GLY A;  3HU1 A;  1PQF A;  5GM9 A;  1HD5 A;  1I50 A;  1PYU B;  4JP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...