2AE0X

Crystal structure of mlta from escherichia coli reveals a unique lytic transglycosylase fold
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MltA from Escherichia coli Reveals a Unique Lytic Transglycosylase Fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 95
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03562 MltA MltA specific insert domain
X PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2ae0X01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2ae0X02
5GLYA 1HD5A 2PI8A 2PJJA 2PNWA 3X2PA 4JCWA 3SUKA 4ENGA 4FG2A 1WC2A 3X2IA 1L8FA 2AE0X 5GM9A 2HCZX 4JJOA 3X2GA 2GAEA 3X2OA 2G5DA 3X2HA 5GLXA 3X2LA 4FFTA 4FERA 4FG4A 3CZBA 1BW4A 3D30A 2BH0A 3X2MA 4L48A 2G6GA 3SUMA 2ENGA 1BW3A 1OA7A 3ENGA 3X2JA 4JS7A 4ZM7A 2PICA 3M3GA 3SUJA 5H4UA 4AVRA 2KQAA 3X2NA 1OA9A 3SULA 4JP7A 3X2KA 1N10A 4JP6A
chains in the Genus database with same CATH superfamily
1HD5A 1E18A 2PNWA 3GTKA 3GTJA 1SIWA 1AW8B 5FTMA 4CS0A 3DMRA 4KO8A 2A6HD 1Y5IA 2NYAA 2A69D 3CQZA 4WFNS 1DMSA 3HKZA 5IZNA 2PMZA 3X2LA 5FTLA 1CZ4A 3CF2A 1Z85A 3PIOS 1EUQA 1YLEA 3D30A 2BH0A 3X2MA 1PYUB 4KDIA 2ZJPS 1GTSA 2HZ7A 1DMRA 3OUGA 5BNZA 1PQFA 3GTQA 1GTRA 2CX8A 3X2JA 4ZM7A 1O0BA 2PICA 3FKIA 2BE5D 5HL7S 1QRSA 2ZJRS 2IV2X 5JVGS 5GADW 4JYZA 1Y4ZA 1OGYA 1E32A 1FDOA 3HU3A 4WCES 2JIOA 4AVRA 2E2IA 2NAPA 1OA9A 3W2VB 4E8BA 2VPXA 1G8KA 2Y0SA 1FEUA 1S3SA 1H5NA 5FTKA 2NVXA 2NVYA 1EXDA 1UHDA 3H0GA 3PLXB 1ZJWA 4ENGA 1KQGA 4FG2A 2AE0X 1QDNA 1H0HA 5GM9A 5GAEW 1E61A 2HCZX 1E5VA 4GA6A 4C2MA 5C18A 1ZYRD 2NWAA 1Q16A 4J3CA 1TWAA 5B6CA 1EUYA 4FERA 1IW7D 4AZDA 2JA5A 1FDIA 4U67S 3GTGA 2JIMA 2WB1A 4L48A 5T5MD 2G6GA 1BW3A 2ENGA 3IR6A 2EEOB 4H3SA 1OA7A 4DMRA 3ENGA 2RD2A 2CW0D 4JS7A 1TWGA 3QWZA 1VHKA 3GTLA 4AONB 2YUJA 4H4KA 3CF5S 4AAYA 3IR5A 2JA7A 1QRUA 2R92A 4CRYG 2ZJQS 1TWHA 2V45A 3DLLS 1V6ZA 5H4UA 3TIWA 4JXZA 1SMYD 2KQAA 4NOHA 4JP7A 1YNND 1I3QA 5GLFA 4JP6A 3J7ZV 4KODA 2PJHB 2PJJA 3IR7A 3X2PA 4D7ZB 1D6KA 4JCWA 3SUKA 1R7RA 1EU1A 3QQ7A 1QRTA 2JIQA 2WAQA 3QQ8A 4IOCS 4JJOA 3X2GA 1VC3B 2GAEA 3X2HA 1K83A 3AIIA 1TWCA 1R27A 1YNJD 5GLXA 2C45A 5FTNA 4FFTA 3GTMA 5EPPA 2B63A 4FG4A 2E2HA 1CR5A 3CZBA 1BW4A 2VPZA 1PT0A 4IOAS 3HU1A 1PT1A 2V3VA 4CRZA 1AA6A 3SUMA 3KW2A 1B75A 1PQHA 1ZC1A 4RV0A 4WF9S 4GA5A 4AYBA 1VHYA 1QTQA 2R93A 1WLFA 3GTOA 2YU9A 2EGVA 5DM6S 3TM7B 2O5JD 3W2WB 1CZ5A 1KQFA 3X2NA 4P2BA 1UHEA 5DM7S 2RE8A 1R9TA 5DYGA 3X2KA 1G8JA 5C1BA 1PPYA 5GLYA 2JIRA 2E7ZA 2PI8A 1SFOA 2A68D 2DMRA 1WC2A 3X2IA 3GTPA 1L8FA 1O0CA 1NYLA 2JA6A 4WFBS 1NXZA 3QC8A 4L69A 1E60A 2A6ED 2VUMA 3X2OA 2G5DA 2VPYA 4AOKB 2VPWA 3PIPS 2Z0YA 4KDLA 1PYQA 1PQEA 4JXXA 5GAHW 5FTJA 4WFAS 2KI8A 5JVHS 3X1LB 4IO9S 5T5ID 1WCMA 3M3GA 4QIWA 1TWFA 3SUJA 2R7ZA 3ML1A 1Y1WA 3O5AA 2EGWA 1Y1VA 1DFUP 4UY88 5DYIA 2JIPA 1TMOA 4V194 5GAGW 1I50A 3SULA 1QCSA 3HU2A 1UDXA 1N10A 4KLNA
chains in the Genus database with same CATH topology
1HD5A 2PNWA 1E18A 3GTKA 3GTJA 1SIWA 1AW8B 5FTMA 4CS0A 3DMRA 4KO8A 2A6HD 1Y5IA 2NYAA 2A69D 3CQZA 1DMSA 3HKZA 2PMZA 3X2LA 5FTLA 1CZ4A 3CF2A 1YLEA 3D30A 2BH0A 3X2MA 1PYUB 4KDIA 1DMRA 3OUGA 1PQFA 3GTQA 3X2JA 4ZM7A 2PICA 3FKIA 2BE5D 2IV2X 1Y4ZA 1OGYA 1E32A 1FDOA 3HU3A 2JIOA 4AVRA 2E2IA 2NAPA 1OA9A 2VPXA 1G8KA 2Y0SA 1H5NA 1S3SA 5FTKA 2NVXA 2NVYA 1UHDA 3H0GA 3PLXB 4ENGA 1KQGA 4FG2A 2AE0X 5GM9A 1H0HA 1QDNA 2HCZX 1E61A 1E5VA 4GA6A 4C2MA 5C18A 1ZYRD 1Q16A 1TWAA 5B6CA 4FERA 1IW7D 4AZDA 2JA5A 1FDIA 3GTGA 2JIMA 2WB1A 4L48A 5T5MD 2G6GA 1BW3A 2ENGA 3IR6A 2EEOB 1OA7A 4DMRA 3ENGA 2CW0D 4JS7A 1TWGA 3QWZA 3GTLA 4AONB 2YUJA 4AAYA 3IR5A 2JA7A 2R92A 4CRYG 1TWHA 2V45A 5H4UA 3TIWA 2KQAA 1SMYD 4NOHA 4JP7A 1YNND 1I3QA 5GLFA 4JP6A 4KODA 2PJJA 3X2PA 2PJHB 3IR7A 4D7ZB 4JCWA 3SUKA 1R7RA 1EU1A 3QQ7A 2JIQA 2WAQA 3QQ8A 4JJOA 3X2GA 1VC3B 2GAEA 3X2HA 1K83A 1TWCA 5GLXA 1R27A 1YNJD 2C45A 5FTNA 4FFTA 3GTMA 5EPPA 2B63A 4FG4A 2E2HA 3CZBA 1BW4A 1CR5A 2VPZA 1PT0A 3HU1A 1PT1A 2V3VA 4CRZA 1AA6A 3SUMA 1PQHA 1ZC1A 4RV0A 4GA5A 4AYBA 2R93A 1WLFA 3GTOA 2YU9A 3TM7B 2O5JD 1CZ5A 1KQFA 3X2NA 1UHEA 1R9TA 3X2KA 5DYGA 1G8JA 5C1BA 1PPYA 5GLYA 2JIRA 2E7ZA 2PI8A 1SFOA 2A68D 2DMRA 1WC2A 3X2IA 3GTPA 1L8FA 2JA6A 3QC8A 1E60A 2A6ED 2VUMA 3X2OA 2G5DA 2VPYA 4AOKB 2VPWA 4KDLA 1PYQA 1PQEA 5FTJA 2KI8A 5T5ID 1WCMA 3M3GA 4QIWA 1TWFA 3SUJA 2R7ZA 3ML1A 1Y1WA 3O5AA 1Y1VA 5DYIA 2JIPA 1TMOA 1I50A 3SULA 1QCSA 3HU2A 1N10A 4KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLY A;  1HD5 A;  2PI8 A;  2PJJ A;  2PNW A;  3X2P A;  4JCW A;  3SUK A;  4ENG A;  4FG2 A;  1WC2 A;  3X2I A;  1L8F A;  2AE0 X;  5GM9 A;  2HCZ X;  4JJO A;  3X2G A;  2GAE A;  3X2O A;  2G5D A;  3X2H A;  5GLX A;  3X2L A;  4FFT A;  4FER A;  4FG4 A;  3CZB A;  1BW4 A;  3D30 A;  2BH0 A;  3X2M A;  4L48 A;  2G6G A;  3SUM A;  2ENG A;  1BW3 A;  1OA7 A;  3ENG A;  3X2J A;  4JS7 A;  4ZM7 A;  2PIC A;  3M3G A;  3SUJ A;  5H4U A;  4AVR A;  2KQA A;  3X2N A;  1OA9 A;  3SUL A;  4JP7 A;  3X2K A;  1N10 A;  4JP6 A; 
#chains in the Genus database with same CATH topology
 1HD5 A;  1E18 A;  2PNW A;  3GTK A;  3GTJ A;  1SIW A;  1AW8 B;  5FTM A;  4CS0 A;  3DMR A;  4KO8 A;  2A6H D;  1Y5I A;  2NYA A;  2A69 D;  3CQZ A;  4WFN S;  1DMS A;  3HKZ A;  5IZN A;  2PMZ A;  3X2L A;  5FTL A;  1CZ4 A;  3CF2 A;  1Z85 A;  3PIO S;  1EUQ A;  1YLE A;  3D30 A;  2BH0 A;  3X2M A;  1PYU B;  4KDI A;  2ZJP S;  1GTS A;  2HZ7 A;  1DMR A;  3OUG A;  5BNZ A;  1PQF A;  3GTQ A;  1GTR A;  2CX8 A;  3X2J A;  4ZM7 A;  1O0B A;  2PIC A;  3FKI A;  2BE5 D;  5HL7 S;  1QRS A;  2ZJR S;  2IV2 X;  5JVG S;  5GAD W;  4JYZ A;  1Y4Z A;  1OGY A;  1E32 A;  1FDO A;  3HU3 A;  4WCE S;  2JIO A;  4AVR A;  2E2I A;  2NAP A;  1OA9 A;  3W2V B;  4E8B A;  2VPX A;  1G8K A;  2Y0S A;  1FEU A;  1S3S A;  1H5N A;  5FTK A;  2NVX A;  2NVY A;  1EXD A;  1UHD A;  3H0G A;  3PLX B;  1ZJW A;  4ENG A;  1KQG A;  4FG2 A;  2AE0 X;  1QDN A;  1H0H A;  5GM9 A;  5GAE W;  1E61 A;  2HCZ X;  1E5V A;  4GA6 A;  4C2M A;  5C18 A;  1ZYR D;  2NWA A;  1Q16 A;  4J3C A;  1TWA A;  5B6C A;  1EUY A;  4FER A;  1IW7 D;  4AZD A;  2JA5 A;  1FDI A;  4U67 S;  3GTG A;  2JIM A;  2WB1 A;  4L48 A;  5T5M D;  2G6G A;  1BW3 A;  2ENG A;  3IR6 A;  2EEO B;  4H3S A;  1OA7 A;  4DMR A;  3ENG A;  2RD2 A;  2CW0 D;  4JS7 A;  1TWG A;  3QWZ A;  1VHK A;  3GTL A;  4AON B;  2YUJ A;  4H4K A;  3CF5 S;  4AAY A;  3IR5 A;  2JA7 A;  1QRU A;  2R92 A;  4CRY G;  2ZJQ S;  1TWH A;  2V45 A;  3DLL S;  1V6Z A;  5H4U A;  3TIW A;  4JXZ A;  1SMY D;  2KQA A;  4NOH A;  4JP7 A;  1YNN D;  1I3Q A;  5GLF A;  4JP6 A;  3J7Z V;  4KOD A;  2PJH B;  2PJJ A;  3IR7 A;  3X2P A;  4D7Z B;  1D6K A;  4JCW A;  3SUK A;  1R7R A;  1EU1 A;  3QQ7 A;  1QRT A;  2JIQ A;  2WAQ A;  3QQ8 A;  4IOC S;  4JJO A;  3X2G A;  1VC3 B;  2GAE A;  3X2H A;  1K83 A;  3AII A;  1TWC A;  1R27 A;  1YNJ D;  5GLX A;  2C45 A;  5FTN A;  4FFT A;  3GTM A;  5EPP A;  2B63 A;  4FG4 A;  2E2H A;  1CR5 A;  3CZB A;  1BW4 A;  2VPZ A;  1PT0 A;  4IOA S;  3HU1 A;  1PT1 A;  2V3V A;  4CRZ A;  1AA6 A;  3SUM A;  3KW2 A;  1B75 A;  1PQH A;  1ZC1 A;  4RV0 A;  4WF9 S;  4GA5 A;  4AYB A;  1VHY A;  1QTQ A;  2R93 A;  1WLF A;  3GTO A;  2YU9 A;  2EGV A;  5DM6 S;  3TM7 B;  2O5J D;  3W2W B;  1CZ5 A;  1KQF A;  3X2N A;  4P2B A;  1UHE A;  5DM7 S;  2RE8 A;  1R9T A;  5DYG A;  3X2K A;  1G8J A;  5C1B A;  1PPY A;  5GLY A;  2JIR A;  2E7Z A;  2PI8 A;  1SFO A;  2A68 D;  2DMR A;  1WC2 A;  3X2I A;  3GTP A;  1L8F A;  1O0C A;  1NYL A;  2JA6 A;  4WFB S;  1NXZ A;  3QC8 A;  4L69 A;  1E60 A;  2A6E D;  2VUM A;  3X2O A;  2G5D A;  2VPY A;  4AOK B;  2VPW A;  3PIP S;  2Z0Y A;  4KDL A;  1PYQ A;  1PQE A;  4JXX A;  5GAH W;  5FTJ A;  4WFA S;  2KI8 A;  5JVH S;  3X1L B;  4IO9 S;  5T5I D;  1WCM A;  3M3G A;  4QIW A;  1TWF A;  3SUJ A;  2R7Z A;  3ML1 A;  1Y1W A;  3O5A A;  2EGW A;  1Y1V A;  1DFU P;  4UY8 8;  5DYI A;  2JIP A;  1TMO A;  4V19 4;  5GAG W;  1I50 A;  3SUL A;  1QCS A;  3HU2 A;  1UDX A;  1N10 A;  4KLN A; 
#chains in the Genus database with same CATH homology
 1HD5 A;  2PNW A;  1E18 A;  3GTK A;  3GTJ A;  1SIW A;  1AW8 B;  5FTM A;  4CS0 A;  3DMR A;  4KO8 A;  2A6H D;  1Y5I A;  2NYA A;  2A69 D;  3CQZ A;  1DMS A;  3HKZ A;  2PMZ A;  3X2L A;  5FTL A;  1CZ4 A;  3CF2 A;  1YLE A;  3D30 A;  2BH0 A;  3X2M A;  1PYU B;  4KDI A;  1DMR A;  3OUG A;  1PQF A;  3GTQ A;  3X2J A;  4ZM7 A;  2PIC A;  3FKI A;  2BE5 D;  2IV2 X;  1Y4Z A;  1OGY A;  1E32 A;  1FDO A;  3HU3 A;  2JIO A;  4AVR A;  2E2I A;  2NAP A;  1OA9 A;  2VPX A;  1G8K A;  2Y0S A;  1H5N A;  1S3S A;  5FTK A;  2NVX A;  2NVY A;  1UHD A;  3H0G A;  3PLX B;  4ENG A;  1KQG A;  4FG2 A;  2AE0 X;  5GM9 A;  1H0H A;  1QDN A;  2HCZ X;  1E61 A;  1E5V A;  4GA6 A;  4C2M A;  5C18 A;  1ZYR D;  1Q16 A;  1TWA A;  5B6C A;  4FER A;  1IW7 D;  4AZD A;  2JA5 A;  1FDI A;  3GTG A;  2JIM A;  2WB1 A;  4L48 A;  5T5M D;  2G6G A;  1BW3 A;  2ENG A;  3IR6 A;  2EEO B;  1OA7 A;  4DMR A;  3ENG A;  2CW0 D;  4JS7 A;  1TWG A;  3QWZ A;  3GTL A;  4AON B;  2YUJ A;  4AAY A;  3IR5 A;  2JA7 A;  2R92 A;  4CRY G;  1TWH A;  2V45 A;  5H4U A;  3TIW A;  2KQA A;  1SMY D;  4NOH A;  4JP7 A;  1YNN D;  1I3Q A;  5GLF A;  4JP6 A;  4KOD A;  2PJJ A;  3X2P A;  2PJH B;  3IR7 A;  4D7Z B;  4JCW A;  3SUK A;  1R7R A;  1EU1 A;  3QQ7 A;  2JIQ A;  2WAQ A;  3QQ8 A;  4JJO A;  3X2G A;  1VC3 B;  2GAE A;  3X2H A;  1K83 A;  1TWC A;  5GLX A;  1R27 A;  1YNJ D;  2C45 A;  5FTN A;  4FFT A;  3GTM A;  5EPP A;  2B63 A;  4FG4 A;  2E2H A;  3CZB A;  1BW4 A;  1CR5 A;  2VPZ A;  1PT0 A;  3HU1 A;  1PT1 A;  2V3V A;  4CRZ A;  1AA6 A;  3SUM A;  1PQH A;  1ZC1 A;  4RV0 A;  4GA5 A;  4AYB A;  2R93 A;  1WLF A;  3GTO A;  2YU9 A;  3TM7 B;  2O5J D;  1CZ5 A;  1KQF A;  3X2N A;  1UHE A;  1R9T A;  3X2K A;  5DYG A;  1G8J A;  5C1B A;  1PPY A;  5GLY A;  2JIR A;  2E7Z A;  2PI8 A;  1SFO A;  2A68 D;  2DMR A;  1WC2 A;  3X2I A;  3GTP A;  1L8F A;  2JA6 A;  3QC8 A;  1E60 A;  2A6E D;  2VUM A;  3X2O A;  2G5D A;  2VPY A;  4AOK B;  2VPW A;  4KDL A;  1PYQ A;  1PQE A;  5FTJ A;  2KI8 A;  5T5I D;  1WCM A;  3M3G A;  4QIW A;  1TWF A;  3SUJ A;  2R7Z A;  3ML1 A;  1Y1W A;  3O5A A;  1Y1V A;  5DYI A;  2JIP A;  1TMO A;  1I50 A;  3SUL A;  1QCS A;  3HU2 A;  1N10 A;  4KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...