2AE0X

Crystal structure of mlta from escherichia coli reveals a unique lytic transglycosylase fold
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
b'SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Crystal Structure of MltA from Escherichia coli Reveals a Unique Lytic Transglycosylase Fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 335
sequence length 335
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03562 MltA MltA specific insert domain
X PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2ae0X01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2ae0X02
2KQAA 2ENGA 3D30A 3SULA 4AVRA 3X2KA 1L8FA 4FFTA 2G5DA 3X2OA 3X2NA 4JP6A 1BW3A 3M3GA 4JCWA 4ENGA 3X2JA 3SUKA 2AE0X 1BW4A 3ENGA 2HCZX 3X2IA 3X2PA 3SUMA 4ZM7A 2BH0A 5H4UA 2PI8A 1OA7A 3X2LA 2PJJA 3SUJA 4JP7A 2G6GA 4FG4A 5GM9A 4JS7A 1WC2A 4JJOA 3CZBA 1N10A 3X2MA 2PICA 2PNWA 5GLYA 1HD5A 1OA9A 5GLXA 3X2GA 3X2HA 4FG2A 4FERA 2GAEA 4L48A
chains in the Genus database with same CATH superfamily
2KQAA 1UHEA 4AVRA 2RE8A 1PPYA 2NVYA 3X2KA 3GTQA 1PQEA 4FFTA 2G5DA 3HU3A 4CS0A 5C1BA 3GTPA 5JVGS 1R27A 3GTMA 3X2OA 3QC8A 5HL7S 1CZ4A 4IOCS 1G8JA 4ENGA 4UY88 3CQZA 3HU2A 2JA5A 3QQ8A 1BW4A 2ZJRS 4C2MA 2A69D 1TWFA 1KQFA 2JIOA 5H4UA 2PI8A 1E61A 4V194 1PQFA 1OGYA 1PYQA 1ZC1A 5EPPA 3GTKA 5GADW 4WF9S 5B6CA 1SFOA 2NAPA 1ZYRD 1NYLA 4JXXA 2E2HA 2BE5D 3CZBA 2R7ZA 2JA7A 1EU1A 1TMOA 2VPXA 1NXZA 5DM6S 1V6ZA 4GA5A 3H0GA 2ENGA 1O0CA 2VPYA 2A6HD 4NOHA 5GAEW 4KDIA 2JA6A 3PIOS 3FKIA 3IR7A 1EUQA 5FTMA 1CR5A 3J7ZV 5C18A 1B75A 2JIMA 1TWGA 4JCWA 1R9TA 3CF5S 2AE0X 1YNND 4JXZA 2CW0D 4IO9S 1DMSA 1YNJD 2WB1A 3W2VB 2YU9A 4KDLA 3GTOA 4QIWA 4ZM7A 2BH0A 1SIWA 2DMRA 2EEOB 1QCSA 5GLFA 4RV0A 2PJJA 5JVHS 1I3QA 2V45A 3SUJA 4JP7A 2G6GA 5T5MD 2CX8A 2B63A 4WCES 1AW8B 4GA6A 5FTKA 2O5JD 3PIPS 4DMRA 2E7ZA 3IR6A 5BNZA 4CRYG 1N10A 1Z85A 4WFNS 3W2WB 5FTNA 1Y1VA 2PNWA 5T5ID 1FDIA 1OA9A 4AOKB 1DFUP 4FERA 2ZJPS 1QRSA 4L48A 5DYGA 2JIPA 3D30A 3ML1A 3SULA 5DM7S 3TIWA 5GAHW 1QRUA 1DMRA 2A68D 5GAGW 4WFAS 1YLEA 1Q16A 2KI8A 1I50A 3M3GA 1Y4ZA 2R92A 3IR5A 3X2JA 3QQ7A 1PT0A 3ENGA 1Y1WA 1R7RA 4KLNA 3TM7B 3X2IA 4H3SA 4E8BA 4P2BA 4KODA 2VPZA 3SUMA 2PMZA 5FTJA 4D7ZB 1OA7A 2A6ED 1QDNA 4AONB 3AIIA 1K83A 4AYBA 2R93A 4L69A 2Z0YA 1TWCA 1GTRA 2NVXA 4FG4A 5GM9A 4JS7A 1E60A 2EGVA 1IW7D 1CZ5A 1AA6A 2VPWA 2C45A 2JIQA 4JJOA 4AAYA 1EUYA 3X2MA 1PT1A 2YUJA 1HD5A 5GLYA 1QRTA 1S3SA 1E18A 1TWAA 2NYAA 1WLFA 1E32A 2JIRA 3OUGA 5FTLA 1L8FA 3KW2A 4WFBS 1G8KA 3HU1A 4H4KA 3PLXB 1PQHA 4J3CA 1E5VA 2NWAA 3QWZA 4JP6A 3X2NA 4AZDA 1BW3A 3X1LB 4JYZA 3GTGA 2E2IA 5IZNA 3SUKA 1TWHA 2IV2X 2HCZX 4CRZA 1D6KA 1UHDA 3X2PA 1VC3B 1VHKA 1Y5IA 5DYIA 1KQGA 3GTLA 2PJHB 2EGWA 1ZJWA 1FDOA 3X2LA 1QTQA 1H5NA 3HKZA 1H0HA 1WCMA 3CF2A 1VHYA 2ZJQS 1PYUB 1O0BA 4IOAS 1FEUA 2HZ7A 1GTSA 4U67S 1SMYD 2Y0SA 2RD2A 1EXDA 3O5AA 1WC2A 3X2HA 1UDXA 2VUMA 2V3VA 3DLLS 3GTJA 2PICA 5GLXA 2WAQA 3DMRA 3X2GA 4FG2A 4KO8A 2GAEA
chains in the Genus database with same CATH topology
2KQAA 4AVRA 1UHEA 1PPYA 2NVYA 3X2KA 3GTQA 4FFTA 1PQEA 2G5DA 3HU3A 4CS0A 5C1BA 3GTPA 1R27A 3GTMA 3X2OA 3QC8A 1CZ4A 1G8JA 4ENGA 3CQZA 3HU2A 2JA5A 1BW4A 3QQ8A 4C2MA 2A69D 1TWFA 1KQFA 2JIOA 5H4UA 2PI8A 1E61A 1PQFA 1OGYA 1PYQA 1ZC1A 5EPPA 3GTKA 5B6CA 1SFOA 2NAPA 1ZYRD 2E2HA 2BE5D 3CZBA 2R7ZA 2JA7A 1EU1A 1TMOA 2VPXA 4GA5A 3H0GA 2ENGA 2VPYA 2A6HD 4NOHA 4KDIA 2JA6A 3FKIA 3IR7A 5FTMA 1CR5A 5C18A 2JIMA 4JCWA 1TWGA 1R9TA 2AE0X 1YNND 2CW0D 1DMSA 1YNJD 2WB1A 2YU9A 4KDLA 3GTOA 4QIWA 4ZM7A 2BH0A 1SIWA 2DMRA 2EEOB 1QCSA 5GLFA 4RV0A 2PJJA 1I3QA 2V45A 3SUJA 4JP7A 2G6GA 5T5MD 2B63A 1AW8B 4GA6A 5FTKA 2O5JD 4DMRA 2E7ZA 3IR6A 4CRYG 1N10A 5FTNA 2PNWA 1Y1VA 5T5ID 1FDIA 1OA9A 4AOKB 4FERA 4L48A 5DYGA 3D30A 3SULA 2JIPA 3ML1A 3TIWA 1DMRA 2A68D 1YLEA 1Q16A 2KI8A 1I50A 3M3GA 1Y4ZA 2R92A 3IR5A 3X2JA 3QQ7A 1PT0A 3ENGA 1Y1WA 1R7RA 4KLNA 3X2IA 3TM7B 4KODA 3SUMA 2VPZA 2PMZA 5FTJA 4D7ZB 1OA7A 2A6ED 1QDNA 4AONB 1K83A 4AYBA 2R93A 1TWCA 4KO8A 2NVXA 4FG4A 5GM9A 4JS7A 1E60A 1IW7D 1CZ5A 1AA6A 4JJOA 2C45A 2JIQA 2VPWA 4AAYA 3X2MA 1PT1A 5GLYA 1HD5A 2YUJA 1S3SA 1E18A 1TWAA 2NYAA 1WLFA 1E32A 2JIRA 3OUGA 5FTLA 1L8FA 1G8KA 3HU1A 3PLXB 1PQHA 1E5VA 3X2NA 4JP6A 3QWZA 1BW3A 4AZDA 3GTGA 2E2IA 3SUKA 1TWHA 2IV2X 2HCZX 4CRZA 3X2PA 1UHDA 1VC3B 1Y5IA 5DYIA 1KQGA 3GTLA 2PJHB 1FDOA 3X2LA 1H5NA 3HKZA 1H0HA 1WCMA 3CF2A 1PYUB 1SMYD 2Y0SA 3O5AA 1WC2A 2VUMA 2V3VA 3GTJA 2PICA 5GLXA 2WAQA 3X2GA 3X2HA 4FG2A 3DMRA 2GAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQA A;  2ENG A;  3D30 A;  3SUL A;  4AVR A;  3X2K A;  1L8F A;  4FFT A;  2G5D A;  3X2O A;  3X2N A;  4JP6 A;  1BW3 A;  3M3G A;  4JCW A;  4ENG A;  3X2J A;  3SUK A;  2AE0 X;  1BW4 A;  3ENG A;  2HCZ X;  3X2I A;  3X2P A;  3SUM A;  4ZM7 A;  2BH0 A;  5H4U A;  2PI8 A;  1OA7 A;  3X2L A;  2PJJ A;  3SUJ A;  4JP7 A;  2G6G A;  4FG4 A;  5GM9 A;  4JS7 A;  1WC2 A;  4JJO A;  3CZB A;  1N10 A;  3X2M A;  2PIC A;  2PNW A;  5GLY A;  1HD5 A;  1OA9 A;  5GLX A;  3X2G A;  3X2H A;  4FG2 A;  4FER A;  2GAE A;  4L48 A; 
#chains in the Genus database with same CATH topology
 2KQA A;  1UHE A;  4AVR A;  2RE8 A;  1PPY A;  2NVY A;  3X2K A;  3GTQ A;  1PQE A;  4FFT A;  2G5D A;  3HU3 A;  4CS0 A;  5C1B A;  3GTP A;  5JVG S;  1R27 A;  3GTM A;  3X2O A;  3QC8 A;  5HL7 S;  1CZ4 A;  4IOC S;  1G8J A;  4ENG A;  4UY8 8;  3CQZ A;  3HU2 A;  2JA5 A;  3QQ8 A;  1BW4 A;  2ZJR S;  4C2M A;  2A69 D;  1TWF A;  1KQF A;  2JIO A;  5H4U A;  2PI8 A;  1E61 A;  4V19 4;  1PQF A;  1OGY A;  1PYQ A;  1ZC1 A;  5EPP A;  3GTK A;  5GAD W;  4WF9 S;  5B6C A;  1SFO A;  2NAP A;  1ZYR D;  1NYL A;  4JXX A;  2E2H A;  2BE5 D;  3CZB A;  2R7Z A;  2JA7 A;  1EU1 A;  1TMO A;  2VPX A;  1NXZ A;  5DM6 S;  1V6Z A;  4GA5 A;  3H0G A;  2ENG A;  1O0C A;  2VPY A;  2A6H D;  4NOH A;  5GAE W;  4KDI A;  2JA6 A;  3PIO S;  3FKI A;  3IR7 A;  1EUQ A;  5FTM A;  1CR5 A;  3J7Z V;  5C18 A;  1B75 A;  2JIM A;  1TWG A;  4JCW A;  1R9T A;  3CF5 S;  2AE0 X;  1YNN D;  4JXZ A;  2CW0 D;  4IO9 S;  1DMS A;  1YNJ D;  2WB1 A;  3W2V B;  2YU9 A;  4KDL A;  3GTO A;  4QIW A;  4ZM7 A;  2BH0 A;  1SIW A;  2DMR A;  2EEO B;  1QCS A;  5GLF A;  4RV0 A;  2PJJ A;  5JVH S;  1I3Q A;  2V45 A;  3SUJ A;  4JP7 A;  2G6G A;  5T5M D;  2CX8 A;  2B63 A;  4WCE S;  1AW8 B;  4GA6 A;  5FTK A;  2O5J D;  3PIP S;  4DMR A;  2E7Z A;  3IR6 A;  5BNZ A;  4CRY G;  1N10 A;  1Z85 A;  4WFN S;  3W2W B;  5FTN A;  1Y1V A;  2PNW A;  5T5I D;  1FDI A;  1OA9 A;  4AOK B;  1DFU P;  4FER A;  2ZJP S;  1QRS A;  4L48 A;  5DYG A;  2JIP A;  3D30 A;  3ML1 A;  3SUL A;  5DM7 S;  3TIW A;  5GAH W;  1QRU A;  1DMR A;  2A68 D;  5GAG W;  4WFA S;  1YLE A;  1Q16 A;  2KI8 A;  1I50 A;  3M3G A;  1Y4Z A;  2R92 A;  3IR5 A;  3X2J A;  3QQ7 A;  1PT0 A;  3ENG A;  1Y1W A;  1R7R A;  4KLN A;  3TM7 B;  3X2I A;  4H3S A;  4E8B A;  4P2B A;  4KOD A;  2VPZ A;  3SUM A;  2PMZ A;  5FTJ A;  4D7Z B;  1OA7 A;  2A6E D;  1QDN A;  4AON B;  3AII A;  1K83 A;  4AYB A;  2R93 A;  4L69 A;  2Z0Y A;  1TWC A;  1GTR A;  2NVX A;  4FG4 A;  5GM9 A;  4JS7 A;  1E60 A;  2EGV A;  1IW7 D;  1CZ5 A;  1AA6 A;  2VPW A;  2C45 A;  2JIQ A;  4JJO A;  4AAY A;  1EUY A;  3X2M A;  1PT1 A;  2YUJ A;  1HD5 A;  5GLY A;  1QRT A;  1S3S A;  1E18 A;  1TWA A;  2NYA A;  1WLF A;  1E32 A;  2JIR A;  3OUG A;  5FTL A;  1L8F A;  3KW2 A;  4WFB S;  1G8K A;  3HU1 A;  4H4K A;  3PLX B;  1PQH A;  4J3C A;  1E5V A;  2NWA A;  3QWZ A;  4JP6 A;  3X2N A;  4AZD A;  1BW3 A;  3X1L B;  4JYZ A;  3GTG A;  2E2I A;  5IZN A;  3SUK A;  1TWH A;  2IV2 X;  2HCZ X;  4CRZ A;  1D6K A;  1UHD A;  3X2P A;  1VC3 B;  1VHK A;  1Y5I A;  5DYI A;  1KQG A;  3GTL A;  2PJH B;  2EGW A;  1ZJW A;  1FDO A;  3X2L A;  1QTQ A;  1H5N A;  3HKZ A;  1H0H A;  1WCM A;  3CF2 A;  1VHY A;  2ZJQ S;  1PYU B;  1O0B A;  4IOA S;  1FEU A;  2HZ7 A;  1GTS A;  4U67 S;  1SMY D;  2Y0S A;  2RD2 A;  1EXD A;  3O5A A;  1WC2 A;  3X2H A;  1UDX A;  2VUM A;  2V3V A;  3DLL S;  3GTJ A;  2PIC A;  5GLX A;  2WAQ A;  3DMR A;  3X2G A;  4FG2 A;  4KO8 A;  2GAE A; 
#chains in the Genus database with same CATH homology
 2KQA A;  4AVR A;  1UHE A;  1PPY A;  2NVY A;  3X2K A;  3GTQ A;  4FFT A;  1PQE A;  2G5D A;  3HU3 A;  4CS0 A;  5C1B A;  3GTP A;  1R27 A;  3GTM A;  3X2O A;  3QC8 A;  1CZ4 A;  1G8J A;  4ENG A;  3CQZ A;  3HU2 A;  2JA5 A;  1BW4 A;  3QQ8 A;  4C2M A;  2A69 D;  1TWF A;  1KQF A;  2JIO A;  5H4U A;  2PI8 A;  1E61 A;  1PQF A;  1OGY A;  1PYQ A;  1ZC1 A;  5EPP A;  3GTK A;  5B6C A;  1SFO A;  2NAP A;  1ZYR D;  2E2H A;  2BE5 D;  3CZB A;  2R7Z A;  2JA7 A;  1EU1 A;  1TMO A;  2VPX A;  4GA5 A;  3H0G A;  2ENG A;  2VPY A;  2A6H D;  4NOH A;  4KDI A;  2JA6 A;  3FKI A;  3IR7 A;  5FTM A;  1CR5 A;  5C18 A;  2JIM A;  4JCW A;  1TWG A;  1R9T A;  2AE0 X;  1YNN D;  2CW0 D;  1DMS A;  1YNJ D;  2WB1 A;  2YU9 A;  4KDL A;  3GTO A;  4QIW A;  4ZM7 A;  2BH0 A;  1SIW A;  2DMR A;  2EEO B;  1QCS A;  5GLF A;  4RV0 A;  2PJJ A;  1I3Q A;  2V45 A;  3SUJ A;  4JP7 A;  2G6G A;  5T5M D;  2B63 A;  1AW8 B;  4GA6 A;  5FTK A;  2O5J D;  4DMR A;  2E7Z A;  3IR6 A;  4CRY G;  1N10 A;  5FTN A;  2PNW A;  1Y1V A;  5T5I D;  1FDI A;  1OA9 A;  4AOK B;  4FER A;  4L48 A;  5DYG A;  3D30 A;  3SUL A;  2JIP A;  3ML1 A;  3TIW A;  1DMR A;  2A68 D;  1YLE A;  1Q16 A;  2KI8 A;  1I50 A;  3M3G A;  1Y4Z A;  2R92 A;  3IR5 A;  3X2J A;  3QQ7 A;  1PT0 A;  3ENG A;  1Y1W A;  1R7R A;  4KLN A;  3X2I A;  3TM7 B;  4KOD A;  3SUM A;  2VPZ A;  2PMZ A;  5FTJ A;  4D7Z B;  1OA7 A;  2A6E D;  1QDN A;  4AON B;  1K83 A;  4AYB A;  2R93 A;  1TWC A;  4KO8 A;  2NVX A;  4FG4 A;  5GM9 A;  4JS7 A;  1E60 A;  1IW7 D;  1CZ5 A;  1AA6 A;  4JJO A;  2C45 A;  2JIQ A;  2VPW A;  4AAY A;  3X2M A;  1PT1 A;  5GLY A;  1HD5 A;  2YUJ A;  1S3S A;  1E18 A;  1TWA A;  2NYA A;  1WLF A;  1E32 A;  2JIR A;  3OUG A;  5FTL A;  1L8F A;  1G8K A;  3HU1 A;  3PLX B;  1PQH A;  1E5V A;  3X2N A;  4JP6 A;  3QWZ A;  1BW3 A;  4AZD A;  3GTG A;  2E2I A;  3SUK A;  1TWH A;  2IV2 X;  2HCZ X;  4CRZ A;  3X2P A;  1UHD A;  1VC3 B;  1Y5I A;  5DYI A;  1KQG A;  3GTL A;  2PJH B;  1FDO A;  3X2L A;  1H5N A;  3HKZ A;  1H0H A;  1WCM A;  3CF2 A;  1PYU B;  1SMY D;  2Y0S A;  3O5A A;  1WC2 A;  2VUM A;  2V3V A;  3GTJ A;  2PIC A;  5GLX A;  2WAQ A;  3X2G A;  3X2H A;  4FG2 A;  3DMR A;  2GAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...