2PI8A

Crystal structure of e. coli mlta with bound chitohexaose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
335
structure length
331
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLIAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 72
structure length 331
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pi8A01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pi8A02
2PJJA 3SUKA 4JP7A 1L8FA 3CZBA 1BW3A 2HCZX 4FFTA 3X2IA 3ENGA 3X2KA 5GM9A 5H4UA 1HD5A 2G6GA 4JS7A 2ENGA 4AVRA 4FERA 1OA7A 5GLYA 3X2GA 1N10A 4FG2A 1BW4A 4ENGA 4ZM7A 2KQAA 3SUMA 3SULA 2PICA 3X2PA 2PI8A 4JCWA 2PNWA 4JJOA 1OA9A 3M3GA 1WC2A 3X2NA 3X2OA 2AE0X 3X2MA 3X2JA 3D30A 4FG4A 3X2LA 2BH0A 4L48A 2G5DA 5GLXA 3SUJA 3X2HA 4JP6A 2GAEA
chains in the Genus database with same CATH superfamily
3HU3A 3CZBA 4IO9S 3GTMA 1QTQA 1PT1A 1BW3A 1PYUB 4WFAS 1TWGA 2E2HA 3PLXB 4NOHA 3GTJA 1CR5A 1Y1VA 1NXZA 1B75A 2ZJRS 5GM9A 5H4UA 2RE8A 3DMRA 4JS7A 2JIOA 2Y0SA 2V3VA 2O5JD 4AZDA 2Z0YA 1EUYA 5T5MD 1DFUP 1E18A 2BE5D 2VPYA 4GA6A 1KQFA 1PQFA 2ZJPS 4FG2A 5HL7S 5DYGA 3PIPS 2KQAA 5DM6S 4KODA 3GTOA 1G8JA 3GTPA 5GAGW 5BNZA 1SIWA 2NVXA 3X2JA 1Z85A 3HKZA 3X2HA 2KI8A 2EGVA 1VHKA 4QIWA 5JVGS 1EUQA 1UHDA 1PPYA 3TM7B 1G8KA 4H3SA 1DMSA 3W2VB 1S3SA 1O0BA 4RV0A 1PQEA 1Y5IA 1FEUA 1I3QA 1QDNA 4JP6A 5FTMA 2HCZX 2VPZA 3QQ8A 3ML1A 3O5AA 1KQGA 4L69A 1D6KA 1I50A 2JA6A 1V6ZA 3X1LB 5B6CA 2NWAA 4V194 2G6GA 1PYQA 5FTJA 3IR6A 1DMRA 4FERA 1E61A 1NYLA 3J7ZV 2ZJQS 2PMZA 2JIQA 3HU2A 4KO8A 3GTLA 1TWFA 4J3CA 4IOAS 4AONB 4JCWA 1WLFA 2PNWA 4JJOA 1FDIA 3QWZA 3M3GA 3QQ7A 1QRSA 1WC2A 2RD2A 1H5NA 5GLFA 2AE0X 3X2NA 3X2OA 3D30A 4H4KA 1H0HA 2G5DA 3X2IA 4D7ZB 2B63A 1QRUA 4CRZA 5GAHW 3GTGA 2GAEA 1AW8B 1SMYD 1R9TA 2JIMA 1IW7D 1L8FA 3CF5S 1UHEA 1R7RA 1ZC1A 2A6ED 1YLEA 2VPWA 4CRYG 4UY88 2A68D 3ENGA 4IOCS 1WCMA 1E32A 1E60A 3X2KA 2CX8A 1CZ4A 3CF2A 3DLLS 1HD5A 2IV2X 4AOKB 2ENGA 4AVRA 1QRTA 2JIPA 2A6HD 3GTQA 1K83A 1UDXA 4JYZA 1CZ5A 3OUGA 4KLNA 4KDIA 4KDLA 1N10A 2C45A 1BW4A 1TWCA 2NAPA 4ENGA 4WFBS 2R93A 1O0CA 2R7ZA 2WB1A 3W2WB 1R27A 5GADW 2YU9A 2PICA 2NYAA 3QC8A 5T5ID 4AAYA 3AIIA 4E8BA 1ZJWA 2E7ZA 1OA9A 2VUMA 4P2BA 2CW0D 1Q16A 3H0GA 1VHYA 5FTLA 4FG4A 3X2LA 2BH0A 4L48A 1YNJD 5GLXA 5GAEW 1TWAA 2JIRA 2PJJA 3SUKA 1AA6A 1SFOA 1EXDA 5FTKA 1E5VA 1OGYA 4JP7A 5C1BA 4U67S 2VPXA 5DYIA 5FTNA 5DM7S 2V45A 3CQZA 4FFTA 4WCES 4WF9S 2R92A 1YNND 4DMRA 1ZYRD 3HU1A 4GA5A 4WFNS 5IZNA 3IR5A 3GTKA 2JA7A 3IR7A 1QCSA 2YUJA 3TIWA 4AYBA 4JXXA 1OA7A 5GLYA 1FDOA 3X2GA 2HZ7A 4CS0A 1TWHA 1Y1WA 2JA5A 3PIOS 4JXZA 3KW2A 2PJHB 3FKIA 4ZM7A 5EPPA 3SUMA 3SULA 3X2PA 1GTSA 2A69D 2EEOB 2PI8A 2EGWA 5JVHS 5C18A 1Y4ZA 2WAQA 1GTRA 1PT0A 2E2IA 1PQHA 1VC3B 3X2MA 2DMRA 2NVYA 1TMOA 3SUJA 4C2MA 1EU1A
chains in the Genus database with same CATH topology
3HU3A 3CZBA 3GTMA 1BW3A 1PT1A 1PYUB 1TWGA 2E2HA 3PLXB 4NOHA 3GTJA 1CR5A 1Y1VA 5GM9A 5H4UA 3DMRA 4JS7A 2JIOA 2Y0SA 2V3VA 2O5JD 4AZDA 5T5MD 1E18A 2BE5D 2VPYA 4GA6A 1KQFA 1PQFA 4FG2A 5DYGA 2KQAA 4KODA 3GTOA 1G8JA 3GTPA 1SIWA 2NVXA 3X2JA 3HKZA 3X2HA 2KI8A 4QIWA 1PPYA 1UHDA 3TM7B 1DMSA 1S3SA 4RV0A 1PQEA 1Y5IA 1I3QA 1QDNA 4JP6A 5FTMA 2HCZX 2VPZA 3QQ8A 3ML1A 3O5AA 1KQGA 1I50A 2JA6A 5B6CA 2G6GA 1PYQA 5FTJA 3IR6A 4FERA 1DMRA 1E61A 2PMZA 2JIQA 3HU2A 4KO8A 3GTLA 1TWFA 4AONB 4JCWA 1WLFA 2PNWA 4JJOA 1FDIA 3QWZA 3M3GA 3QQ7A 1WC2A 3X2NA 3X2OA 2AE0X 1H5NA 5GLFA 3D30A 2G5DA 3X2IA 1H0HA 4D7ZB 2B63A 4CRZA 3GTGA 2GAEA 1AW8B 1SMYD 1R9TA 2JIMA 1IW7D 1L8FA 1UHEA 1R7RA 1ZC1A 2A6ED 1YLEA 2VPWA 4CRYG 2A68D 3ENGA 1WCMA 3X2KA 1E32A 1E60A 1CZ4A 3CF2A 1HD5A 2IV2X 4AOKB 2ENGA 4AVRA 2JIPA 2A6HD 3GTQA 1K83A 1CZ5A 3OUGA 4KLNA 4KDIA 4KDLA 1N10A 2C45A 1BW4A 1TWCA 2NAPA 4ENGA 2R93A 2R7ZA 2WB1A 1R27A 2YU9A 2PICA 2NYAA 3QC8A 5T5ID 4AAYA 2E7ZA 1OA9A 2VUMA 2CW0D 1Q16A 3H0GA 5FTLA 4FG4A 3X2LA 2BH0A 4L48A 5GLXA 1YNJD 1TWAA 2JIRA 2PJJA 3SUKA 1AA6A 1SFOA 5FTKA 4JP7A 1E5VA 1OGYA 5C1BA 2VPXA 5DYIA 5FTNA 2V45A 4FFTA 3CQZA 2R92A 1YNND 4DMRA 1ZYRD 3HU1A 4GA5A 3IR5A 3GTKA 2JA7A 3IR7A 1QCSA 2YUJA 3TIWA 4AYBA 1OA7A 5GLYA 1FDOA 3X2GA 4CS0A 1TWHA 1Y1WA 2JA5A 1EU1A 2PJHB 4ZM7A 3FKIA 5EPPA 3SUMA 3SULA 3X2PA 2A69D 2PI8A 2EEOB 5C18A 1Y4ZA 2WAQA 1PT0A 2E2IA 1PQHA 3X2MA 1VC3B 2DMRA 2NVYA 1TMOA 3SUJA 4C2MA 1G8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJJ A;  3SUK A;  4JP7 A;  1L8F A;  3CZB A;  1BW3 A;  2HCZ X;  4FFT A;  3X2I A;  3ENG A;  3X2K A;  5GM9 A;  5H4U A;  1HD5 A;  2G6G A;  4JS7 A;  2ENG A;  4AVR A;  4FER A;  1OA7 A;  5GLY A;  3X2G A;  1N10 A;  4FG2 A;  1BW4 A;  4ENG A;  4ZM7 A;  2KQA A;  3SUM A;  3SUL A;  2PIC A;  3X2P A;  2PI8 A;  4JCW A;  2PNW A;  4JJO A;  1OA9 A;  3M3G A;  1WC2 A;  3X2N A;  3X2O A;  2AE0 X;  3X2M A;  3X2J A;  3D30 A;  4FG4 A;  3X2L A;  2BH0 A;  4L48 A;  2G5D A;  5GLX A;  3SUJ A;  3X2H A;  4JP6 A;  2GAE A; 
#chains in the Genus database with same CATH topology
 3HU3 A;  3CZB A;  4IO9 S;  3GTM A;  1QTQ A;  1PT1 A;  1BW3 A;  1PYU B;  4WFA S;  1TWG A;  2E2H A;  3PLX B;  4NOH A;  3GTJ A;  1CR5 A;  1Y1V A;  1NXZ A;  1B75 A;  2ZJR S;  5GM9 A;  5H4U A;  2RE8 A;  3DMR A;  4JS7 A;  2JIO A;  2Y0S A;  2V3V A;  2O5J D;  4AZD A;  2Z0Y A;  1EUY A;  5T5M D;  1DFU P;  1E18 A;  2BE5 D;  2VPY A;  4GA6 A;  1KQF A;  1PQF A;  2ZJP S;  4FG2 A;  5HL7 S;  5DYG A;  3PIP S;  2KQA A;  5DM6 S;  4KOD A;  3GTO A;  1G8J A;  3GTP A;  5GAG W;  5BNZ A;  1SIW A;  2NVX A;  3X2J A;  1Z85 A;  3HKZ A;  3X2H A;  2KI8 A;  2EGV A;  1VHK A;  4QIW A;  5JVG S;  1EUQ A;  1UHD A;  1PPY A;  3TM7 B;  1G8K A;  4H3S A;  1DMS A;  3W2V B;  1S3S A;  1O0B A;  4RV0 A;  1PQE A;  1Y5I A;  1FEU A;  1I3Q A;  1QDN A;  4JP6 A;  5FTM A;  2HCZ X;  2VPZ A;  3QQ8 A;  3ML1 A;  3O5A A;  1KQG A;  4L69 A;  1D6K A;  1I50 A;  2JA6 A;  1V6Z A;  3X1L B;  5B6C A;  2NWA A;  4V19 4;  2G6G A;  1PYQ A;  5FTJ A;  3IR6 A;  1DMR A;  4FER A;  1E61 A;  1NYL A;  3J7Z V;  2ZJQ S;  2PMZ A;  2JIQ A;  3HU2 A;  4KO8 A;  3GTL A;  1TWF A;  4J3C A;  4IOA S;  4AON B;  4JCW A;  1WLF A;  2PNW A;  4JJO A;  1FDI A;  3QWZ A;  3M3G A;  3QQ7 A;  1QRS A;  1WC2 A;  2RD2 A;  1H5N A;  5GLF A;  2AE0 X;  3X2N A;  3X2O A;  3D30 A;  4H4K A;  1H0H A;  2G5D A;  3X2I A;  4D7Z B;  2B63 A;  1QRU A;  4CRZ A;  5GAH W;  3GTG A;  2GAE A;  1AW8 B;  1SMY D;  1R9T A;  2JIM A;  1IW7 D;  1L8F A;  3CF5 S;  1UHE A;  1R7R A;  1ZC1 A;  2A6E D;  1YLE A;  2VPW A;  4CRY G;  4UY8 8;  2A68 D;  3ENG A;  4IOC S;  1WCM A;  1E32 A;  1E60 A;  3X2K A;  2CX8 A;  1CZ4 A;  3CF2 A;  3DLL S;  1HD5 A;  2IV2 X;  4AOK B;  2ENG A;  4AVR A;  1QRT A;  2JIP A;  2A6H D;  3GTQ A;  1K83 A;  1UDX A;  4JYZ A;  1CZ5 A;  3OUG A;  4KLN A;  4KDI A;  4KDL A;  1N10 A;  2C45 A;  1BW4 A;  1TWC A;  2NAP A;  4ENG A;  4WFB S;  2R93 A;  1O0C A;  2R7Z A;  2WB1 A;  3W2W B;  1R27 A;  5GAD W;  2YU9 A;  2PIC A;  2NYA A;  3QC8 A;  5T5I D;  4AAY A;  3AII A;  4E8B A;  1ZJW A;  2E7Z A;  1OA9 A;  2VUM A;  4P2B A;  2CW0 D;  1Q16 A;  3H0G A;  1VHY A;  5FTL A;  4FG4 A;  3X2L A;  2BH0 A;  4L48 A;  1YNJ D;  5GLX A;  5GAE W;  1TWA A;  2JIR A;  2PJJ A;  3SUK A;  1AA6 A;  1SFO A;  1EXD A;  5FTK A;  1E5V A;  1OGY A;  4JP7 A;  5C1B A;  4U67 S;  2VPX A;  5DYI A;  5FTN A;  5DM7 S;  2V45 A;  3CQZ A;  4FFT A;  4WCE S;  4WF9 S;  2R92 A;  1YNN D;  4DMR A;  1ZYR D;  3HU1 A;  4GA5 A;  4WFN S;  5IZN A;  3IR5 A;  3GTK A;  2JA7 A;  3IR7 A;  1QCS A;  2YUJ A;  3TIW A;  4AYB A;  4JXX A;  1OA7 A;  5GLY A;  1FDO A;  3X2G A;  2HZ7 A;  4CS0 A;  1TWH A;  1Y1W A;  2JA5 A;  3PIO S;  4JXZ A;  3KW2 A;  2PJH B;  3FKI A;  4ZM7 A;  5EPP A;  3SUM A;  3SUL A;  3X2P A;  1GTS A;  2A69 D;  2EEO B;  2PI8 A;  2EGW A;  5JVH S;  5C18 A;  1Y4Z A;  2WAQ A;  1GTR A;  1PT0 A;  2E2I A;  1PQH A;  1VC3 B;  3X2M A;  2DMR A;  2NVY A;  1TMO A;  3SUJ A;  4C2M A;  1EU1 A; 
#chains in the Genus database with same CATH homology
 3HU3 A;  3CZB A;  3GTM A;  1BW3 A;  1PT1 A;  1PYU B;  1TWG A;  2E2H A;  3PLX B;  4NOH A;  3GTJ A;  1CR5 A;  1Y1V A;  5GM9 A;  5H4U A;  3DMR A;  4JS7 A;  2JIO A;  2Y0S A;  2V3V A;  2O5J D;  4AZD A;  5T5M D;  1E18 A;  2BE5 D;  2VPY A;  4GA6 A;  1KQF A;  1PQF A;  4FG2 A;  5DYG A;  2KQA A;  4KOD A;  3GTO A;  1G8J A;  3GTP A;  1SIW A;  2NVX A;  3X2J A;  3HKZ A;  3X2H A;  2KI8 A;  4QIW A;  1PPY A;  1UHD A;  3TM7 B;  1DMS A;  1S3S A;  4RV0 A;  1PQE A;  1Y5I A;  1I3Q A;  1QDN A;  4JP6 A;  5FTM A;  2HCZ X;  2VPZ A;  3QQ8 A;  3ML1 A;  3O5A A;  1KQG A;  1I50 A;  2JA6 A;  5B6C A;  2G6G A;  1PYQ A;  5FTJ A;  3IR6 A;  4FER A;  1DMR A;  1E61 A;  2PMZ A;  2JIQ A;  3HU2 A;  4KO8 A;  3GTL A;  1TWF A;  4AON B;  4JCW A;  1WLF A;  2PNW A;  4JJO A;  1FDI A;  3QWZ A;  3M3G A;  3QQ7 A;  1WC2 A;  3X2N A;  3X2O A;  2AE0 X;  1H5N A;  5GLF A;  3D30 A;  2G5D A;  3X2I A;  1H0H A;  4D7Z B;  2B63 A;  4CRZ A;  3GTG A;  2GAE A;  1AW8 B;  1SMY D;  1R9T A;  2JIM A;  1IW7 D;  1L8F A;  1UHE A;  1R7R A;  1ZC1 A;  2A6E D;  1YLE A;  2VPW A;  4CRY G;  2A68 D;  3ENG A;  1WCM A;  3X2K A;  1E32 A;  1E60 A;  1CZ4 A;  3CF2 A;  1HD5 A;  2IV2 X;  4AOK B;  2ENG A;  4AVR A;  2JIP A;  2A6H D;  3GTQ A;  1K83 A;  1CZ5 A;  3OUG A;  4KLN A;  4KDI A;  4KDL A;  1N10 A;  2C45 A;  1BW4 A;  1TWC A;  2NAP A;  4ENG A;  2R93 A;  2R7Z A;  2WB1 A;  1R27 A;  2YU9 A;  2PIC A;  2NYA A;  3QC8 A;  5T5I D;  4AAY A;  2E7Z A;  1OA9 A;  2VUM A;  2CW0 D;  1Q16 A;  3H0G A;  5FTL A;  4FG4 A;  3X2L A;  2BH0 A;  4L48 A;  5GLX A;  1YNJ D;  1TWA A;  2JIR A;  2PJJ A;  3SUK A;  1AA6 A;  1SFO A;  5FTK A;  4JP7 A;  1E5V A;  1OGY A;  5C1B A;  2VPX A;  5DYI A;  5FTN A;  2V45 A;  4FFT A;  3CQZ A;  2R92 A;  1YNN D;  4DMR A;  1ZYR D;  3HU1 A;  4GA5 A;  3IR5 A;  3GTK A;  2JA7 A;  3IR7 A;  1QCS A;  2YUJ A;  3TIW A;  4AYB A;  1OA7 A;  5GLY A;  1FDO A;  3X2G A;  4CS0 A;  1TWH A;  1Y1W A;  2JA5 A;  1EU1 A;  2PJH B;  4ZM7 A;  3FKI A;  5EPP A;  3SUM A;  3SUL A;  3X2P A;  2A69 D;  2PI8 A;  2EEO B;  5C18 A;  1Y4Z A;  2WAQ A;  1PT0 A;  2E2I A;  1PQH A;  3X2M A;  1VC3 B;  2DMR A;  2NVY A;  1TMO A;  3SUJ A;  4C2M A;  1G8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...