2PI8A

Crystal structure of e. coli mlta with bound chitohexaose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
335
structure length
331
Chain Sequence
b'SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLIAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 72
structure length 331
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pi8A01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pi8A02
4JP7A 1OA7A 2PJJA 4JCWA 3X2IA 3X2HA 3X2PA 3X2GA 2ENGA 5H4UA 3X2MA 1HD5A 4FG4A 1WC2A 3X2JA 3X2LA 1OA9A 4FG2A 1BW4A 3M3GA 4L48A 2PICA 3D30A 1N10A 5GM9A 3X2NA 3X2OA 4ENGA 2PNWA 4JJOA 2G6GA 2GAEA 2BH0A 3ENGA 5GLXA 3CZBA 2G5DA 3SUMA 2KQAA 2PI8A 4JP6A 3X2KA 1BW3A 4FFTA 3SUJA 1L8FA 4JS7A 4ZM7A 3SUKA 4FERA 5GLYA 2AE0X 4AVRA 2HCZX 3SULA
chains in the Genus database with same CATH superfamily
2DMRA 1AW8B 2JIRA 4KDIA 4AYBA 3HU1A 1SIWA 2E2HA 2E2IA 3PIOS 1PQHA 4IOCS 2EEOB 4IOAS 2BE5D 2A6HD 1DMRA 4FG4A 5FTKA 3X2MA 2B63A 2RE8A 2VPZA 1QRSA 3PIPS 5T5ID 5C1BA 2R7ZA 1V6ZA 2A68D 2V3VA 1E61A 1OA9A 2C45A 4JXZA 2KI8A 1Y4ZA 3QC8A 1TWGA 3GTLA 1TWHA 2NWAA 4H4KA 4KO8A 5BNZA 1IW7D 1E18A 1DMSA 2PNWA 1VHYA 5FTMA 4JJOA 2A69D 2G6GA 1PYQA 1UHEA 1TWFA 5FTNA 4AAYA 3ENGA 4CRYG 1VHKA 5GLXA 3SUMA 3KW2A 1OGYA 3W2VB 2PI8A 3PLXB 1G8JA 3GTMA 1PT0A 4FFTA 1I50A 1FDIA 3SUJA 4J3CA 4P2BA 2HZ7A 5T5MD 2ZJQS 2A6ED 1TWAA 2HCZX 4WFBS 1FDOA 5FTLA 1QTQA 1YNND 3GTGA 2JIMA 5DYIA 1EUYA 3GTOA 2WAQA 5H4UA 4KODA 5GAEW 4WFNS 1FEUA 2JIOA 1R9TA 1DFUP 1PT1A 1WC2A 2WB1A 4CRZA 4NOHA 1EXDA 1AA6A 4V194 2JIQA 4FG2A 4D7ZB 2NAPA 4KLNA 3M3GA 1WLFA 3QQ8A 4C2MA 3DLLS 1D6KA 1N10A 2JIPA 5GM9A 1GTSA 2V45A 2EGVA 2VUMA 4JYZA 1CZ5A 3AIIA 1H5NA 1I3QA 2CW0D 2JA7A 1L8FA 4E8BA 3HU2A 4IO9S 1ZJWA 1EUQA 4FERA 1KQFA 2CX8A 2PMZA 1PYUB 4WCES 1B75A 1CR5A 2IV2X 3O5AA 4JP7A 1OA7A 1Q16A 3TIWA 3X2HA 2Z0YA 3CF5S 3X2PA 3IR7A 2PJHB 3X2GA 2ENGA 4WF9S 1QDNA 2VPYA 3HU3A 1NYLA 1HD5A 1SMYD 1Y1VA 5C18A 1Z85A 5DM7S 1QRUA 4DMRA 4WFAS 3X2JA 1G8KA 2R93A 1BW4A 2VPWA 4GA6A 3IR5A 4L48A 3GTJA 1R27A 2ZJRS 1O0CA 1O0BA 4ENGA 2O5JD 3GTKA 1K83A 1ZYRD 2GAEA 1PPYA 3CF2A 4RV0A 3J7ZV 1Y5IA 2G5DA 3CZBA 4KDLA 2KQAA 3CQZA 4JP6A 1BW3A 5DYGA 4L69A 1UDXA 1GTRA 1ZC1A 2VPXA 3SUKA 1KQGA 1E5VA 5GLYA 1CZ4A 1NXZA 3HKZA 3W2WB 3SULA 3QQ7A 1E60A 3OUGA 3GTQA 3H0GA 2JA5A 5IZNA 1QRTA 1UHDA 2PJJA 5GAHW 4JXXA 4JCWA 1TWCA 5GLFA 3X2IA 1Y1WA 5GADW 2YU9A 3GTPA 4H3SA 5DM6S 1S3SA 5FTJA 4CS0A 3QWZA 5EPPA 3X1LB 1TMOA 3IR6A 2EGWA 4GA5A 1H0HA 2NVYA 3X2LA 3FKIA 1SFOA 5JVHS 1PQEA 2YUJA 3ML1A 2NVXA 1EU1A 2PICA 3D30A 3X2NA 3X2OA 4U67S 5GAGW 2JA6A 5HL7S 2Y0SA 5B6CA 4UY88 1YNJD 1VC3B 2BH0A 4QIWA 1E32A 1PQFA 2R92A 2RD2A 5JVGS 1WCMA 3X2KA 3TM7B 2E7ZA 4JS7A 4AZDA 4ZM7A 1YLEA 1R7RA 2AE0X 2ZJPS 4AVRA 3DMRA 4AOKB 4AONB 1QCSA 2NYAA
chains in the Genus database with same CATH topology
2DMRA 1AW8B 2JIRA 4KDIA 4AYBA 3HU1A 1SIWA 2E2HA 2E2IA 1PQHA 2EEOB 2BE5D 3X2MA 4FG4A 1DMRA 2A6HD 5FTKA 2B63A 2VPZA 5T5ID 5C1BA 2R7ZA 2A68D 2V3VA 1E61A 1OA9A 2C45A 2KI8A 1Y4ZA 3QC8A 1TWGA 3GTLA 1TWHA 4KO8A 1IW7D 1E18A 2PNWA 1DMSA 5FTMA 4JJOA 2G6GA 1PYQA 1TWFA 1UHEA 2A69D 5FTNA 4AAYA 3ENGA 4CRYG 5GLXA 3SUMA 1OGYA 2PI8A 3PLXB 1G8JA 3GTMA 1PT0A 4FFTA 1I50A 3SUJA 1FDIA 5T5MD 2A6ED 1TWAA 2HCZX 1FDOA 5FTLA 1YNND 3GTGA 2JIMA 5DYIA 3GTOA 2WAQA 5H4UA 4KODA 2JIOA 1R9TA 1WC2A 1PT1A 2WB1A 4CRZA 4NOHA 1AA6A 2JIQA 4FG2A 4D7ZB 2NAPA 4KLNA 3M3GA 1WLFA 3QQ8A 4C2MA 1N10A 5GM9A 2JIPA 2V45A 2VUMA 1CZ5A 1H5NA 1I3QA 2CW0D 2JA7A 1L8FA 3HU2A 4FERA 1KQFA 2PMZA 1PYUB 1CR5A 2IV2X 3O5AA 4JP7A 1OA7A 1Q16A 3TIWA 3X2HA 3X2PA 3X2GA 2PJHB 3IR7A 2ENGA 1QDNA 2VPYA 3HU3A 1HD5A 1SMYD 1Y1VA 5C18A 4DMRA 3X2JA 1G8KA 2R93A 1BW4A 2VPWA 4GA6A 3IR5A 4L48A 3GTJA 1R27A 4ENGA 2O5JD 3GTKA 1K83A 1ZYRD 2GAEA 1PPYA 3CF2A 4RV0A 1Y5IA 3CZBA 2G5DA 4KDLA 2KQAA 4JP6A 1BW3A 3CQZA 5DYGA 1ZC1A 2VPXA 3SUKA 1KQGA 5GLYA 1E5VA 1CZ4A 3HKZA 3SULA 3QQ7A 1E60A 3OUGA 3GTQA 3H0GA 2JA5A 1UHDA 2PJJA 4JCWA 3X2IA 1TWCA 5GLFA 1Y1WA 2YU9A 3GTPA 1S3SA 5FTJA 4CS0A 3QWZA 5EPPA 1TMOA 3IR6A 4GA5A 1H0HA 3X2LA 2NVYA 3FKIA 1SFOA 1PQEA 2YUJA 3ML1A 2NVXA 1EU1A 2PICA 3D30A 3X2NA 3X2OA 2JA6A 2Y0SA 5B6CA 1YNJD 1VC3B 2BH0A 4QIWA 1E32A 1PQFA 2R92A 1WCMA 3X2KA 3TM7B 2E7ZA 4JS7A 4AZDA 4ZM7A 1YLEA 1R7RA 2AE0X 4AVRA 3DMRA 4AOKB 4AONB 1QCSA 2NYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JP7 A;  1OA7 A;  2PJJ A;  4JCW A;  3X2I A;  3X2H A;  3X2P A;  3X2G A;  2ENG A;  5H4U A;  3X2M A;  1HD5 A;  4FG4 A;  1WC2 A;  3X2J A;  3X2L A;  1OA9 A;  4FG2 A;  1BW4 A;  3M3G A;  4L48 A;  2PIC A;  3D30 A;  1N10 A;  5GM9 A;  3X2N A;  3X2O A;  4ENG A;  2PNW A;  4JJO A;  2G6G A;  2GAE A;  2BH0 A;  3ENG A;  5GLX A;  3CZB A;  2G5D A;  3SUM A;  2KQA A;  2PI8 A;  4JP6 A;  3X2K A;  1BW3 A;  4FFT A;  3SUJ A;  1L8F A;  4JS7 A;  4ZM7 A;  3SUK A;  4FER A;  5GLY A;  2AE0 X;  4AVR A;  2HCZ X;  3SUL A; 
#chains in the Genus database with same CATH topology
 2DMR A;  1AW8 B;  2JIR A;  4KDI A;  4AYB A;  3HU1 A;  1SIW A;  2E2H A;  2E2I A;  3PIO S;  1PQH A;  4IOC S;  2EEO B;  4IOA S;  2BE5 D;  2A6H D;  1DMR A;  4FG4 A;  5FTK A;  3X2M A;  2B63 A;  2RE8 A;  2VPZ A;  1QRS A;  3PIP S;  5T5I D;  5C1B A;  2R7Z A;  1V6Z A;  2A68 D;  2V3V A;  1E61 A;  1OA9 A;  2C45 A;  4JXZ A;  2KI8 A;  1Y4Z A;  3QC8 A;  1TWG A;  3GTL A;  1TWH A;  2NWA A;  4H4K A;  4KO8 A;  5BNZ A;  1IW7 D;  1E18 A;  1DMS A;  2PNW A;  1VHY A;  5FTM A;  4JJO A;  2A69 D;  2G6G A;  1PYQ A;  1UHE A;  1TWF A;  5FTN A;  4AAY A;  3ENG A;  4CRY G;  1VHK A;  5GLX A;  3SUM A;  3KW2 A;  1OGY A;  3W2V B;  2PI8 A;  3PLX B;  1G8J A;  3GTM A;  1PT0 A;  4FFT A;  1I50 A;  1FDI A;  3SUJ A;  4J3C A;  4P2B A;  2HZ7 A;  5T5M D;  2ZJQ S;  2A6E D;  1TWA A;  2HCZ X;  4WFB S;  1FDO A;  5FTL A;  1QTQ A;  1YNN D;  3GTG A;  2JIM A;  5DYI A;  1EUY A;  3GTO A;  2WAQ A;  5H4U A;  4KOD A;  5GAE W;  4WFN S;  1FEU A;  2JIO A;  1R9T A;  1DFU P;  1PT1 A;  1WC2 A;  2WB1 A;  4CRZ A;  4NOH A;  1EXD A;  1AA6 A;  4V19 4;  2JIQ A;  4FG2 A;  4D7Z B;  2NAP A;  4KLN A;  3M3G A;  1WLF A;  3QQ8 A;  4C2M A;  3DLL S;  1D6K A;  1N10 A;  2JIP A;  5GM9 A;  1GTS A;  2V45 A;  2EGV A;  2VUM A;  4JYZ A;  1CZ5 A;  3AII A;  1H5N A;  1I3Q A;  2CW0 D;  2JA7 A;  1L8F A;  4E8B A;  3HU2 A;  4IO9 S;  1ZJW A;  1EUQ A;  4FER A;  1KQF A;  2CX8 A;  2PMZ A;  1PYU B;  4WCE S;  1B75 A;  1CR5 A;  2IV2 X;  3O5A A;  4JP7 A;  1OA7 A;  1Q16 A;  3TIW A;  3X2H A;  2Z0Y A;  3CF5 S;  3X2P A;  3IR7 A;  2PJH B;  3X2G A;  2ENG A;  4WF9 S;  1QDN A;  2VPY A;  3HU3 A;  1NYL A;  1HD5 A;  1SMY D;  1Y1V A;  5C18 A;  1Z85 A;  5DM7 S;  1QRU A;  4DMR A;  4WFA S;  3X2J A;  1G8K A;  2R93 A;  1BW4 A;  2VPW A;  4GA6 A;  3IR5 A;  4L48 A;  3GTJ A;  1R27 A;  2ZJR S;  1O0C A;  1O0B A;  4ENG A;  2O5J D;  3GTK A;  1K83 A;  1ZYR D;  2GAE A;  1PPY A;  3CF2 A;  4RV0 A;  3J7Z V;  1Y5I A;  2G5D A;  3CZB A;  4KDL A;  2KQA A;  3CQZ A;  4JP6 A;  1BW3 A;  5DYG A;  4L69 A;  1UDX A;  1GTR A;  1ZC1 A;  2VPX A;  3SUK A;  1KQG A;  1E5V A;  5GLY A;  1CZ4 A;  1NXZ A;  3HKZ A;  3W2W B;  3SUL A;  3QQ7 A;  1E60 A;  3OUG A;  3GTQ A;  3H0G A;  2JA5 A;  5IZN A;  1QRT A;  1UHD A;  2PJJ A;  5GAH W;  4JXX A;  4JCW A;  1TWC A;  5GLF A;  3X2I A;  1Y1W A;  5GAD W;  2YU9 A;  3GTP A;  4H3S A;  5DM6 S;  1S3S A;  5FTJ A;  4CS0 A;  3QWZ A;  5EPP A;  3X1L B;  1TMO A;  3IR6 A;  2EGW A;  4GA5 A;  1H0H A;  2NVY A;  3X2L A;  3FKI A;  1SFO A;  5JVH S;  1PQE A;  2YUJ A;  3ML1 A;  2NVX A;  1EU1 A;  2PIC A;  3D30 A;  3X2N A;  3X2O A;  4U67 S;  5GAG W;  2JA6 A;  5HL7 S;  2Y0S A;  5B6C A;  4UY8 8;  1YNJ D;  1VC3 B;  2BH0 A;  4QIW A;  1E32 A;  1PQF A;  2R92 A;  2RD2 A;  5JVG S;  1WCM A;  3X2K A;  3TM7 B;  2E7Z A;  4JS7 A;  4AZD A;  4ZM7 A;  1YLE A;  1R7R A;  2AE0 X;  2ZJP S;  4AVR A;  3DMR A;  4AOK B;  4AON B;  1QCS A;  2NYA A; 
#chains in the Genus database with same CATH homology
 2DMR A;  1AW8 B;  2JIR A;  4KDI A;  4AYB A;  3HU1 A;  1SIW A;  2E2H A;  2E2I A;  1PQH A;  2EEO B;  2BE5 D;  3X2M A;  4FG4 A;  1DMR A;  2A6H D;  5FTK A;  2B63 A;  2VPZ A;  5T5I D;  5C1B A;  2R7Z A;  2A68 D;  2V3V A;  1E61 A;  1OA9 A;  2C45 A;  2KI8 A;  1Y4Z A;  3QC8 A;  1TWG A;  3GTL A;  1TWH A;  4KO8 A;  1IW7 D;  1E18 A;  2PNW A;  1DMS A;  5FTM A;  4JJO A;  2G6G A;  1PYQ A;  1TWF A;  1UHE A;  2A69 D;  5FTN A;  4AAY A;  3ENG A;  4CRY G;  5GLX A;  3SUM A;  1OGY A;  2PI8 A;  3PLX B;  1G8J A;  3GTM A;  1PT0 A;  4FFT A;  1I50 A;  3SUJ A;  1FDI A;  5T5M D;  2A6E D;  1TWA A;  2HCZ X;  1FDO A;  5FTL A;  1YNN D;  3GTG A;  2JIM A;  5DYI A;  3GTO A;  2WAQ A;  5H4U A;  4KOD A;  2JIO A;  1R9T A;  1WC2 A;  1PT1 A;  2WB1 A;  4CRZ A;  4NOH A;  1AA6 A;  2JIQ A;  4FG2 A;  4D7Z B;  2NAP A;  4KLN A;  3M3G A;  1WLF A;  3QQ8 A;  4C2M A;  1N10 A;  5GM9 A;  2JIP A;  2V45 A;  2VUM A;  1CZ5 A;  1H5N A;  1I3Q A;  2CW0 D;  2JA7 A;  1L8F A;  3HU2 A;  4FER A;  1KQF A;  2PMZ A;  1PYU B;  1CR5 A;  2IV2 X;  3O5A A;  4JP7 A;  1OA7 A;  1Q16 A;  3TIW A;  3X2H A;  3X2P A;  3X2G A;  2PJH B;  3IR7 A;  2ENG A;  1QDN A;  2VPY A;  3HU3 A;  1HD5 A;  1SMY D;  1Y1V A;  5C18 A;  4DMR A;  3X2J A;  1G8K A;  2R93 A;  1BW4 A;  2VPW A;  4GA6 A;  3IR5 A;  4L48 A;  3GTJ A;  1R27 A;  4ENG A;  2O5J D;  3GTK A;  1K83 A;  1ZYR D;  2GAE A;  1PPY A;  3CF2 A;  4RV0 A;  1Y5I A;  3CZB A;  2G5D A;  4KDL A;  2KQA A;  4JP6 A;  1BW3 A;  3CQZ A;  5DYG A;  1ZC1 A;  2VPX A;  3SUK A;  1KQG A;  5GLY A;  1E5V A;  1CZ4 A;  3HKZ A;  3SUL A;  3QQ7 A;  1E60 A;  3OUG A;  3GTQ A;  3H0G A;  2JA5 A;  1UHD A;  2PJJ A;  4JCW A;  3X2I A;  1TWC A;  5GLF A;  1Y1W A;  2YU9 A;  3GTP A;  1S3S A;  5FTJ A;  4CS0 A;  3QWZ A;  5EPP A;  1TMO A;  3IR6 A;  4GA5 A;  1H0H A;  3X2L A;  2NVY A;  3FKI A;  1SFO A;  1PQE A;  2YUJ A;  3ML1 A;  2NVX A;  1EU1 A;  2PIC A;  3D30 A;  3X2N A;  3X2O A;  2JA6 A;  2Y0S A;  5B6C A;  1YNJ D;  1VC3 B;  2BH0 A;  4QIW A;  1E32 A;  1PQF A;  2R92 A;  1WCM A;  3X2K A;  3TM7 B;  2E7Z A;  4JS7 A;  4AZD A;  4ZM7 A;  1YLE A;  1R7R A;  2AE0 X;  4AVR A;  3DMR A;  4AOK B;  4AON B;  1QCS A;  2NYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...