2PI8A

Crystal structure of e. coli mlta with bound chitohexaose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
335
structure length
331
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLIAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 72
structure length 331
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pi8A01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pi8A02
4FG2A 3D30A 4JS7A 3X2LA 1BW4A 3X2KA 2G5DA 2G6GA 1N10A 4JCWA 2PJJA 4JP6A 1OA9A 3SUKA 1WC2A 3X2IA 5GM9A 3X2HA 4ZM7A 1HD5A 3X2NA 4FG4A 3X2PA 2HCZX 2PNWA 3SUMA 3CZBA 4FFTA 4FERA 3X2MA 4L48A 3SUJA 3X2JA 4JJOA 2PICA 5GLYA 1OA7A 5GLXA 1L8FA 3M3GA 2BH0A 4AVRA 3SULA 2AE0X 2ENGA 4JP7A 4ENGA 2GAEA 2KQAA 3X2GA 5H4UA 3X2OA 2PI8A 1BW3A 3ENGA
chains in the Genus database with same CATH superfamily
1KQFA 2V3VA 1ZC1A 4GA5A 1WCMA 4JS7A 5T5ID 4AAYA 1BW4A 5HL7S 2G6GA 3GTQA 2VPWA 2NVXA 1N10A 2JIMA 2Y0SA 2R93A 1EUYA 5JVHS 3CF5S 1OA9A 1FEUA 1WC2A 4IOCS 1E60A 3X2HA 2YU9A 1Z85A 1TWFA 3GTJA 1O0BA 1R27A 2A69D 3HU1A 5B6CA 2HCZX 3SUMA 1VHYA 1FDIA 1NYLA 2EGVA 5IZNA 1PT0A 3GTOA 2A6ED 5DYGA 5FTNA 1R9TA 4WCES 5C1BA 4U67S 1TWCA 5GAGW 1PQFA 5GLYA 1OA7A 3GTGA 3GTKA 1E5VA 3QWZA 3H0GA 4AZDA 1VHKA 3QC8A 2BH0A 3HKZA 4L69A 1DMRA 4JYZA 2AE0X 3AIIA 2EEOB 2NYAA 1B75A 3W2WB 1VC3B 1QRUA 4DMRA 5H4UA 2PI8A 4GA6A 3SUJA 2BE5D 1BW3A 4WF9S 5FTMA 3X2LA 3X2KA 5BNZA 3GTLA 3QQ7A 1V6ZA 4H3SA 1G8JA 1E32A 2C45A 2JIQA 2PJJA 5GLFA 5T5MD 1GTSA 1K83A 1QDNA 3GTMA 1SMYD 3X2PA 2WB1A 2A6HD 4CRZA 2PMZA 3ML1A 4FERA 2CX8A 2Z0YA 1ZYRD 1PYUB 3O5AA 1KQGA 5GAHW 2A68D 3OUGA 4RV0A 2NVYA 3QQ8A 1YLEA 3TM7B 2HZ7A 2V45A 4E8BA 4QIWA 4KDLA 1ZJWA 4IO9S 3DLLS 2ZJRS 3CF2A 2PJHB 3J7ZV 2RE8A 3HU2A 3FKIA 2GAEA 2KQAA 1AA6A 4KLNA 1CZ4A 1UHDA 1Y1VA 5C18A 2ZJQS 1EU1A 3TIWA 4WFNS 1E18A 3W2VB 3GTPA 5FTLA 1EUQA 2JIPA 5EPPA 4P2BA 2R92A 4JP6A 3SUKA 1WLFA 3X2IA 2O5JD 1AW8B 2NWAA 3PLXB 1H5NA 1TMOA 2CW0D 4CS0A 2E7ZA 4FG4A 1UDXA 4D7ZB 2PNWA 4J3CA 3CZBA 3CQZA 2JIRA 1I50A 1O0CA 3IR6A 2KI8A 3IR7A 3X2MA 4V194 1TWAA 1DFUP 1PPYA 1SIWA 2VUMA 2ZJPS 2R7ZA 5GAEW 1Q16A 2JIOA 5GLXA 1CZ5A 1QRSA 5DYIA 1L8FA 1PQEA 1Y4ZA 2VPZA 1EXDA 1GTRA 1UHEA 4KDIA 4AVRA 4KODA 4AOKB 2ENGA 4KO8A 1PYQA 4JP7A 1Y1WA 1OGYA 2JA6A 4WFAS 3PIPS 4JXXA 1QRTA 4CRYG 1QCSA 4FG2A 2JA5A 3D30A 1DMSA 4JXZA 1D6KA 2G5DA 4AYBA 2VPYA 4WFBS 1E61A 4JCWA 5FTJA 4NOHA 1YNND 1PT1A 5FTKA 4UY88 2NAPA 2IV2X 1H0HA 3IR5A 5GM9A 4ZM7A 2E2HA 3KW2A 1HD5A 3PIOS 1PQHA 3X2NA 2WAQA 4H4KA 1R7RA 2B63A 5GADW 5DM7S 4FFTA 1IW7D 1QTQA 1Y5IA 2YUJA 1YNJD 4L48A 1NXZA 5DM6S 3X2JA 4JJOA 4IOAS 2DMRA 2PICA 3X1LB 2JA7A 3HU3A 1G8KA 1TWGA 1SFOA 3M3GA 2VPXA 2E2IA 5JVGS 1TWHA 1FDOA 1S3SA 3SULA 4ENGA 4AONB 1I3QA 4C2MA 2EGWA 2RD2A 3X2GA 1CR5A 3X2OA 3DMRA 3ENGA
chains in the Genus database with same CATH topology
1KQFA 2V3VA 1ZC1A 4GA5A 4JS7A 1BW4A 1WCMA 5T5ID 4AAYA 2G6GA 3GTQA 2VPWA 2NVXA 1N10A 2JIMA 2Y0SA 2R93A 1OA9A 1WC2A 3X2HA 1E60A 2YU9A 1TWFA 3GTJA 1R27A 2A69D 3HU1A 5B6CA 2HCZX 3SUMA 1FDIA 1PT0A 3GTOA 2A6ED 5DYGA 5FTNA 1R9TA 5C1BA 1TWCA 1PQFA 5GLYA 1OA7A 3GTGA 3GTKA 1E5VA 3QWZA 3H0GA 4AZDA 3QC8A 2BH0A 3HKZA 1DMRA 2AE0X 2EEOB 2NYAA 1VC3B 4DMRA 5H4UA 3SUJA 2PI8A 1BW3A 2BE5D 4GA6A 3X2LA 5FTMA 3X2KA 3GTLA 3QQ7A 1E32A 1G8JA 2C45A 2PJJA 2JIQA 5GLFA 5T5MD 1K83A 1QDNA 3GTMA 1SMYD 3X2PA 2WB1A 2A6HD 4CRZA 2PMZA 3ML1A 4FERA 1ZYRD 1PYUB 3O5AA 1KQGA 2A68D 3OUGA 4RV0A 2NVYA 3QQ8A 1YLEA 3TM7B 2V45A 4QIWA 4KDLA 3CF2A 2PJHB 3HU2A 3FKIA 2GAEA 2KQAA 1AA6A 4KLNA 1CZ4A 1UHDA 1Y1VA 5C18A 1EU1A 3TIWA 1E18A 3GTPA 5FTLA 2JIPA 5EPPA 2R92A 4JP6A 3SUKA 1WLFA 3X2IA 2O5JD 1AW8B 3PLXB 1H5NA 1TMOA 2CW0D 4CS0A 2E7ZA 4FG4A 4D7ZB 2PNWA 3CZBA 3CQZA 2JIRA 1I50A 3X2MA 2KI8A 3IR6A 3IR7A 1TWAA 1PPYA 1SIWA 2VUMA 2R7ZA 1Q16A 2JIOA 5GLXA 1CZ5A 5DYIA 1L8FA 1PQEA 1Y4ZA 2VPZA 4AVRA 1UHEA 4KDIA 4KODA 4AOKB 2ENGA 4KO8A 4JP7A 1PYQA 1Y1WA 1OGYA 2JA6A 4CRYG 1QCSA 4FG2A 2JA5A 3D30A 1DMSA 2G5DA 4AYBA 2VPYA 4JCWA 1E61A 5FTJA 4NOHA 1YNND 1PT1A 5FTKA 2NAPA 2IV2X 1H0HA 3IR5A 5GM9A 4ZM7A 2E2HA 1HD5A 3X2NA 1PQHA 2WAQA 1R7RA 2B63A 1IW7D 1Y5IA 2YUJA 1YNJD 4L48A 3X2JA 4JJOA 2DMRA 2PICA 3ENGA 2JA7A 3HU3A 1G8KA 1TWGA 1SFOA 3M3GA 2VPXA 2E2IA 3SULA 1FDOA 1S3SA 1TWHA 4ENGA 4AONB 1I3QA 4C2MA 3X2GA 1CR5A 3X2OA 3DMRA 4FFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FG2 A;  3D30 A;  4JS7 A;  3X2L A;  1BW4 A;  3X2K A;  2G5D A;  2G6G A;  1N10 A;  4JCW A;  2PJJ A;  4JP6 A;  1OA9 A;  3SUK A;  1WC2 A;  3X2I A;  5GM9 A;  3X2H A;  4ZM7 A;  1HD5 A;  3X2N A;  4FG4 A;  3X2P A;  2HCZ X;  2PNW A;  3SUM A;  3CZB A;  4FFT A;  4FER A;  3X2M A;  4L48 A;  3SUJ A;  3X2J A;  4JJO A;  2PIC A;  5GLY A;  1OA7 A;  5GLX A;  1L8F A;  3M3G A;  2BH0 A;  4AVR A;  3SUL A;  2AE0 X;  2ENG A;  4JP7 A;  4ENG A;  2GAE A;  2KQA A;  3X2G A;  5H4U A;  3X2O A;  2PI8 A;  1BW3 A;  3ENG A; 
#chains in the Genus database with same CATH topology
 1KQF A;  2V3V A;  1ZC1 A;  4GA5 A;  1WCM A;  4JS7 A;  5T5I D;  4AAY A;  1BW4 A;  5HL7 S;  2G6G A;  3GTQ A;  2VPW A;  2NVX A;  1N10 A;  2JIM A;  2Y0S A;  2R93 A;  1EUY A;  5JVH S;  3CF5 S;  1OA9 A;  1FEU A;  1WC2 A;  4IOC S;  1E60 A;  3X2H A;  2YU9 A;  1Z85 A;  1TWF A;  3GTJ A;  1O0B A;  1R27 A;  2A69 D;  3HU1 A;  5B6C A;  2HCZ X;  3SUM A;  1VHY A;  1FDI A;  1NYL A;  2EGV A;  5IZN A;  1PT0 A;  3GTO A;  2A6E D;  5DYG A;  5FTN A;  1R9T A;  4WCE S;  5C1B A;  4U67 S;  1TWC A;  5GAG W;  1PQF A;  5GLY A;  1OA7 A;  3GTG A;  3GTK A;  1E5V A;  3QWZ A;  3H0G A;  4AZD A;  1VHK A;  3QC8 A;  2BH0 A;  3HKZ A;  4L69 A;  1DMR A;  4JYZ A;  2AE0 X;  3AII A;  2EEO B;  2NYA A;  1B75 A;  3W2W B;  1VC3 B;  1QRU A;  4DMR A;  5H4U A;  2PI8 A;  4GA6 A;  3SUJ A;  2BE5 D;  1BW3 A;  4WF9 S;  5FTM A;  3X2L A;  3X2K A;  5BNZ A;  3GTL A;  3QQ7 A;  1V6Z A;  4H3S A;  1G8J A;  1E32 A;  2C45 A;  2JIQ A;  2PJJ A;  5GLF A;  5T5M D;  1GTS A;  1K83 A;  1QDN A;  3GTM A;  1SMY D;  3X2P A;  2WB1 A;  2A6H D;  4CRZ A;  2PMZ A;  3ML1 A;  4FER A;  2CX8 A;  2Z0Y A;  1ZYR D;  1PYU B;  3O5A A;  1KQG A;  5GAH W;  2A68 D;  3OUG A;  4RV0 A;  2NVY A;  3QQ8 A;  1YLE A;  3TM7 B;  2HZ7 A;  2V45 A;  4E8B A;  4QIW A;  4KDL A;  1ZJW A;  4IO9 S;  3DLL S;  2ZJR S;  3CF2 A;  2PJH B;  3J7Z V;  2RE8 A;  3HU2 A;  3FKI A;  2GAE A;  2KQA A;  1AA6 A;  4KLN A;  1CZ4 A;  1UHD A;  1Y1V A;  5C18 A;  2ZJQ S;  1EU1 A;  3TIW A;  4WFN S;  1E18 A;  3W2V B;  3GTP A;  5FTL A;  1EUQ A;  2JIP A;  5EPP A;  4P2B A;  2R92 A;  4JP6 A;  3SUK A;  1WLF A;  3X2I A;  2O5J D;  1AW8 B;  2NWA A;  3PLX B;  1H5N A;  1TMO A;  2CW0 D;  4CS0 A;  2E7Z A;  4FG4 A;  1UDX A;  4D7Z B;  2PNW A;  4J3C A;  3CZB A;  3CQZ A;  2JIR A;  1I50 A;  1O0C A;  3IR6 A;  2KI8 A;  3IR7 A;  3X2M A;  4V19 4;  1TWA A;  1DFU P;  1PPY A;  1SIW A;  2VUM A;  2ZJP S;  2R7Z A;  5GAE W;  1Q16 A;  2JIO A;  5GLX A;  1CZ5 A;  1QRS A;  5DYI A;  1L8F A;  1PQE A;  1Y4Z A;  2VPZ A;  1EXD A;  1GTR A;  1UHE A;  4KDI A;  4AVR A;  4KOD A;  4AOK B;  2ENG A;  4KO8 A;  1PYQ A;  4JP7 A;  1Y1W A;  1OGY A;  2JA6 A;  4WFA S;  3PIP S;  4JXX A;  1QRT A;  4CRY G;  1QCS A;  4FG2 A;  2JA5 A;  3D30 A;  1DMS A;  4JXZ A;  1D6K A;  2G5D A;  4AYB A;  2VPY A;  4WFB S;  1E61 A;  4JCW A;  5FTJ A;  4NOH A;  1YNN D;  1PT1 A;  5FTK A;  4UY8 8;  2NAP A;  2IV2 X;  1H0H A;  3IR5 A;  5GM9 A;  4ZM7 A;  2E2H A;  3KW2 A;  1HD5 A;  3PIO S;  1PQH A;  3X2N A;  2WAQ A;  4H4K A;  1R7R A;  2B63 A;  5GAD W;  5DM7 S;  4FFT A;  1IW7 D;  1QTQ A;  1Y5I A;  2YUJ A;  1YNJ D;  4L48 A;  1NXZ A;  5DM6 S;  3X2J A;  4JJO A;  4IOA S;  2DMR A;  2PIC A;  3X1L B;  2JA7 A;  3HU3 A;  1G8K A;  1TWG A;  1SFO A;  3M3G A;  2VPX A;  2E2I A;  5JVG S;  1TWH A;  1FDO A;  1S3S A;  3SUL A;  4ENG A;  4AON B;  1I3Q A;  4C2M A;  2EGW A;  2RD2 A;  3X2G A;  1CR5 A;  3X2O A;  3DMR A;  3ENG A; 
#chains in the Genus database with same CATH homology
 1KQF A;  2V3V A;  1ZC1 A;  4GA5 A;  4JS7 A;  1BW4 A;  1WCM A;  5T5I D;  4AAY A;  2G6G A;  3GTQ A;  2VPW A;  2NVX A;  1N10 A;  2JIM A;  2Y0S A;  2R93 A;  1OA9 A;  1WC2 A;  3X2H A;  1E60 A;  2YU9 A;  1TWF A;  3GTJ A;  1R27 A;  2A69 D;  3HU1 A;  5B6C A;  2HCZ X;  3SUM A;  1FDI A;  1PT0 A;  3GTO A;  2A6E D;  5DYG A;  5FTN A;  1R9T A;  5C1B A;  1TWC A;  1PQF A;  5GLY A;  1OA7 A;  3GTG A;  3GTK A;  1E5V A;  3QWZ A;  3H0G A;  4AZD A;  3QC8 A;  2BH0 A;  3HKZ A;  1DMR A;  2AE0 X;  2EEO B;  2NYA A;  1VC3 B;  4DMR A;  5H4U A;  3SUJ A;  2PI8 A;  1BW3 A;  2BE5 D;  4GA6 A;  3X2L A;  5FTM A;  3X2K A;  3GTL A;  3QQ7 A;  1E32 A;  1G8J A;  2C45 A;  2PJJ A;  2JIQ A;  5GLF A;  5T5M D;  1K83 A;  1QDN A;  3GTM A;  1SMY D;  3X2P A;  2WB1 A;  2A6H D;  4CRZ A;  2PMZ A;  3ML1 A;  4FER A;  1ZYR D;  1PYU B;  3O5A A;  1KQG A;  2A68 D;  3OUG A;  4RV0 A;  2NVY A;  3QQ8 A;  1YLE A;  3TM7 B;  2V45 A;  4QIW A;  4KDL A;  3CF2 A;  2PJH B;  3HU2 A;  3FKI A;  2GAE A;  2KQA A;  1AA6 A;  4KLN A;  1CZ4 A;  1UHD A;  1Y1V A;  5C18 A;  1EU1 A;  3TIW A;  1E18 A;  3GTP A;  5FTL A;  2JIP A;  5EPP A;  2R92 A;  4JP6 A;  3SUK A;  1WLF A;  3X2I A;  2O5J D;  1AW8 B;  3PLX B;  1H5N A;  1TMO A;  2CW0 D;  4CS0 A;  2E7Z A;  4FG4 A;  4D7Z B;  2PNW A;  3CZB A;  3CQZ A;  2JIR A;  1I50 A;  3X2M A;  2KI8 A;  3IR6 A;  3IR7 A;  1TWA A;  1PPY A;  1SIW A;  2VUM A;  2R7Z A;  1Q16 A;  2JIO A;  5GLX A;  1CZ5 A;  5DYI A;  1L8F A;  1PQE A;  1Y4Z A;  2VPZ A;  4AVR A;  1UHE A;  4KDI A;  4KOD A;  4AOK B;  2ENG A;  4KO8 A;  4JP7 A;  1PYQ A;  1Y1W A;  1OGY A;  2JA6 A;  4CRY G;  1QCS A;  4FG2 A;  2JA5 A;  3D30 A;  1DMS A;  2G5D A;  4AYB A;  2VPY A;  4JCW A;  1E61 A;  5FTJ A;  4NOH A;  1YNN D;  1PT1 A;  5FTK A;  2NAP A;  2IV2 X;  1H0H A;  3IR5 A;  5GM9 A;  4ZM7 A;  2E2H A;  1HD5 A;  3X2N A;  1PQH A;  2WAQ A;  1R7R A;  2B63 A;  1IW7 D;  1Y5I A;  2YUJ A;  1YNJ D;  4L48 A;  3X2J A;  4JJO A;  2DMR A;  2PIC A;  3ENG A;  2JA7 A;  3HU3 A;  1G8K A;  1TWG A;  1SFO A;  3M3G A;  2VPX A;  2E2I A;  3SUL A;  1FDO A;  1S3S A;  1TWH A;  4ENG A;  4AON B;  1I3Q A;  4C2M A;  3X2G A;  1CR5 A;  3X2O A;  3DMR A;  4FFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...