2PI8A

Crystal structure of e. coli mlta with bound chitohexaose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
335
structure length
331
Chain Sequence
SKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLIAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 72
structure length 331
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2pi8A01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2pi8A02
3CZBA 3SUMA 3X2OA 3X2IA 2KQAA 3X2MA 4JCWA 4JJOA 2PJJA 3SUJA 4FG4A 3X2GA 3SULA 3M3GA 3X2KA 2PNWA 4JP6A 1OA7A 4FERA 5H4UA 4FFTA 2GAEA 4JP7A 1N10A 1BW3A 2G5DA 2HCZX 2BH0A 2PI8A 4ZM7A 1OA9A 3ENGA 3X2LA 2PICA 1L8FA 3X2PA 4FG2A 5GLYA 4JS7A 3X2NA 2AE0X 3X2HA 1BW4A 1WC2A 1HD5A 5GM9A 3D30A 3X2JA 4ENGA 4L48A 3SUKA 2ENGA 2G6GA 5GLXA 4AVRA
chains in the Genus database with same CATH superfamily
1TWHA 3CZBA 2RE8A 2JA6A 2Y0SA 3GTOA 2KQAA 3X2MA 2A68D 4JCWA 4JJOA 4CRYG 1EXDA 1EUQA 1Y5IA 2NAPA 2V45A 1YNJD 1ZJWA 1IW7D 4JP6A 4JXXA 5EPPA 4FERA 1KQFA 1CZ5A 4FFTA 4WFBS 5GADW 1N10A 2B63A 1VC3B 1FDOA 5FTNA 4WF9S 2E2IA 5JVGS 2BH0A 3HU2A 3PLXB 3IR7A 2VUMA 3QC8A 5JVHS 2PICA 2DMRA 3J7ZV 3QWZA 3GTMA 4FG2A 4AAYA 4JXZA 1AW8B 3QQ8A 3X2HA 1BW4A 3AIIA 3IR6A 2A6ED 5GM9A 4H4KA 5DYIA 1WLFA 2IV2X 1NXZA 4P2BA 2VPYA 4CRZA 2NWAA 1PQEA 2G6GA 5IZNA 4KDIA 1G8KA 1PYQA 2A6HD 4AOKB 4J3CA 2JIRA 3X2IA 4AZDA 2EEOB 2CW0D 1TWAA 5GAEW 5GAHW 1Z85A 4DMRA 5C18A 2PMZA 1V6ZA 1D6KA 3OUGA 2PJJA 1SIWA 4FG4A 3SUJA 3SULA 1UDXA 3PIPS 4JYZA 3M3GA 1GTSA 1O0BA 1FEUA 1R7RA 3DMRA 4GA6A 1OA7A 2E2HA 1YNND 3HU1A 3W2VB 1QRSA 4JP7A 2VPWA 2YU9A 2C45A 1TWCA 1VHKA 1G8JA 2HCZX 3GTKA 3X1LB 3FKIA 3CF5S 4ZM7A 3CQZA 5FTJA 1Y1WA 4E8BA 1L8FA 1ZC1A 3X2PA 1TMOA 4D7ZB 2JIMA 1R27A 2ZJPS 1PQHA 1E61A 1DMRA 1CR5A 4JS7A 3TIWA 1UHEA 5C1BA 2HZ7A 3HKZA 1HD5A 1DFUP 3KW2A 1B75A 2R93A 4UY88 1WCMA 4L69A 3IR5A 3SUKA 3X2NA 3GTGA 2ZJQS 5GLXA 1CZ4A 3X2OA 4GA5A 1EUYA 5B6CA 1GTRA 2ZJRS 1E32A 4RV0A 3TM7B 4IO9S 2PJHB 3X2GA 3ML1A 5T5ID 2YUJA 3X2KA 1QRUA 2PNWA 4KDLA 1I50A 1SFOA 3GTJA 2VPZA 2EGVA 3H0GA 1K83A 1H5NA 4KODA 1TWFA 2NYAA 3QQ7A 2PI8A 4AONB 3GTLA 3ENGA 4KLNA 1VHYA 4IOCS 1QCSA 1OGYA 4NOHA 2VPXA 2Z0YA 4WCES 5GLYA 1O0CA 4WFNS 4C2MA 1PQFA 1SMYD 2AE0X 4WFAS 4QIWA 3D30A 4KO8A 3X2JA 5FTKA 1S3SA 4ENGA 2O5JD 2R7ZA 1FDIA 2NVXA 1I3QA 4V194 1QTQA 1UHDA 2ENGA 1KQGA 1NYLA 5BNZA 3O5AA 3SUMA 1PT0A 1Q16A 2JA5A 2A69D 1E18A 1PPYA 1TWGA 5FTMA 5DYGA 2CX8A 2RD2A 5HL7S 1E60A 2E7ZA 2WB1A 5H4UA 2JA7A 2GAEA 1BW3A 1QRTA 1YLEA 1PT1A 2G5DA 4U67S 2BE5D 1Y4ZA 2EGWA 1QDNA 2V3VA 1PYUB 4IOAS 1OA9A 1ZYRD 3PIOS 3HU3A 3X2LA 5GAGW 4H3SA 3GTQA 2KI8A 1E5VA 1H0HA 2R92A 5DM6S 2NVYA 2JIOA 4AYBA 5FTLA 3GTPA 1Y1VA 1AA6A 3DLLS 1R9TA 5DM7S 5T5MD 1DMSA 1WC2A 2JIPA 4L48A 4CS0A 3W2WB 2JIQA 3CF2A 5GLFA 1EU1A 2WAQA 4AVRA
chains in the Genus database with same CATH topology
1TWHA 3CZBA 2JA6A 2Y0SA 3GTOA 2KQAA 3X2MA 2A68D 4JCWA 4JJOA 4CRYG 1Y5IA 2NAPA 2V45A 1YNJD 1IW7D 4JP6A 5EPPA 4FERA 1KQFA 1CZ5A 4FFTA 1N10A 2B63A 1VC3B 1FDOA 5FTNA 2E2IA 2BH0A 3HU2A 3PLXB 3IR7A 2VUMA 3QC8A 2PICA 2DMRA 3QWZA 3GTMA 4FG2A 4AAYA 1AW8B 3QQ8A 3X2HA 1BW4A 5GM9A 2A6ED 3IR6A 5DYIA 1WLFA 2IV2X 2VPYA 4CRZA 1PQEA 2G6GA 4KDIA 1G8KA 1PYQA 2A6HD 4AOKB 2JIRA 3X2IA 4AZDA 2EEOB 2CW0D 1TWAA 4DMRA 5C18A 2PMZA 3OUGA 2PJJA 3SUJA 4FG4A 1SIWA 3SULA 3M3GA 1R7RA 3DMRA 4GA6A 1OA7A 2E2HA 1YNND 3HU1A 4JP7A 2VPWA 2YU9A 2C45A 1TWCA 1G8JA 2HCZX 3GTKA 3FKIA 4ZM7A 3CQZA 5FTJA 1Y1WA 1L8FA 3X2PA 1ZC1A 1TMOA 4D7ZB 2JIMA 1R27A 1PQHA 1DMRA 1E61A 4JS7A 1CR5A 3TIWA 1UHEA 5C1BA 3HKZA 1HD5A 2R93A 1WCMA 3IR5A 3SUKA 3X2NA 3GTGA 5GLXA 1CZ4A 3X2OA 4GA5A 5B6CA 1E32A 4RV0A 3TM7B 2PJHB 3X2GA 3ML1A 5T5ID 3X2KA 2YUJA 2PNWA 4KDLA 1I50A 1SFOA 3GTJA 2VPZA 3H0GA 1K83A 1H5NA 4KODA 1TWFA 2NYAA 3QQ7A 2PI8A 4AONB 3GTLA 3ENGA 4KLNA 1QCSA 1OGYA 4NOHA 2VPXA 5GLYA 4C2MA 1PQFA 1SMYD 2AE0X 4QIWA 3D30A 3X2JA 4ENGA 4KO8A 1S3SA 5FTKA 2O5JD 2R7ZA 1FDIA 2NVXA 1I3QA 1UHDA 2ENGA 1KQGA 3SUMA 3O5AA 1PT0A 1Q16A 2JA5A 2A69D 1E18A 1PPYA 1TWGA 5FTMA 5DYGA 5H4UA 1E60A 2E7ZA 2WB1A 2JA7A 2GAEA 1BW3A 1YLEA 1PT1A 2G5DA 2BE5D 1Y4ZA 1QDNA 2V3VA 1PYUB 1OA9A 1ZYRD 3X2LA 3HU3A 3GTQA 2KI8A 1E5VA 1H0HA 2R92A 2NVYA 2JIOA 4AYBA 5FTLA 3GTPA 1Y1VA 1AA6A 1R9TA 5T5MD 1WC2A 1DMSA 2JIPA 4L48A 4CS0A 2JIQA 3CF2A 5GLFA 1EU1A 2WAQA 4AVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZB A;  3SUM A;  3X2O A;  3X2I A;  2KQA A;  3X2M A;  4JCW A;  4JJO A;  2PJJ A;  3SUJ A;  4FG4 A;  3X2G A;  3SUL A;  3M3G A;  3X2K A;  2PNW A;  4JP6 A;  1OA7 A;  4FER A;  5H4U A;  4FFT A;  2GAE A;  4JP7 A;  1N10 A;  1BW3 A;  2G5D A;  2HCZ X;  2BH0 A;  2PI8 A;  4ZM7 A;  1OA9 A;  3ENG A;  3X2L A;  2PIC A;  1L8F A;  3X2P A;  4FG2 A;  5GLY A;  4JS7 A;  3X2N A;  2AE0 X;  3X2H A;  1BW4 A;  1WC2 A;  1HD5 A;  5GM9 A;  3D30 A;  3X2J A;  4ENG A;  4L48 A;  3SUK A;  2ENG A;  2G6G A;  5GLX A;  4AVR A; 
#chains in the Genus database with same CATH topology
 1TWH A;  3CZB A;  2RE8 A;  2JA6 A;  2Y0S A;  3GTO A;  2KQA A;  3X2M A;  2A68 D;  4JCW A;  4JJO A;  4CRY G;  1EXD A;  1EUQ A;  1Y5I A;  2NAP A;  2V45 A;  1YNJ D;  1ZJW A;  1IW7 D;  4JP6 A;  4JXX A;  5EPP A;  4FER A;  1KQF A;  1CZ5 A;  4FFT A;  4WFB S;  5GAD W;  1N10 A;  2B63 A;  1VC3 B;  1FDO A;  5FTN A;  4WF9 S;  2E2I A;  5JVG S;  2BH0 A;  3HU2 A;  3PLX B;  3IR7 A;  2VUM A;  3QC8 A;  5JVH S;  2PIC A;  2DMR A;  3J7Z V;  3QWZ A;  3GTM A;  4FG2 A;  4AAY A;  4JXZ A;  1AW8 B;  3QQ8 A;  3X2H A;  1BW4 A;  3AII A;  3IR6 A;  2A6E D;  5GM9 A;  4H4K A;  5DYI A;  1WLF A;  2IV2 X;  1NXZ A;  4P2B A;  2VPY A;  4CRZ A;  2NWA A;  1PQE A;  2G6G A;  5IZN A;  4KDI A;  1G8K A;  1PYQ A;  2A6H D;  4AOK B;  4J3C A;  2JIR A;  3X2I A;  4AZD A;  2EEO B;  2CW0 D;  1TWA A;  5GAE W;  5GAH W;  1Z85 A;  4DMR A;  5C18 A;  2PMZ A;  1V6Z A;  1D6K A;  3OUG A;  2PJJ A;  1SIW A;  4FG4 A;  3SUJ A;  3SUL A;  1UDX A;  3PIP S;  4JYZ A;  3M3G A;  1GTS A;  1O0B A;  1FEU A;  1R7R A;  3DMR A;  4GA6 A;  1OA7 A;  2E2H A;  1YNN D;  3HU1 A;  3W2V B;  1QRS A;  4JP7 A;  2VPW A;  2YU9 A;  2C45 A;  1TWC A;  1VHK A;  1G8J A;  2HCZ X;  3GTK A;  3X1L B;  3FKI A;  3CF5 S;  4ZM7 A;  3CQZ A;  5FTJ A;  1Y1W A;  4E8B A;  1L8F A;  1ZC1 A;  3X2P A;  1TMO A;  4D7Z B;  2JIM A;  1R27 A;  2ZJP S;  1PQH A;  1E61 A;  1DMR A;  1CR5 A;  4JS7 A;  3TIW A;  1UHE A;  5C1B A;  2HZ7 A;  3HKZ A;  1HD5 A;  1DFU P;  3KW2 A;  1B75 A;  2R93 A;  4UY8 8;  1WCM A;  4L69 A;  3IR5 A;  3SUK A;  3X2N A;  3GTG A;  2ZJQ S;  5GLX A;  1CZ4 A;  3X2O A;  4GA5 A;  1EUY A;  5B6C A;  1GTR A;  2ZJR S;  1E32 A;  4RV0 A;  3TM7 B;  4IO9 S;  2PJH B;  3X2G A;  3ML1 A;  5T5I D;  2YUJ A;  3X2K A;  1QRU A;  2PNW A;  4KDL A;  1I50 A;  1SFO A;  3GTJ A;  2VPZ A;  2EGV A;  3H0G A;  1K83 A;  1H5N A;  4KOD A;  1TWF A;  2NYA A;  3QQ7 A;  2PI8 A;  4AON B;  3GTL A;  3ENG A;  4KLN A;  1VHY A;  4IOC S;  1QCS A;  1OGY A;  4NOH A;  2VPX A;  2Z0Y A;  4WCE S;  5GLY A;  1O0C A;  4WFN S;  4C2M A;  1PQF A;  1SMY D;  2AE0 X;  4WFA S;  4QIW A;  3D30 A;  4KO8 A;  3X2J A;  5FTK A;  1S3S A;  4ENG A;  2O5J D;  2R7Z A;  1FDI A;  2NVX A;  1I3Q A;  4V19 4;  1QTQ A;  1UHD A;  2ENG A;  1KQG A;  1NYL A;  5BNZ A;  3O5A A;  3SUM A;  1PT0 A;  1Q16 A;  2JA5 A;  2A69 D;  1E18 A;  1PPY A;  1TWG A;  5FTM A;  5DYG A;  2CX8 A;  2RD2 A;  5HL7 S;  1E60 A;  2E7Z A;  2WB1 A;  5H4U A;  2JA7 A;  2GAE A;  1BW3 A;  1QRT A;  1YLE A;  1PT1 A;  2G5D A;  4U67 S;  2BE5 D;  1Y4Z A;  2EGW A;  1QDN A;  2V3V A;  1PYU B;  4IOA S;  1OA9 A;  1ZYR D;  3PIO S;  3HU3 A;  3X2L A;  5GAG W;  4H3S A;  3GTQ A;  2KI8 A;  1E5V A;  1H0H A;  2R92 A;  5DM6 S;  2NVY A;  2JIO A;  4AYB A;  5FTL A;  3GTP A;  1Y1V A;  1AA6 A;  3DLL S;  1R9T A;  5DM7 S;  5T5M D;  1DMS A;  1WC2 A;  2JIP A;  4L48 A;  4CS0 A;  3W2W B;  2JIQ A;  3CF2 A;  5GLF A;  1EU1 A;  2WAQ A;  4AVR A; 
#chains in the Genus database with same CATH homology
 1TWH A;  3CZB A;  2JA6 A;  2Y0S A;  3GTO A;  2KQA A;  3X2M A;  2A68 D;  4JCW A;  4JJO A;  4CRY G;  1Y5I A;  2NAP A;  2V45 A;  1YNJ D;  1IW7 D;  4JP6 A;  5EPP A;  4FER A;  1KQF A;  1CZ5 A;  4FFT A;  1N10 A;  2B63 A;  1VC3 B;  1FDO A;  5FTN A;  2E2I A;  2BH0 A;  3HU2 A;  3PLX B;  3IR7 A;  2VUM A;  3QC8 A;  2PIC A;  2DMR A;  3QWZ A;  3GTM A;  4FG2 A;  4AAY A;  1AW8 B;  3QQ8 A;  3X2H A;  1BW4 A;  5GM9 A;  2A6E D;  3IR6 A;  5DYI A;  1WLF A;  2IV2 X;  2VPY A;  4CRZ A;  1PQE A;  2G6G A;  4KDI A;  1G8K A;  1PYQ A;  2A6H D;  4AOK B;  2JIR A;  3X2I A;  4AZD A;  2EEO B;  2CW0 D;  1TWA A;  4DMR A;  5C18 A;  2PMZ A;  3OUG A;  2PJJ A;  3SUJ A;  4FG4 A;  1SIW A;  3SUL A;  3M3G A;  1R7R A;  3DMR A;  4GA6 A;  1OA7 A;  2E2H A;  1YNN D;  3HU1 A;  4JP7 A;  2VPW A;  2YU9 A;  2C45 A;  1TWC A;  1G8J A;  2HCZ X;  3GTK A;  3FKI A;  4ZM7 A;  3CQZ A;  5FTJ A;  1Y1W A;  1L8F A;  3X2P A;  1ZC1 A;  1TMO A;  4D7Z B;  2JIM A;  1R27 A;  1PQH A;  1DMR A;  1E61 A;  4JS7 A;  1CR5 A;  3TIW A;  1UHE A;  5C1B A;  3HKZ A;  1HD5 A;  2R93 A;  1WCM A;  3IR5 A;  3SUK A;  3X2N A;  3GTG A;  5GLX A;  1CZ4 A;  3X2O A;  4GA5 A;  5B6C A;  1E32 A;  4RV0 A;  3TM7 B;  2PJH B;  3X2G A;  3ML1 A;  5T5I D;  3X2K A;  2YUJ A;  2PNW A;  4KDL A;  1I50 A;  1SFO A;  3GTJ A;  2VPZ A;  3H0G A;  1K83 A;  1H5N A;  4KOD A;  1TWF A;  2NYA A;  3QQ7 A;  2PI8 A;  4AON B;  3GTL A;  3ENG A;  4KLN A;  1QCS A;  1OGY A;  4NOH A;  2VPX A;  5GLY A;  4C2M A;  1PQF A;  1SMY D;  2AE0 X;  4QIW A;  3D30 A;  3X2J A;  4ENG A;  4KO8 A;  1S3S A;  5FTK A;  2O5J D;  2R7Z A;  1FDI A;  2NVX A;  1I3Q A;  1UHD A;  2ENG A;  1KQG A;  3SUM A;  3O5A A;  1PT0 A;  1Q16 A;  2JA5 A;  2A69 D;  1E18 A;  1PPY A;  1TWG A;  5FTM A;  5DYG A;  5H4U A;  1E60 A;  2E7Z A;  2WB1 A;  2JA7 A;  2GAE A;  1BW3 A;  1YLE A;  1PT1 A;  2G5D A;  2BE5 D;  1Y4Z A;  1QDN A;  2V3V A;  1PYU B;  1OA9 A;  1ZYR D;  3X2L A;  3HU3 A;  3GTQ A;  2KI8 A;  1E5V A;  1H0H A;  2R92 A;  2NVY A;  2JIO A;  4AYB A;  5FTL A;  3GTP A;  1Y1V A;  1AA6 A;  1R9T A;  5T5M D;  1WC2 A;  1DMS A;  2JIP A;  4L48 A;  4CS0 A;  2JIQ A;  3CF2 A;  5GLF A;  1EU1 A;  2WAQ A;  4AVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...