2PICA

E. coli lytic transglycosylase mlta-d308a in apo-2 form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
SSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVIIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2picA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2picA02
3X2IA 4FFTA 3SULA 2AE0X 5GLXA 1BW3A 2HCZX 1OA7A 4FERA 4AVRA 2PICA 3X2OA 3CZBA 4FG2A 3X2JA 2PNWA 4ENGA 3X2PA 3M3GA 1L8FA 2KQAA 1HD5A 4ZM7A 3X2MA 1OA9A 4FG4A 3SUJA 3SUKA 1WC2A 5H4UA 4JS7A 2ENGA 5GLYA 2G6GA 4JP6A 3ENGA 4L48A 3X2NA 3X2KA 2PI8A 4JJOA 3X2LA 3X2HA 2PJJA 2G5DA 4JCWA 3SUMA 1N10A 3X2GA 2GAEA 2BH0A 1BW4A 4JP7A 5GM9A 3D30A
chains in the Genus database with same CATH superfamily
3X1LB 1SMYD 1Q16A 4L69A 5GLXA 1VHKA 1TWCA 2KI8A 5GAHW 4DMRA 2PICA 3CZBA 3H0GA 2JA6A 4WF9S 1AA6A 2JIOA 2PNWA 1DMSA 2JIQA 4ENGA 5IZNA 1R7RA 3IR5A 5C1BA 3GTQA 2JA5A 1Y1VA 3GTJA 1E32A 1V6ZA 2IV2X 3X2MA 4V194 3SUJA 1UHDA 3W2WB 3IR6A 4JS7A 2NAPA 2JA7A 5GAGW 3CF5S 4P2BA 5JVHS 1FDIA 4IOCS 2VPZA 3TIWA 2C45A 4D7ZB 1EUYA 2PI8A 4GA5A 1ZC1A 5DYGA 4IO9S 1B75A 5FTJA 2E7ZA 5DYIA 4NOHA 1E61A 2NVYA 2Y0SA 3SUMA 3X2GA 1NXZA 5GADW 2BE5D 4WFAS 1YNND 1BW4A 1VHYA 3QWZA 3PIOS 5GM9A 4CRZA 1D6KA 5B6CA 4H4KA 1IW7D 3HU1A 2AE0X 1UHEA 5FTMA 2O5JD 4U67S 1ZJWA 2NWAA 1GTRA 1DFUP 3GTMA 5T5MD 1PT0A 4FERA 4AVRA 1KQFA 3CF2A 5BNZA 4JYZA 2B63A 3GTGA 3HU2A 3M3GA 4KLNA 1QCSA 1KQGA 2ZJRS 1R9TA 3FKIA 1SFOA 2ENGA 1PYUB 4AZDA 2HZ7A 4JP6A 1FEUA 3PIPS 4L48A 1S3SA 4AONB 4C2MA 2R7ZA 2WB1A 2NYAA 1DMRA 3HU3A 1H0HA 2VPXA 2G5DA 1QRTA 3DLLS 3QC8A 4AAYA 4WCES 2EGWA 1AW8B 1N10A 3W2VB 3CQZA 1YNJD 5FTKA 2JIPA 1Y1WA 2BH0A 1PQFA 4JP7A 4JXXA 1E5VA 3D30A 2VPYA 1QRSA 4UY88 3X2IA 1QDNA 2ZJQS 2PMZA 1G8JA 3HKZA 1I3QA 1O0CA 1PYQA 3X2OA 4IOAS 3KW2A 4WFBS 3X2JA 1EXDA 1TWHA 1VC3B 3GTLA 2VUMA 3GTPA 1UDXA 4E8BA 5DM7S 1EU1A 4CRYG 4ZM7A 3GTOA 2E2IA 3O5AA 4FG4A 3SUKA 4AYBA 2R93A 1Z85A 4KO8A 5GLYA 4GA6A 1NYLA 3ENGA 2YUJA 2CX8A 1PQEA 3X2KA 2JIMA 1PQHA 4JJOA 1PT1A 4QIWA 4WFNS 3PLXB 3X2HA 2PJJA 2YU9A 5HL7S 5GLFA 1CZ5A 2NVXA 2RD2A 5T5ID 1CZ4A 1OGYA 1TWGA 2GAEA 2WAQA 2E2HA 5GAEW 5EPPA 4H3SA 3GTKA 1WCMA 2Z0YA 4FFTA 2ZJPS 1YLEA 4KDLA 3SULA 3OUGA 2DMRA 5FTLA 1BW3A 3ML1A 2HCZX 1OA7A 1ZYRD 2JIRA 1H5NA 3TM7B 3QQ7A 2A69D 1FDOA 3IR7A 1K83A 2CW0D 4FG2A 1EUQA 1QTQA 1Y4ZA 1O0BA 2A68D 2PJHB 3X2PA 1E60A 1L8FA 1CR5A 1QRUA 2KQAA 2EEOB 5FTNA 1HD5A 3QQ8A 1G8KA 1TMOA 2V45A 1OA9A 4KDIA 5JVGS 1GTSA 1SIWA 1Y5IA 1WC2A 5H4UA 2A6HD 4JXZA 1TWAA 2G6GA 4AOKB 2EGVA 1PPYA 1WLFA 3X2NA 3X2LA 5DM6S 3J7ZV 1R27A 1TWFA 3AIIA 2VPWA 4KODA 5C18A 4CS0A 2A6ED 4JCWA 3DMRA 1I50A 1E18A 2V3VA 4RV0A 2RE8A 2R92A 4J3CA
chains in the Genus database with same CATH topology
1SMYD 1Q16A 5GLXA 1TWCA 2KI8A 4DMRA 2PICA 3CZBA 3H0GA 2JA6A 1AA6A 2JIOA 2PNWA 4ENGA 1DMSA 2JIQA 1R7RA 3IR5A 5C1BA 3GTQA 2JA5A 1Y1VA 3GTJA 1E32A 2IV2X 3X2MA 3SUJA 1UHDA 4JS7A 3IR6A 2NAPA 2JA7A 1FDIA 2VPZA 3TIWA 2C45A 4D7ZB 2PI8A 4GA5A 1ZC1A 5DYGA 5FTJA 2E7ZA 5DYIA 4NOHA 1E61A 3SUMA 2NVYA 2Y0SA 3X2GA 2BE5D 1YNND 1BW4A 3QWZA 5GM9A 4CRZA 5B6CA 1IW7D 3HU1A 2AE0X 1UHEA 5FTMA 2O5JD 3GTMA 5T5MD 4FERA 4AVRA 1PT0A 1KQFA 3CF2A 2B63A 3GTGA 3HU2A 3M3GA 4KLNA 1QCSA 1KQGA 1R9TA 3FKIA 1SFOA 2ENGA 1PYUB 4AZDA 4JP6A 4L48A 1S3SA 4AONB 4C2MA 2R7ZA 2WB1A 2NYAA 1DMRA 3HU3A 1H0HA 2VPXA 2G5DA 3QC8A 4AAYA 1AW8B 1N10A 3CQZA 1YNJD 5FTKA 2JIPA 1Y1WA 2BH0A 1PQFA 4JP7A 1E5VA 3D30A 2VPYA 3X2IA 1QDNA 2PMZA 1G8JA 3HKZA 1I3QA 3X2OA 1PYQA 3X2JA 1TWHA 1VC3B 3GTLA 2VUMA 3GTPA 1EU1A 4ZM7A 4CRYG 3GTOA 2E2IA 3O5AA 4FG4A 3SUKA 4AYBA 2R93A 4KO8A 5GLYA 4GA6A 3ENGA 2YUJA 3X2KA 1PQEA 4JJOA 1PQHA 2JIMA 1PT1A 4QIWA 3X2HA 3PLXB 2PJJA 2YU9A 5GLFA 1CZ5A 2NVXA 5T5ID 1CZ4A 1OGYA 2GAEA 1TWGA 2WAQA 2E2HA 5EPPA 3GTKA 1WCMA 4FFTA 1YLEA 3SULA 4KDLA 3OUGA 1BW3A 2DMRA 5FTLA 3ML1A 2HCZX 1OA7A 1ZYRD 2JIRA 1H5NA 3TM7B 3QQ7A 2A69D 1FDOA 3IR7A 1K83A 2CW0D 4FG2A 1Y4ZA 3X2PA 2A68D 2PJHB 1L8FA 1E60A 1CR5A 2KQAA 2EEOB 5FTNA 1HD5A 3QQ8A 1G8KA 1TMOA 2V45A 1OA9A 4KDIA 1SIWA 1Y5IA 1WC2A 5H4UA 2A6HD 1TWAA 2G6GA 4AOKB 1PPYA 1WLFA 3X2NA 3X2LA 1R27A 1TWFA 2VPWA 4KODA 5C18A 4CS0A 2A6ED 4JCWA 3DMRA 1I50A 1E18A 2V3VA 4RV0A 2R92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2I A;  4FFT A;  3SUL A;  2AE0 X;  5GLX A;  1BW3 A;  2HCZ X;  1OA7 A;  4FER A;  4AVR A;  2PIC A;  3X2O A;  3CZB A;  4FG2 A;  3X2J A;  2PNW A;  4ENG A;  3X2P A;  3M3G A;  1L8F A;  2KQA A;  1HD5 A;  4ZM7 A;  3X2M A;  1OA9 A;  4FG4 A;  3SUJ A;  3SUK A;  1WC2 A;  5H4U A;  4JS7 A;  2ENG A;  5GLY A;  2G6G A;  4JP6 A;  3ENG A;  4L48 A;  3X2N A;  3X2K A;  2PI8 A;  4JJO A;  3X2L A;  3X2H A;  2PJJ A;  2G5D A;  4JCW A;  3SUM A;  1N10 A;  3X2G A;  2GAE A;  2BH0 A;  1BW4 A;  4JP7 A;  5GM9 A;  3D30 A; 
#chains in the Genus database with same CATH topology
 3X1L B;  1SMY D;  1Q16 A;  4L69 A;  5GLX A;  1VHK A;  1TWC A;  2KI8 A;  5GAH W;  4DMR A;  2PIC A;  3CZB A;  3H0G A;  2JA6 A;  4WF9 S;  1AA6 A;  2JIO A;  2PNW A;  1DMS A;  2JIQ A;  4ENG A;  5IZN A;  1R7R A;  3IR5 A;  5C1B A;  3GTQ A;  2JA5 A;  1Y1V A;  3GTJ A;  1E32 A;  1V6Z A;  2IV2 X;  3X2M A;  4V19 4;  3SUJ A;  1UHD A;  3W2W B;  3IR6 A;  4JS7 A;  2NAP A;  2JA7 A;  5GAG W;  3CF5 S;  4P2B A;  5JVH S;  1FDI A;  4IOC S;  2VPZ A;  3TIW A;  2C45 A;  4D7Z B;  1EUY A;  2PI8 A;  4GA5 A;  1ZC1 A;  5DYG A;  4IO9 S;  1B75 A;  5FTJ A;  2E7Z A;  5DYI A;  4NOH A;  1E61 A;  2NVY A;  2Y0S A;  3SUM A;  3X2G A;  1NXZ A;  5GAD W;  2BE5 D;  4WFA S;  1YNN D;  1BW4 A;  1VHY A;  3QWZ A;  3PIO S;  5GM9 A;  4CRZ A;  1D6K A;  5B6C A;  4H4K A;  1IW7 D;  3HU1 A;  2AE0 X;  1UHE A;  5FTM A;  2O5J D;  4U67 S;  1ZJW A;  2NWA A;  1GTR A;  1DFU P;  3GTM A;  5T5M D;  1PT0 A;  4FER A;  4AVR A;  1KQF A;  3CF2 A;  5BNZ A;  4JYZ A;  2B63 A;  3GTG A;  3HU2 A;  3M3G A;  4KLN A;  1QCS A;  1KQG A;  2ZJR S;  1R9T A;  3FKI A;  1SFO A;  2ENG A;  1PYU B;  4AZD A;  2HZ7 A;  4JP6 A;  1FEU A;  3PIP S;  4L48 A;  1S3S A;  4AON B;  4C2M A;  2R7Z A;  2WB1 A;  2NYA A;  1DMR A;  3HU3 A;  1H0H A;  2VPX A;  2G5D A;  1QRT A;  3DLL S;  3QC8 A;  4AAY A;  4WCE S;  2EGW A;  1AW8 B;  1N10 A;  3W2V B;  3CQZ A;  1YNJ D;  5FTK A;  2JIP A;  1Y1W A;  2BH0 A;  1PQF A;  4JP7 A;  4JXX A;  1E5V A;  3D30 A;  2VPY A;  1QRS A;  4UY8 8;  3X2I A;  1QDN A;  2ZJQ S;  2PMZ A;  1G8J A;  3HKZ A;  1I3Q A;  1O0C A;  1PYQ A;  3X2O A;  4IOA S;  3KW2 A;  4WFB S;  3X2J A;  1EXD A;  1TWH A;  1VC3 B;  3GTL A;  2VUM A;  3GTP A;  1UDX A;  4E8B A;  5DM7 S;  1EU1 A;  4CRY G;  4ZM7 A;  3GTO A;  2E2I A;  3O5A A;  4FG4 A;  3SUK A;  4AYB A;  2R93 A;  1Z85 A;  4KO8 A;  5GLY A;  4GA6 A;  1NYL A;  3ENG A;  2YUJ A;  2CX8 A;  1PQE A;  3X2K A;  2JIM A;  1PQH A;  4JJO A;  1PT1 A;  4QIW A;  4WFN S;  3PLX B;  3X2H A;  2PJJ A;  2YU9 A;  5HL7 S;  5GLF A;  1CZ5 A;  2NVX A;  2RD2 A;  5T5I D;  1CZ4 A;  1OGY A;  1TWG A;  2GAE A;  2WAQ A;  2E2H A;  5GAE W;  5EPP A;  4H3S A;  3GTK A;  1WCM A;  2Z0Y A;  4FFT A;  2ZJP S;  1YLE A;  4KDL A;  3SUL A;  3OUG A;  2DMR A;  5FTL A;  1BW3 A;  3ML1 A;  2HCZ X;  1OA7 A;  1ZYR D;  2JIR A;  1H5N A;  3TM7 B;  3QQ7 A;  2A69 D;  1FDO A;  3IR7 A;  1K83 A;  2CW0 D;  4FG2 A;  1EUQ A;  1QTQ A;  1Y4Z A;  1O0B A;  2A68 D;  2PJH B;  3X2P A;  1E60 A;  1L8F A;  1CR5 A;  1QRU A;  2KQA A;  2EEO B;  5FTN A;  1HD5 A;  3QQ8 A;  1G8K A;  1TMO A;  2V45 A;  1OA9 A;  4KDI A;  5JVG S;  1GTS A;  1SIW A;  1Y5I A;  1WC2 A;  5H4U A;  2A6H D;  4JXZ A;  1TWA A;  2G6G A;  4AOK B;  2EGV A;  1PPY A;  1WLF A;  3X2N A;  3X2L A;  5DM6 S;  3J7Z V;  1R27 A;  1TWF A;  3AII A;  2VPW A;  4KOD A;  5C18 A;  4CS0 A;  2A6E D;  4JCW A;  3DMR A;  1I50 A;  1E18 A;  2V3V A;  4RV0 A;  2RE8 A;  2R92 A;  4J3C A; 
#chains in the Genus database with same CATH homology
 1SMY D;  1Q16 A;  5GLX A;  1TWC A;  2KI8 A;  4DMR A;  2PIC A;  3CZB A;  3H0G A;  2JA6 A;  1AA6 A;  2JIO A;  2PNW A;  4ENG A;  1DMS A;  2JIQ A;  1R7R A;  3IR5 A;  5C1B A;  3GTQ A;  2JA5 A;  1Y1V A;  3GTJ A;  1E32 A;  2IV2 X;  3X2M A;  3SUJ A;  1UHD A;  4JS7 A;  3IR6 A;  2NAP A;  2JA7 A;  1FDI A;  2VPZ A;  3TIW A;  2C45 A;  4D7Z B;  2PI8 A;  4GA5 A;  1ZC1 A;  5DYG A;  5FTJ A;  2E7Z A;  5DYI A;  4NOH A;  1E61 A;  3SUM A;  2NVY A;  2Y0S A;  3X2G A;  2BE5 D;  1YNN D;  1BW4 A;  3QWZ A;  5GM9 A;  4CRZ A;  5B6C A;  1IW7 D;  3HU1 A;  2AE0 X;  1UHE A;  5FTM A;  2O5J D;  3GTM A;  5T5M D;  4FER A;  4AVR A;  1PT0 A;  1KQF A;  3CF2 A;  2B63 A;  3GTG A;  3HU2 A;  3M3G A;  4KLN A;  1QCS A;  1KQG A;  1R9T A;  3FKI A;  1SFO A;  2ENG A;  1PYU B;  4AZD A;  4JP6 A;  4L48 A;  1S3S A;  4AON B;  4C2M A;  2R7Z A;  2WB1 A;  2NYA A;  1DMR A;  3HU3 A;  1H0H A;  2VPX A;  2G5D A;  3QC8 A;  4AAY A;  1AW8 B;  1N10 A;  3CQZ A;  1YNJ D;  5FTK A;  2JIP A;  1Y1W A;  2BH0 A;  1PQF A;  4JP7 A;  1E5V A;  3D30 A;  2VPY A;  3X2I A;  1QDN A;  2PMZ A;  1G8J A;  3HKZ A;  1I3Q A;  3X2O A;  1PYQ A;  3X2J A;  1TWH A;  1VC3 B;  3GTL A;  2VUM A;  3GTP A;  1EU1 A;  4ZM7 A;  4CRY G;  3GTO A;  2E2I A;  3O5A A;  4FG4 A;  3SUK A;  4AYB A;  2R93 A;  4KO8 A;  5GLY A;  4GA6 A;  3ENG A;  2YUJ A;  3X2K A;  1PQE A;  4JJO A;  1PQH A;  2JIM A;  1PT1 A;  4QIW A;  3X2H A;  3PLX B;  2PJJ A;  2YU9 A;  5GLF A;  1CZ5 A;  2NVX A;  5T5I D;  1CZ4 A;  1OGY A;  2GAE A;  1TWG A;  2WAQ A;  2E2H A;  5EPP A;  3GTK A;  1WCM A;  4FFT A;  1YLE A;  3SUL A;  4KDL A;  3OUG A;  1BW3 A;  2DMR A;  5FTL A;  3ML1 A;  2HCZ X;  1OA7 A;  1ZYR D;  2JIR A;  1H5N A;  3TM7 B;  3QQ7 A;  2A69 D;  1FDO A;  3IR7 A;  1K83 A;  2CW0 D;  4FG2 A;  1Y4Z A;  3X2P A;  2A68 D;  2PJH B;  1L8F A;  1E60 A;  1CR5 A;  2KQA A;  2EEO B;  5FTN A;  1HD5 A;  3QQ8 A;  1G8K A;  1TMO A;  2V45 A;  1OA9 A;  4KDI A;  1SIW A;  1Y5I A;  1WC2 A;  5H4U A;  2A6H D;  1TWA A;  2G6G A;  4AOK B;  1PPY A;  1WLF A;  3X2N A;  3X2L A;  1R27 A;  1TWF A;  2VPW A;  4KOD A;  5C18 A;  4CS0 A;  2A6E D;  4JCW A;  3DMR A;  1I50 A;  1E18 A;  2V3V A;  4RV0 A;  2R92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...