2PICA

E. coli lytic transglycosylase mlta-d308a in apo-2 form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
SSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVIIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2picA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2picA02
4ENGA 2G6GA 1HD5A 4JJOA 3X2IA 3X2OA 5GM9A 1BW4A 1WC2A 5GLXA 3ENGA 2PJJA 1OA9A 4FG4A 4FERA 3X2LA 2ENGA 2PI8A 1OA7A 4FG2A 1N10A 4AVRA 3M3GA 5GLYA 2GAEA 3SUMA 3X2KA 4JP6A 1L8FA 5H4UA 4L48A 3CZBA 3D30A 4JP7A 3SUKA 4ZM7A 3X2JA 1BW3A 4JS7A 2PICA 2KQAA 4FFTA 3SUJA 2AE0X 3X2PA 2HCZX 4JCWA 3X2NA 2PNWA 3X2MA 2G5DA 2BH0A 3X2HA 3X2GA 3SULA
chains in the Genus database with same CATH superfamily
1V6ZA 5DYIA 4KDLA 2JIPA 1O0CA 1ZYRD 3IR7A 3J7ZV 1DMSA 2WB1A 1GTSA 4GA6A 5GM9A 1WC2A 5GLXA 1QRTA 3X2LA 2PJJA 1IW7D 1AW8B 2JIOA 1AA6A 2CX8A 5FTNA 1R7RA 1OA7A 4AONB 1VHYA 1Z85A 1N10A 1SFOA 3H0GA 1UHDA 1CZ4A 4C2MA 1PT1A 2IV2X 1E61A 1L8FA 2RD2A 2WAQA 4L48A 2NAPA 4JP7A 5B6CA 4ZM7A 3KW2A 3TIWA 1EUQA 4JXXA 3X2JA 2JA5A 4JS7A 4KLNA 2V3VA 2PMZA 4UY88 2C45A 4WFAS 2A69D 3X2MA 2EGWA 5DYGA 1O0BA 2HZ7A 3HU2A 2KI8A 3QQ8A 3QQ7A 2YU9A 3X2GA 1UDXA 4ENGA 1FDOA 2G6GA 1EU1A 1FEUA 2BE5D 3GTLA 3CF5S 3GTPA 1KQFA 1PQFA 3PIPS 3X1LB 4JXZA 3ENGA 5C1BA 1OA9A 2JIRA 1EXDA 4AYBA 5GLFA 3QWZA 1CZ5A 4WFNS 5JVGS 4CRYG 1TWCA 2NWAA 1DMRA 5EPPA 4CRZA 4FG2A 4AVRA 1E32A 3M3GA 3AIIA 5GAEW 4IOAS 4KDIA 5GAHW 3SUMA 2ZJPS 4U67S 3OUGA 4AZDA 1Y5IA 1OGYA 2R93A 3CZBA 5DM6S 2YUJA 3SUKA 1SIWA 3PIOS 1EUYA 2VPWA 1SMYD 4FFTA 2KQAA 4KO8A 1NYLA 3PLXB 3IR6A 2AE0X 4KODA 1PYUB 3X2PA 2HCZX 2JA6A 3X2NA 2EGVA 1QRUA 1DFUP 4DMRA 4L69A 5JVHS 1PT0A 2G5DA 2NYAA 2ZJRS 1GTRA 1PQHA 1HD5A 1QRSA 3FKIA 2VPZA 4JJOA 1TWHA 1Q16A 5FTLA 4JYZA 1K83A 1QDNA 1YLEA 5T5MD 4E8BA 2PJHB 4FG4A 1YNND 4FERA 2ENGA 4V194 1YNJD 2PI8A 3HU3A 3ML1A 1UHEA 3CF2A 2B63A 1QTQA 5FTJA 4IOCS 1PPYA 1TWGA 2GAEA 4WFBS 1R9TA 3X2KA 4JP6A 3O5AA 1S3SA 2Y0SA 2VUMA 1H0HA 2V45A 3D30A 3HKZA 3GTJA 2DMRA 3GTKA 2E2IA 5GADW 2PICA 5GAGW 1PYQA 1CR5A 4RV0A 1KQGA 4WCES 4IO9S 2NVXA 4JCWA 1E18A 5HL7S 1NXZA 3W2WB 4AOKB 1D6KA 4AAYA 2A6ED 1QCSA 4NOHA 5C18A 3X2HA 3HU1A 3SULA 2EEOB 1TMOA 2O5JD 2JA7A 5FTMA 3DMRA 3GTGA 3QC8A 1WCMA 3X2IA 1Y1WA 3X2OA 3GTQA 5FTKA 1BW4A 5IZNA 2R7ZA 1TWAA 2CW0D 3CQZA 1VHKA 2RE8A 2VPYA 3GTMA 4WF9S 2NVYA 1ZC1A 1R27A 1PQEA 4P2BA 4J3CA 2VPXA 1I3QA 5T5ID 5GLYA 1G8KA 4GA5A 4CS0A 1TWFA 4H4KA 5H4UA 2Z0YA 1FDIA 1H5NA 1Y4ZA 4D7ZB 2JIQA 1ZJWA 1Y1VA 1BW3A 5BNZA 4H3SA 1VC3B 3IR5A 3DLLS 3SUJA 2ZJQS 3TM7B 2R92A 4QIWA 1B75A 2JIMA 2PNWA 1I50A 1E5VA 2E7ZA 2A6HD 1WLFA 3W2VB 1E60A 5DM7S 2A68D 2BH0A 3GTOA 2E2HA 1G8JA
chains in the Genus database with same CATH topology
5DYIA 4KDLA 2JIPA 1ZYRD 3IR7A 1DMSA 2WB1A 5GM9A 4GA6A 1WC2A 5GLXA 3X2LA 2PJJA 1IW7D 1AW8B 2JIOA 1AA6A 5FTNA 1R7RA 1OA7A 4AONB 1N10A 1SFOA 3H0GA 1UHDA 1CZ4A 4C2MA 1PT1A 2IV2X 1E61A 1L8FA 2WAQA 4L48A 4JP7A 2NAPA 5B6CA 4ZM7A 3TIWA 3X2JA 2JA5A 4JS7A 4KLNA 2V3VA 2PMZA 2C45A 2A69D 3X2MA 5DYGA 3HU2A 2KI8A 3QQ8A 3QQ7A 2YU9A 3X2GA 4ENGA 1FDOA 2G6GA 1EU1A 2BE5D 3GTLA 3GTPA 1KQFA 1PQFA 3ENGA 5C1BA 1OA9A 2JIRA 4AYBA 5GLFA 3QWZA 1CZ5A 4CRYG 1TWCA 1DMRA 5EPPA 4CRZA 4FG2A 4AVRA 1E32A 3M3GA 4KDIA 3SUMA 3OUGA 4AZDA 1Y5IA 1OGYA 2R93A 3CZBA 3SUKA 2YUJA 1SIWA 2VPWA 1SMYD 4FFTA 2KQAA 4KO8A 3PLXB 3IR6A 2AE0X 4KODA 1PYUB 3X2PA 2HCZX 2JA6A 3X2NA 4DMRA 1PT0A 2G5DA 2NYAA 1PQHA 1HD5A 3FKIA 4JJOA 2VPZA 1TWHA 1Q16A 5FTLA 1K83A 1QDNA 1YLEA 5T5MD 2PJHB 4FG4A 4FERA 1YNND 2ENGA 1YNJD 2PI8A 3HU3A 3ML1A 1UHEA 3CF2A 2B63A 5FTJA 1PPYA 1TWGA 2GAEA 1R9TA 3X2KA 4JP6A 3O5AA 1S3SA 2Y0SA 2VUMA 1H0HA 2V45A 3D30A 3HKZA 3GTJA 2DMRA 3GTKA 2E2IA 2PICA 1PYQA 1CR5A 4RV0A 1KQGA 2NVXA 4JCWA 1E18A 4AOKB 4AAYA 2A6ED 1QCSA 4NOHA 5C18A 3X2HA 3HU1A 3SULA 2EEOB 1TMOA 2O5JD 2JA7A 5FTMA 3DMRA 3GTGA 3QC8A 3X2IA 1WCMA 1Y1WA 3X2OA 3GTQA 5FTKA 1BW4A 2R7ZA 1TWAA 2CW0D 3CQZA 2VPYA 3GTMA 2NVYA 1ZC1A 1R27A 1PQEA 2VPXA 1I3QA 5T5ID 5GLYA 1G8KA 4GA5A 4CS0A 1TWFA 5H4UA 1FDIA 1H5NA 1Y4ZA 4D7ZB 2JIQA 1Y1VA 1BW3A 1VC3B 3IR5A 3SUJA 3TM7B 2R92A 4QIWA 2JIMA 2PNWA 1I50A 1E5VA 2E7ZA 2A6HD 1WLFA 1E60A 2A68D 2BH0A 3GTOA 2E2HA 1G8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENG A;  2G6G A;  1HD5 A;  4JJO A;  3X2I A;  3X2O A;  5GM9 A;  1BW4 A;  1WC2 A;  5GLX A;  3ENG A;  2PJJ A;  1OA9 A;  4FG4 A;  4FER A;  3X2L A;  2ENG A;  2PI8 A;  1OA7 A;  4FG2 A;  1N10 A;  4AVR A;  3M3G A;  5GLY A;  2GAE A;  3SUM A;  3X2K A;  4JP6 A;  1L8F A;  5H4U A;  4L48 A;  3CZB A;  3D30 A;  4JP7 A;  3SUK A;  4ZM7 A;  3X2J A;  1BW3 A;  4JS7 A;  2PIC A;  2KQA A;  4FFT A;  3SUJ A;  2AE0 X;  3X2P A;  2HCZ X;  4JCW A;  3X2N A;  2PNW A;  3X2M A;  2G5D A;  2BH0 A;  3X2H A;  3X2G A;  3SUL A; 
#chains in the Genus database with same CATH topology
 1V6Z A;  5DYI A;  4KDL A;  2JIP A;  1O0C A;  1ZYR D;  3IR7 A;  3J7Z V;  1DMS A;  2WB1 A;  1GTS A;  4GA6 A;  5GM9 A;  1WC2 A;  5GLX A;  1QRT A;  3X2L A;  2PJJ A;  1IW7 D;  1AW8 B;  2JIO A;  1AA6 A;  2CX8 A;  5FTN A;  1R7R A;  1OA7 A;  4AON B;  1VHY A;  1Z85 A;  1N10 A;  1SFO A;  3H0G A;  1UHD A;  1CZ4 A;  4C2M A;  1PT1 A;  2IV2 X;  1E61 A;  1L8F A;  2RD2 A;  2WAQ A;  4L48 A;  2NAP A;  4JP7 A;  5B6C A;  4ZM7 A;  3KW2 A;  3TIW A;  1EUQ A;  4JXX A;  3X2J A;  2JA5 A;  4JS7 A;  4KLN A;  2V3V A;  2PMZ A;  4UY8 8;  2C45 A;  4WFA S;  2A69 D;  3X2M A;  2EGW A;  5DYG A;  1O0B A;  2HZ7 A;  3HU2 A;  2KI8 A;  3QQ8 A;  3QQ7 A;  2YU9 A;  3X2G A;  1UDX A;  4ENG A;  1FDO A;  2G6G A;  1EU1 A;  1FEU A;  2BE5 D;  3GTL A;  3CF5 S;  3GTP A;  1KQF A;  1PQF A;  3PIP S;  3X1L B;  4JXZ A;  3ENG A;  5C1B A;  1OA9 A;  2JIR A;  1EXD A;  4AYB A;  5GLF A;  3QWZ A;  1CZ5 A;  4WFN S;  5JVG S;  4CRY G;  1TWC A;  2NWA A;  1DMR A;  5EPP A;  4CRZ A;  4FG2 A;  4AVR A;  1E32 A;  3M3G A;  3AII A;  5GAE W;  4IOA S;  4KDI A;  5GAH W;  3SUM A;  2ZJP S;  4U67 S;  3OUG A;  4AZD A;  1Y5I A;  1OGY A;  2R93 A;  3CZB A;  5DM6 S;  2YUJ A;  3SUK A;  1SIW A;  3PIO S;  1EUY A;  2VPW A;  1SMY D;  4FFT A;  2KQA A;  4KO8 A;  1NYL A;  3PLX B;  3IR6 A;  2AE0 X;  4KOD A;  1PYU B;  3X2P A;  2HCZ X;  2JA6 A;  3X2N A;  2EGV A;  1QRU A;  1DFU P;  4DMR A;  4L69 A;  5JVH S;  1PT0 A;  2G5D A;  2NYA A;  2ZJR S;  1GTR A;  1PQH A;  1HD5 A;  1QRS A;  3FKI A;  2VPZ A;  4JJO A;  1TWH A;  1Q16 A;  5FTL A;  4JYZ A;  1K83 A;  1QDN A;  1YLE A;  5T5M D;  4E8B A;  2PJH B;  4FG4 A;  1YNN D;  4FER A;  2ENG A;  4V19 4;  1YNJ D;  2PI8 A;  3HU3 A;  3ML1 A;  1UHE A;  3CF2 A;  2B63 A;  1QTQ A;  5FTJ A;  4IOC S;  1PPY A;  1TWG A;  2GAE A;  4WFB S;  1R9T A;  3X2K A;  4JP6 A;  3O5A A;  1S3S A;  2Y0S A;  2VUM A;  1H0H A;  2V45 A;  3D30 A;  3HKZ A;  3GTJ A;  2DMR A;  3GTK A;  2E2I A;  5GAD W;  2PIC A;  5GAG W;  1PYQ A;  1CR5 A;  4RV0 A;  1KQG A;  4WCE S;  4IO9 S;  2NVX A;  4JCW A;  1E18 A;  5HL7 S;  1NXZ A;  3W2W B;  4AOK B;  1D6K A;  4AAY A;  2A6E D;  1QCS A;  4NOH A;  5C18 A;  3X2H A;  3HU1 A;  3SUL A;  2EEO B;  1TMO A;  2O5J D;  2JA7 A;  5FTM A;  3DMR A;  3GTG A;  3QC8 A;  1WCM A;  3X2I A;  1Y1W A;  3X2O A;  3GTQ A;  5FTK A;  1BW4 A;  5IZN A;  2R7Z A;  1TWA A;  2CW0 D;  3CQZ A;  1VHK A;  2RE8 A;  2VPY A;  3GTM A;  4WF9 S;  2NVY A;  1ZC1 A;  1R27 A;  1PQE A;  4P2B A;  4J3C A;  2VPX A;  1I3Q A;  5T5I D;  5GLY A;  1G8K A;  4GA5 A;  4CS0 A;  1TWF A;  4H4K A;  5H4U A;  2Z0Y A;  1FDI A;  1H5N A;  1Y4Z A;  4D7Z B;  2JIQ A;  1ZJW A;  1Y1V A;  1BW3 A;  5BNZ A;  4H3S A;  1VC3 B;  3IR5 A;  3DLL S;  3SUJ A;  2ZJQ S;  3TM7 B;  2R92 A;  4QIW A;  1B75 A;  2JIM A;  2PNW A;  1I50 A;  1E5V A;  2E7Z A;  2A6H D;  1WLF A;  3W2V B;  1E60 A;  5DM7 S;  2A68 D;  2BH0 A;  3GTO A;  2E2H A;  1G8J A; 
#chains in the Genus database with same CATH homology
 5DYI A;  4KDL A;  2JIP A;  1ZYR D;  3IR7 A;  1DMS A;  2WB1 A;  5GM9 A;  4GA6 A;  1WC2 A;  5GLX A;  3X2L A;  2PJJ A;  1IW7 D;  1AW8 B;  2JIO A;  1AA6 A;  5FTN A;  1R7R A;  1OA7 A;  4AON B;  1N10 A;  1SFO A;  3H0G A;  1UHD A;  1CZ4 A;  4C2M A;  1PT1 A;  2IV2 X;  1E61 A;  1L8F A;  2WAQ A;  4L48 A;  4JP7 A;  2NAP A;  5B6C A;  4ZM7 A;  3TIW A;  3X2J A;  2JA5 A;  4JS7 A;  4KLN A;  2V3V A;  2PMZ A;  2C45 A;  2A69 D;  3X2M A;  5DYG A;  3HU2 A;  2KI8 A;  3QQ8 A;  3QQ7 A;  2YU9 A;  3X2G A;  4ENG A;  1FDO A;  2G6G A;  1EU1 A;  2BE5 D;  3GTL A;  3GTP A;  1KQF A;  1PQF A;  3ENG A;  5C1B A;  1OA9 A;  2JIR A;  4AYB A;  5GLF A;  3QWZ A;  1CZ5 A;  4CRY G;  1TWC A;  1DMR A;  5EPP A;  4CRZ A;  4FG2 A;  4AVR A;  1E32 A;  3M3G A;  4KDI A;  3SUM A;  3OUG A;  4AZD A;  1Y5I A;  1OGY A;  2R93 A;  3CZB A;  3SUK A;  2YUJ A;  1SIW A;  2VPW A;  1SMY D;  4FFT A;  2KQA A;  4KO8 A;  3PLX B;  3IR6 A;  2AE0 X;  4KOD A;  1PYU B;  3X2P A;  2HCZ X;  2JA6 A;  3X2N A;  4DMR A;  1PT0 A;  2G5D A;  2NYA A;  1PQH A;  1HD5 A;  3FKI A;  4JJO A;  2VPZ A;  1TWH A;  1Q16 A;  5FTL A;  1K83 A;  1QDN A;  1YLE A;  5T5M D;  2PJH B;  4FG4 A;  4FER A;  1YNN D;  2ENG A;  1YNJ D;  2PI8 A;  3HU3 A;  3ML1 A;  1UHE A;  3CF2 A;  2B63 A;  5FTJ A;  1PPY A;  1TWG A;  2GAE A;  1R9T A;  3X2K A;  4JP6 A;  3O5A A;  1S3S A;  2Y0S A;  2VUM A;  1H0H A;  2V45 A;  3D30 A;  3HKZ A;  3GTJ A;  2DMR A;  3GTK A;  2E2I A;  2PIC A;  1PYQ A;  1CR5 A;  4RV0 A;  1KQG A;  2NVX A;  4JCW A;  1E18 A;  4AOK B;  4AAY A;  2A6E D;  1QCS A;  4NOH A;  5C18 A;  3X2H A;  3HU1 A;  3SUL A;  2EEO B;  1TMO A;  2O5J D;  2JA7 A;  5FTM A;  3DMR A;  3GTG A;  3QC8 A;  3X2I A;  1WCM A;  1Y1W A;  3X2O A;  3GTQ A;  5FTK A;  1BW4 A;  2R7Z A;  1TWA A;  2CW0 D;  3CQZ A;  2VPY A;  3GTM A;  2NVY A;  1ZC1 A;  1R27 A;  1PQE A;  2VPX A;  1I3Q A;  5T5I D;  5GLY A;  1G8K A;  4GA5 A;  4CS0 A;  1TWF A;  5H4U A;  1FDI A;  1H5N A;  1Y4Z A;  4D7Z B;  2JIQ A;  1Y1V A;  1BW3 A;  1VC3 B;  3IR5 A;  3SUJ A;  3TM7 B;  2R92 A;  4QIW A;  2JIM A;  2PNW A;  1I50 A;  1E5V A;  2E7Z A;  2A6H D;  1WLF A;  1E60 A;  2A68 D;  2BH0 A;  3GTO A;  2E2H A;  1G8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...