2PICA

E. coli lytic transglycosylase mlta-d308a in apo-2 form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
SSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVIIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2picA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2picA02
2HCZX 2PNWA 3SUMA 3X2KA 4JP6A 1L8FA 3X2JA 2PJJA 1WC2A 3SUKA 2BH0A 4FG2A 5GLYA 3X2PA 1OA7A 4FFTA 4FG4A 4JS7A 4JJOA 1OA9A 4L48A 3SUJA 1BW4A 1BW3A 2ENGA 3X2NA 3X2LA 5H4UA 3X2GA 1HD5A 3X2IA 4ZM7A 5GM9A 2PI8A 4FERA 3ENGA 2KQAA 2PICA 4JCWA 5GLXA 3SULA 3X2MA 2G6GA 2G5DA 4ENGA 4JP7A 3X2OA 3D30A 1N10A 3M3GA 3CZBA 3X2HA 2GAEA 4AVRA 2AE0X
chains in the Genus database with same CATH superfamily
2PNWA 2ZJRS 2DMRA 4DMRA 2JA7A 3DMRA 1H5NA 1ZC1A 2RD2A 3IR5A 1TWHA 3GTJA 1E60A 2BH0A 2JIPA 1V6ZA 5DYIA 4FFTA 4FG4A 2R7ZA 4CRZA 1OA9A 2JA6A 1BW3A 1G8JA 5FTKA 2ENGA 3GTMA 4E8BA 5H4UA 3PIOS 1PQFA 1WCMA 3HKZA 2NYAA 4U67S 3HU1A 5GM9A 2V45A 5FTNA 1Y1VA 1IW7D 1TWCA 2CW0D 2PI8A 5EPPA 5GLFA 4C2MA 2EGWA 3ENGA 5C1BA 2PICA 4L69A 4WFNS 1VC3B 1QDNA 2R92A 1DMSA 2RE8A 1QRUA 1QRSA 4AZDA 3D30A 1N10A 2E7ZA 2IV2X 1PT1A 5JVGS 2BE5D 3H0GA 1PYQA 1Y4ZA 2HCZX 3SUMA 3GTPA 3X2KA 1L8FA 1I50A 2R93A 3IR6A 3IR7A 4WCES 3O5AA 1TWFA 3ML1A 1CZ5A 1NYLA 4KDLA 1SIWA 2VPWA 3SUKA 5GLYA 2Z0YA 1EXDA 3PIPS 1D6KA 1OA7A 3SUJA 4JJOA 3HU2A 3X1LB 1PYUB 4GA6A 2A68D 2VPYA 2NWAA 3W2VB 4JXZA 3X2IA 1E32A 2WB1A 3CF2A 4CS0A 4AYBA 2B63A 1YLEA 3GTLA 3OUGA 1EU1A 2EEOB 2KQAA 4AAYA 1O0CA 4P2BA 4QIWA 2G6GA 2JIMA 2NVXA 3QC8A 4JP7A 1CZ4A 2C45A 1FDOA 1AW8B 1OGYA 2JIOA 1PPYA 3X2HA 1Y1WA 2JA5A 2JIQA 4AVRA 3TM7B 1SMYD 5JVHS 2JIRA 2PMZA 4JP6A 5FTLA 1I3QA 3GTGA 1GTRA 4UY88 3X2JA 5DM7S 1E5VA 2YU9A 1R7RA 3X2PA 3QQ7A 4AONB 2ZJPS 2O5JD 5C18A 4WFAS 1PT0A 3X2NA 4AOKB 1ZJWA 1EUYA 2VUMA 1TWGA 3X2LA 1UHEA 3X2GA 2CX8A 2YUJA 4WFBS 1B75A 4CRYG 1DFUP 4IOAS 2VPZA 5FTJA 3TIWA 3DLLS 4D7ZB 5T5MD 2HZ7A 4FERA 4JYZA 1KQFA 1O0BA 3GTKA 1PQEA 2ZJQS 5DYGA 3AIIA 4RV0A 4JXXA 1R9TA 3SULA 3GTQA 1FEUA 4KODA 4ENGA 1GTSA 1E61A 1UHDA 5GAGW 3X2OA 2KI8A 1EUQA 4IOCS 2E2IA 4H4KA 1G8KA 1H0HA 2NAPA 1K83A 1NXZA 5GAEW 3W2WB 4V194 1R27A 5DM6S 3PLXB 2NVYA 1YNND 2WAQA 3QQ8A 1AA6A 2A6ED 3CF5S 4NOHA 1PQHA 1QCSA 1WC2A 2PJJA 5B6CA 2PJHB 4FG2A 4KDIA 1E18A 1BW4A 4JS7A 4L48A 5GADW 4IO9S 4WF9S 2V3VA 4KLNA 3CQZA 5GAHW 2VPXA 1DMRA 3QWZA 1HD5A 1TMOA 4KO8A 4ZM7A 2A69D 1SFOA 2E2HA 2EGVA 5IZNA 1CR5A 1S3SA 1TWAA 3GTOA 1VHYA 3HU3A 4JCWA 4J3CA 1ZYRD 5T5ID 1QTQA 2Y0SA 5GLXA 1FDIA 2A6HD 3X2MA 4H3SA 5HL7S 1QRTA 1VHKA 2G5DA 1UDXA 1Z85A 1WLFA 3FKIA 5FTMA 1KQGA 3M3GA 1Y5IA 3CZBA 1Q16A 4GA5A 2GAEA 1YNJD 3KW2A 5BNZA 3J7ZV 2AE0X
chains in the Genus database with same CATH topology
2PNWA 2DMRA 4DMRA 2JA7A 3DMRA 1H5NA 1ZC1A 3IR5A 1TWHA 3GTJA 2BH0A 1E60A 2JIPA 5DYIA 4FFTA 4FG4A 2R7ZA 1BW3A 1OA9A 4CRZA 2JA6A 1G8JA 5FTKA 2ENGA 3GTMA 5H4UA 1PQFA 1WCMA 3HKZA 2NYAA 3HU1A 5GM9A 2V45A 5FTNA 1Y1VA 1IW7D 2PI8A 1TWCA 2CW0D 5EPPA 5GLFA 4C2MA 3ENGA 5C1BA 2PICA 1VC3B 1QDNA 2R92A 1DMSA 4AZDA 3D30A 1N10A 2E7ZA 2IV2X 1PT1A 2BE5D 3H0GA 1PYQA 2HCZX 3SUMA 1Y4ZA 3GTPA 3X2KA 1L8FA 1I50A 2R93A 3IR6A 3IR7A 3O5AA 1TWFA 3ML1A 1CZ5A 4KDLA 1SIWA 2VPWA 3SUKA 5GLYA 1OA7A 3SUJA 4JJOA 3HU2A 1PYUB 4GA6A 2A68D 2VPYA 3X2IA 1E32A 2WB1A 3CF2A 4CS0A 4AYBA 2B63A 1YLEA 3GTLA 3OUGA 1EU1A 2KQAA 2EEOB 4AAYA 4QIWA 2G6GA 2JIMA 2NVXA 3QC8A 4JP7A 1CZ4A 2C45A 1FDOA 1AW8B 1OGYA 2JIOA 3X2HA 1PPYA 1Y1WA 2JA5A 2JIQA 4AVRA 3TM7B 1SMYD 2JIRA 2PMZA 4JP6A 5FTLA 1I3QA 3GTGA 3X2JA 1E5VA 2YU9A 3X2PA 1R7RA 3QQ7A 4AONB 2O5JD 5C18A 1PT0A 3X2NA 4AOKB 2VUMA 1TWGA 3X2LA 1UHEA 3X2GA 2YUJA 4CRYG 2VPZA 5FTJA 3TIWA 4D7ZB 5T5MD 4FERA 1KQFA 3GTKA 1PQEA 5DYGA 4RV0A 1R9TA 3SULA 3GTQA 4ENGA 4KODA 1E61A 1UHDA 3X2OA 2KI8A 2E2IA 1G8KA 1H0HA 2NAPA 1K83A 1R27A 3PLXB 2NVYA 1YNND 2WAQA 3QQ8A 1AA6A 2A6ED 4NOHA 2PJJA 1WC2A 1PQHA 1QCSA 5B6CA 2PJHB 4FG2A 4KDIA 1E18A 1BW4A 4JS7A 4L48A 2V3VA 4KLNA 3CQZA 2VPXA 1DMRA 3QWZA 1HD5A 1TMOA 4KO8A 4ZM7A 2A69D 1SFOA 2E2HA 1CR5A 1S3SA 1TWAA 3GTOA 3HU3A 4JCWA 1ZYRD 5T5ID 5GLXA 2Y0SA 1FDIA 2A6HD 3X2MA 2G5DA 1WLFA 3FKIA 5FTMA 1KQGA 3M3GA 3CZBA 1Y5IA 1Q16A 4GA5A 2GAEA 1YNJD 2AE0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCZ X;  2PNW A;  3SUM A;  3X2K A;  4JP6 A;  1L8F A;  3X2J A;  2PJJ A;  1WC2 A;  3SUK A;  2BH0 A;  4FG2 A;  5GLY A;  3X2P A;  1OA7 A;  4FFT A;  4FG4 A;  4JS7 A;  4JJO A;  1OA9 A;  4L48 A;  3SUJ A;  1BW4 A;  1BW3 A;  2ENG A;  3X2N A;  3X2L A;  5H4U A;  3X2G A;  1HD5 A;  3X2I A;  4ZM7 A;  5GM9 A;  2PI8 A;  4FER A;  3ENG A;  2KQA A;  2PIC A;  4JCW A;  5GLX A;  3SUL A;  3X2M A;  2G6G A;  2G5D A;  4ENG A;  4JP7 A;  3X2O A;  3D30 A;  1N10 A;  3M3G A;  3CZB A;  3X2H A;  2GAE A;  4AVR A;  2AE0 X; 
#chains in the Genus database with same CATH topology
 2PNW A;  2ZJR S;  2DMR A;  4DMR A;  2JA7 A;  3DMR A;  1H5N A;  1ZC1 A;  2RD2 A;  3IR5 A;  1TWH A;  3GTJ A;  1E60 A;  2BH0 A;  2JIP A;  1V6Z A;  5DYI A;  4FFT A;  4FG4 A;  2R7Z A;  4CRZ A;  1OA9 A;  2JA6 A;  1BW3 A;  1G8J A;  5FTK A;  2ENG A;  3GTM A;  4E8B A;  5H4U A;  3PIO S;  1PQF A;  1WCM A;  3HKZ A;  2NYA A;  4U67 S;  3HU1 A;  5GM9 A;  2V45 A;  5FTN A;  1Y1V A;  1IW7 D;  1TWC A;  2CW0 D;  2PI8 A;  5EPP A;  5GLF A;  4C2M A;  2EGW A;  3ENG A;  5C1B A;  2PIC A;  4L69 A;  4WFN S;  1VC3 B;  1QDN A;  2R92 A;  1DMS A;  2RE8 A;  1QRU A;  1QRS A;  4AZD A;  3D30 A;  1N10 A;  2E7Z A;  2IV2 X;  1PT1 A;  5JVG S;  2BE5 D;  3H0G A;  1PYQ A;  1Y4Z A;  2HCZ X;  3SUM A;  3GTP A;  3X2K A;  1L8F A;  1I50 A;  2R93 A;  3IR6 A;  3IR7 A;  4WCE S;  3O5A A;  1TWF A;  3ML1 A;  1CZ5 A;  1NYL A;  4KDL A;  1SIW A;  2VPW A;  3SUK A;  5GLY A;  2Z0Y A;  1EXD A;  3PIP S;  1D6K A;  1OA7 A;  3SUJ A;  4JJO A;  3HU2 A;  3X1L B;  1PYU B;  4GA6 A;  2A68 D;  2VPY A;  2NWA A;  3W2V B;  4JXZ A;  3X2I A;  1E32 A;  2WB1 A;  3CF2 A;  4CS0 A;  4AYB A;  2B63 A;  1YLE A;  3GTL A;  3OUG A;  1EU1 A;  2EEO B;  2KQA A;  4AAY A;  1O0C A;  4P2B A;  4QIW A;  2G6G A;  2JIM A;  2NVX A;  3QC8 A;  4JP7 A;  1CZ4 A;  2C45 A;  1FDO A;  1AW8 B;  1OGY A;  2JIO A;  1PPY A;  3X2H A;  1Y1W A;  2JA5 A;  2JIQ A;  4AVR A;  3TM7 B;  1SMY D;  5JVH S;  2JIR A;  2PMZ A;  4JP6 A;  5FTL A;  1I3Q A;  3GTG A;  1GTR A;  4UY8 8;  3X2J A;  5DM7 S;  1E5V A;  2YU9 A;  1R7R A;  3X2P A;  3QQ7 A;  4AON B;  2ZJP S;  2O5J D;  5C18 A;  4WFA S;  1PT0 A;  3X2N A;  4AOK B;  1ZJW A;  1EUY A;  2VUM A;  1TWG A;  3X2L A;  1UHE A;  3X2G A;  2CX8 A;  2YUJ A;  4WFB S;  1B75 A;  4CRY G;  1DFU P;  4IOA S;  2VPZ A;  5FTJ A;  3TIW A;  3DLL S;  4D7Z B;  5T5M D;  2HZ7 A;  4FER A;  4JYZ A;  1KQF A;  1O0B A;  3GTK A;  1PQE A;  2ZJQ S;  5DYG A;  3AII A;  4RV0 A;  4JXX A;  1R9T A;  3SUL A;  3GTQ A;  1FEU A;  4KOD A;  4ENG A;  1GTS A;  1E61 A;  1UHD A;  5GAG W;  3X2O A;  2KI8 A;  1EUQ A;  4IOC S;  2E2I A;  4H4K A;  1G8K A;  1H0H A;  2NAP A;  1K83 A;  1NXZ A;  5GAE W;  3W2W B;  4V19 4;  1R27 A;  5DM6 S;  3PLX B;  2NVY A;  1YNN D;  2WAQ A;  3QQ8 A;  1AA6 A;  2A6E D;  3CF5 S;  4NOH A;  1PQH A;  1QCS A;  1WC2 A;  2PJJ A;  5B6C A;  2PJH B;  4FG2 A;  4KDI A;  1E18 A;  1BW4 A;  4JS7 A;  4L48 A;  5GAD W;  4IO9 S;  4WF9 S;  2V3V A;  4KLN A;  3CQZ A;  5GAH W;  2VPX A;  1DMR A;  3QWZ A;  1HD5 A;  1TMO A;  4KO8 A;  4ZM7 A;  2A69 D;  1SFO A;  2E2H A;  2EGV A;  5IZN A;  1CR5 A;  1S3S A;  1TWA A;  3GTO A;  1VHY A;  3HU3 A;  4JCW A;  4J3C A;  1ZYR D;  5T5I D;  1QTQ A;  2Y0S A;  5GLX A;  1FDI A;  2A6H D;  3X2M A;  4H3S A;  5HL7 S;  1QRT A;  1VHK A;  2G5D A;  1UDX A;  1Z85 A;  1WLF A;  3FKI A;  5FTM A;  1KQG A;  3M3G A;  1Y5I A;  3CZB A;  1Q16 A;  4GA5 A;  2GAE A;  1YNJ D;  3KW2 A;  5BNZ A;  3J7Z V;  2AE0 X; 
#chains in the Genus database with same CATH homology
 2PNW A;  2DMR A;  4DMR A;  2JA7 A;  3DMR A;  1H5N A;  1ZC1 A;  3IR5 A;  1TWH A;  3GTJ A;  2BH0 A;  1E60 A;  2JIP A;  5DYI A;  4FFT A;  4FG4 A;  2R7Z A;  1BW3 A;  1OA9 A;  4CRZ A;  2JA6 A;  1G8J A;  5FTK A;  2ENG A;  3GTM A;  5H4U A;  1PQF A;  1WCM A;  3HKZ A;  2NYA A;  3HU1 A;  5GM9 A;  2V45 A;  5FTN A;  1Y1V A;  1IW7 D;  2PI8 A;  1TWC A;  2CW0 D;  5EPP A;  5GLF A;  4C2M A;  3ENG A;  5C1B A;  2PIC A;  1VC3 B;  1QDN A;  2R92 A;  1DMS A;  4AZD A;  3D30 A;  1N10 A;  2E7Z A;  2IV2 X;  1PT1 A;  2BE5 D;  3H0G A;  1PYQ A;  2HCZ X;  3SUM A;  1Y4Z A;  3GTP A;  3X2K A;  1L8F A;  1I50 A;  2R93 A;  3IR6 A;  3IR7 A;  3O5A A;  1TWF A;  3ML1 A;  1CZ5 A;  4KDL A;  1SIW A;  2VPW A;  3SUK A;  5GLY A;  1OA7 A;  3SUJ A;  4JJO A;  3HU2 A;  1PYU B;  4GA6 A;  2A68 D;  2VPY A;  3X2I A;  1E32 A;  2WB1 A;  3CF2 A;  4CS0 A;  4AYB A;  2B63 A;  1YLE A;  3GTL A;  3OUG A;  1EU1 A;  2KQA A;  2EEO B;  4AAY A;  4QIW A;  2G6G A;  2JIM A;  2NVX A;  3QC8 A;  4JP7 A;  1CZ4 A;  2C45 A;  1FDO A;  1AW8 B;  1OGY A;  2JIO A;  3X2H A;  1PPY A;  1Y1W A;  2JA5 A;  2JIQ A;  4AVR A;  3TM7 B;  1SMY D;  2JIR A;  2PMZ A;  4JP6 A;  5FTL A;  1I3Q A;  3GTG A;  3X2J A;  1E5V A;  2YU9 A;  3X2P A;  1R7R A;  3QQ7 A;  4AON B;  2O5J D;  5C18 A;  1PT0 A;  3X2N A;  4AOK B;  2VUM A;  1TWG A;  3X2L A;  1UHE A;  3X2G A;  2YUJ A;  4CRY G;  2VPZ A;  5FTJ A;  3TIW A;  4D7Z B;  5T5M D;  4FER A;  1KQF A;  3GTK A;  1PQE A;  5DYG A;  4RV0 A;  1R9T A;  3SUL A;  3GTQ A;  4ENG A;  4KOD A;  1E61 A;  1UHD A;  3X2O A;  2KI8 A;  2E2I A;  1G8K A;  1H0H A;  2NAP A;  1K83 A;  1R27 A;  3PLX B;  2NVY A;  1YNN D;  2WAQ A;  3QQ8 A;  1AA6 A;  2A6E D;  4NOH A;  2PJJ A;  1WC2 A;  1PQH A;  1QCS A;  5B6C A;  2PJH B;  4FG2 A;  4KDI A;  1E18 A;  1BW4 A;  4JS7 A;  4L48 A;  2V3V A;  4KLN A;  3CQZ A;  2VPX A;  1DMR A;  3QWZ A;  1HD5 A;  1TMO A;  4KO8 A;  4ZM7 A;  2A69 D;  1SFO A;  2E2H A;  1CR5 A;  1S3S A;  1TWA A;  3GTO A;  3HU3 A;  4JCW A;  1ZYR D;  5T5I D;  5GLX A;  2Y0S A;  1FDI A;  2A6H D;  3X2M A;  2G5D A;  1WLF A;  3FKI A;  5FTM A;  1KQG A;  3M3G A;  3CZB A;  1Y5I A;  1Q16 A;  4GA5 A;  2GAE A;  1YNJ D;  2AE0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...