2PICA

E. coli lytic transglycosylase mlta-d308a in apo-2 form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
b'SSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVIIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2picA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2picA02
2PJJA 3X2JA 4L48A 3SULA 2PICA 4FERA 4JS7A 3X2KA 4ZM7A 3SUKA 3X2NA 3X2OA 1BW4A 1BW3A 4JP6A 3X2HA 2BH0A 5H4UA 4JJOA 1L8FA 4AVRA 2PNWA 1OA9A 5GLYA 4FG4A 2PI8A 2AE0X 3M3GA 3ENGA 3SUMA 3X2GA 1N10A 5GM9A 5GLXA 4JCWA 2GAEA 3X2IA 4ENGA 2HCZX 1HD5A 4FG2A 3SUJA 2ENGA 3CZBA 2G6GA 3X2MA 4JP7A 4FFTA 3D30A 3X2LA 1OA7A 1WC2A 3X2PA 2G5DA 2KQAA
chains in the Genus database with same CATH superfamily
2ZJQS 2VPWA 5JVGS 1O0BA 4GA5A 5T5MD 1EUQA 4J3CA 2PICA 4FERA 1AA6A 4JS7A 1B75A 3FKIA 3X2KA 2KI8A 3W2WB 2E7ZA 5DYIA 4CRYG 4KLNA 5FTJA 2JIRA 5GLFA 2V3VA 3AIIA 4CS0A 4H4KA 1ZYRD 1VHYA 1O0CA 1NXZA 3HU1A 3O5AA 4U67S 1TWCA 2NVYA 1QRTA 3M3GA 4C2MA 2YUJA 1I50A 2NAPA 3HU3A 5GM9A 1CR5A 5GLXA 3CF2A 5T5ID 1R7RA 2JA5A 1HD5A 2VPXA 1TWFA 4FG2A 3SUJA 2CX8A 3CZBA 1UDXA 2G6GA 3HKZA 3QQ8A 5FTLA 1KQGA 1PYUB 3D30A 1VHKA 1TWGA 5FTKA 1QRUA 2G5DA 3HU2A 1G8KA 1H0HA 2KQAA 3GTOA 4WFBS 1SMYD 4L48A 4WFAS 2ZJRS 1R27A 4AYBA 4H3SA 1Y5IA 1S3SA 2A69D 1OGYA 3OUGA 5GADW 1PYQA 4RV0A 2VPZA 2VUMA 1E18A 1GTRA 1SIWA 3SUKA 3X2NA 3X2OA 4JXXA 1BW3A 1QTQA 1PT1A 3J7ZV 4KDLA 2BE5D 1FDOA 4JJOA 5H4UA 1WLFA 2Z0YA 2JA7A 4IOAS 1FDIA 4P2BA 3H0GA 4FG4A 3PIPS 1E61A 1PT0A 2JIMA 4GA6A 1QCSA 2Y0SA 3X2GA 2R93A 1ZJWA 4JCWA 1G8JA 4ENGA 3W2VB 4WCES 1DMRA 2HCZX 3DMRA 4E8BA 1D6KA 1UHEA 3GTPA 4KO8A 1KQFA 3X2MA 4JP7A 1YNJD 4FFTA 3TM7B 3IR7A 2EGWA 3IR6A 3X2PA 4D7ZB 1EU1A 2A6ED 2PMZA 3GTGA 2C45A 2RE8A 2VPYA 5GAGW 2PJJA 1PQFA 3X2JA 1EUYA 4AAYA 3SULA 1YLEA 3KW2A 3DLLS 2NWAA 5DM7S 3QWZA 2JIPA 3X1LB 5HL7S 4KODA 1SFOA 5B6CA 1TMOA 4JYZA 4JP6A 1PPYA 1VC3B 1R9TA 2EEOB 3X2HA 1TWAA 1TWHA 2BH0A 5EPPA 4KDIA 2E2IA 5IZNA 1Y1WA 2NVXA 5DM6S 4DMRA 2DMRA 3GTLA 1PQEA 2PNWA 1OA9A 5DYGA 2WAQA 2PJHB 2E2HA 3TIWA 2O5JD 5GLYA 4WFNS 5BNZA 2EGVA 2JIQA 3ENGA 4V194 4JXZA 3GTQA 5C18A 3GTKA 3X2IA 1QDNA 3ML1A 2JA6A 1UHDA 3IR5A 2NYAA 1NYLA 2ZJPS 2WB1A 1CZ4A 1E5VA 1Q16A 2CW0D 4UY88 3CF5S 2IV2X 1DMSA 1CZ5A 5GAHW 2YU9A 4WF9S 3QQ7A 2R92A 4L69A 1YNND 4IOCS 3QC8A 4ZM7A 1V6ZA 1ZC1A 2HZ7A 1BW4A 1H5NA 2R7ZA 3PIOS 5JVHS 1FEUA 1DFUP 3GTJA 4QIWA 1WCMA 2B63A 5C1BA 1I3QA 1L8FA 4AVRA 1K83A 3GTMA 2RD2A 2V45A 1Y4ZA 4IO9S 4AZDA 2PI8A 1GTSA 1AW8B 2AE0X 3SUMA 1IW7D 4AOKB 5GAEW 1N10A 1Y1VA 3PLXB 3CQZA 2GAEA 2A6HD 2JIOA 1PQHA 1Z85A 5FTNA 2ENGA 1E32A 4NOHA 5FTMA 4AONB 1EXDA 1QRSA 1E60A 3X2LA 1OA7A 1WC2A 4CRZA 2A68D
chains in the Genus database with same CATH topology
2VPWA 4GA5A 5T5MD 2PICA 4FERA 1AA6A 4JS7A 3FKIA 3X2KA 2KI8A 2E7ZA 5DYIA 4CRYG 4KLNA 5FTJA 2JIRA 5GLFA 2V3VA 4CS0A 1ZYRD 3HU1A 3O5AA 1TWCA 2NVYA 3M3GA 4C2MA 2YUJA 1I50A 2NAPA 5GM9A 3HU3A 5GLXA 1CR5A 3CF2A 5T5ID 1R7RA 2JA5A 1HD5A 2VPXA 1TWFA 4FG2A 3SUJA 3CZBA 2G6GA 3HKZA 3QQ8A 5FTLA 1KQGA 3D30A 1PYUB 1TWGA 5FTKA 2G5DA 3HU2A 1G8KA 1H0HA 2KQAA 3GTOA 1SMYD 4L48A 1R27A 4AYBA 1Y5IA 1S3SA 2A69D 1OGYA 3OUGA 1PYQA 4RV0A 2VPZA 2VUMA 1E18A 3SUKA 3X2NA 3X2OA 1SIWA 1BW3A 1PT1A 4KDLA 5H4UA 1FDOA 4JJOA 2BE5D 1WLFA 2JA7A 1FDIA 3H0GA 4FG4A 1E61A 1PT0A 2JIMA 4GA6A 1QCSA 2Y0SA 3X2GA 2R93A 4JCWA 4ENGA 1G8JA 1DMRA 2HCZX 3DMRA 1UHEA 3GTPA 4KO8A 1KQFA 3X2MA 4JP7A 4FFTA 1YNJD 3TM7B 3IR7A 3IR6A 3X2PA 4D7ZB 1EU1A 2A6ED 2PMZA 3GTGA 2C45A 2VPYA 2PJJA 3X2JA 1PQFA 4AAYA 3SULA 1YLEA 3QWZA 2JIPA 4KODA 1SFOA 5B6CA 1TMOA 4JP6A 1PPYA 1VC3B 1R9TA 2EEOB 3X2HA 1TWAA 1TWHA 2BH0A 5EPPA 4KDIA 2E2IA 1Y1WA 2NVXA 4DMRA 2DMRA 3GTLA 2PNWA 1PQEA 1OA9A 5DYGA 2WAQA 2PJHB 2E2HA 3TIWA 2O5JD 5GLYA 2JIQA 3ENGA 3GTQA 5C18A 3GTKA 3X2IA 1QDNA 3ML1A 2JA6A 1UHDA 3IR5A 2NYAA 2WB1A 1CZ4A 1E5VA 1Q16A 2CW0D 2IV2X 1DMSA 1CZ5A 2YU9A 3QQ7A 2R92A 1YNND 3QC8A 4ZM7A 1ZC1A 1BW4A 1H5NA 2R7ZA 3GTJA 4QIWA 1WCMA 2B63A 5C1BA 1I3QA 1L8FA 4AVRA 1K83A 3GTMA 2V45A 1Y4ZA 4AZDA 2PI8A 1AW8B 2AE0X 3SUMA 1IW7D 4AOKB 1N10A 1Y1VA 3PLXB 3CQZA 2GAEA 2A6HD 2JIOA 1PQHA 5FTNA 2ENGA 1E32A 4NOHA 5FTMA 4AONB 1E60A 3X2LA 1OA7A 1WC2A 4CRZA 2A68D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJJ A;  3X2J A;  4L48 A;  3SUL A;  2PIC A;  4FER A;  4JS7 A;  3X2K A;  4ZM7 A;  3SUK A;  3X2N A;  3X2O A;  1BW4 A;  1BW3 A;  4JP6 A;  3X2H A;  2BH0 A;  5H4U A;  4JJO A;  1L8F A;  4AVR A;  2PNW A;  1OA9 A;  5GLY A;  4FG4 A;  2PI8 A;  2AE0 X;  3M3G A;  3ENG A;  3SUM A;  3X2G A;  1N10 A;  5GM9 A;  5GLX A;  4JCW A;  2GAE A;  3X2I A;  4ENG A;  2HCZ X;  1HD5 A;  4FG2 A;  3SUJ A;  2ENG A;  3CZB A;  2G6G A;  3X2M A;  4JP7 A;  4FFT A;  3D30 A;  3X2L A;  1OA7 A;  1WC2 A;  3X2P A;  2G5D A;  2KQA A; 
#chains in the Genus database with same CATH topology
 2ZJQ S;  2VPW A;  5JVG S;  1O0B A;  4GA5 A;  5T5M D;  1EUQ A;  4J3C A;  2PIC A;  4FER A;  1AA6 A;  4JS7 A;  1B75 A;  3FKI A;  3X2K A;  2KI8 A;  3W2W B;  2E7Z A;  5DYI A;  4CRY G;  4KLN A;  5FTJ A;  2JIR A;  5GLF A;  2V3V A;  3AII A;  4CS0 A;  4H4K A;  1ZYR D;  1VHY A;  1O0C A;  1NXZ A;  3HU1 A;  3O5A A;  4U67 S;  1TWC A;  2NVY A;  1QRT A;  3M3G A;  4C2M A;  2YUJ A;  1I50 A;  2NAP A;  3HU3 A;  5GM9 A;  1CR5 A;  5GLX A;  3CF2 A;  5T5I D;  1R7R A;  2JA5 A;  1HD5 A;  2VPX A;  1TWF A;  4FG2 A;  3SUJ A;  2CX8 A;  3CZB A;  1UDX A;  2G6G A;  3HKZ A;  3QQ8 A;  5FTL A;  1KQG A;  1PYU B;  3D30 A;  1VHK A;  1TWG A;  5FTK A;  1QRU A;  2G5D A;  3HU2 A;  1G8K A;  1H0H A;  2KQA A;  3GTO A;  4WFB S;  1SMY D;  4L48 A;  4WFA S;  2ZJR S;  1R27 A;  4AYB A;  4H3S A;  1Y5I A;  1S3S A;  2A69 D;  1OGY A;  3OUG A;  5GAD W;  1PYQ A;  4RV0 A;  2VPZ A;  2VUM A;  1E18 A;  1GTR A;  1SIW A;  3SUK A;  3X2N A;  3X2O A;  4JXX A;  1BW3 A;  1QTQ A;  1PT1 A;  3J7Z V;  4KDL A;  2BE5 D;  1FDO A;  4JJO A;  5H4U A;  1WLF A;  2Z0Y A;  2JA7 A;  4IOA S;  1FDI A;  4P2B A;  3H0G A;  4FG4 A;  3PIP S;  1E61 A;  1PT0 A;  2JIM A;  4GA6 A;  1QCS A;  2Y0S A;  3X2G A;  2R93 A;  1ZJW A;  4JCW A;  1G8J A;  4ENG A;  3W2V B;  4WCE S;  1DMR A;  2HCZ X;  3DMR A;  4E8B A;  1D6K A;  1UHE A;  3GTP A;  4KO8 A;  1KQF A;  3X2M A;  4JP7 A;  1YNJ D;  4FFT A;  3TM7 B;  3IR7 A;  2EGW A;  3IR6 A;  3X2P A;  4D7Z B;  1EU1 A;  2A6E D;  2PMZ A;  3GTG A;  2C45 A;  2RE8 A;  2VPY A;  5GAG W;  2PJJ A;  1PQF A;  3X2J A;  1EUY A;  4AAY A;  3SUL A;  1YLE A;  3KW2 A;  3DLL S;  2NWA A;  5DM7 S;  3QWZ A;  2JIP A;  3X1L B;  5HL7 S;  4KOD A;  1SFO A;  5B6C A;  1TMO A;  4JYZ A;  4JP6 A;  1PPY A;  1VC3 B;  1R9T A;  2EEO B;  3X2H A;  1TWA A;  1TWH A;  2BH0 A;  5EPP A;  4KDI A;  2E2I A;  5IZN A;  1Y1W A;  2NVX A;  5DM6 S;  4DMR A;  2DMR A;  3GTL A;  1PQE A;  2PNW A;  1OA9 A;  5DYG A;  2WAQ A;  2PJH B;  2E2H A;  3TIW A;  2O5J D;  5GLY A;  4WFN S;  5BNZ A;  2EGV A;  2JIQ A;  3ENG A;  4V19 4;  4JXZ A;  3GTQ A;  5C18 A;  3GTK A;  3X2I A;  1QDN A;  3ML1 A;  2JA6 A;  1UHD A;  3IR5 A;  2NYA A;  1NYL A;  2ZJP S;  2WB1 A;  1CZ4 A;  1E5V A;  1Q16 A;  2CW0 D;  4UY8 8;  3CF5 S;  2IV2 X;  1DMS A;  1CZ5 A;  5GAH W;  2YU9 A;  4WF9 S;  3QQ7 A;  2R92 A;  4L69 A;  1YNN D;  4IOC S;  3QC8 A;  4ZM7 A;  1V6Z A;  1ZC1 A;  2HZ7 A;  1BW4 A;  1H5N A;  2R7Z A;  3PIO S;  5JVH S;  1FEU A;  1DFU P;  3GTJ A;  4QIW A;  1WCM A;  2B63 A;  5C1B A;  1I3Q A;  1L8F A;  4AVR A;  1K83 A;  3GTM A;  2RD2 A;  2V45 A;  1Y4Z A;  4IO9 S;  4AZD A;  2PI8 A;  1GTS A;  1AW8 B;  2AE0 X;  3SUM A;  1IW7 D;  4AOK B;  5GAE W;  1N10 A;  1Y1V A;  3PLX B;  3CQZ A;  2GAE A;  2A6H D;  2JIO A;  1PQH A;  1Z85 A;  5FTN A;  2ENG A;  1E32 A;  4NOH A;  5FTM A;  4AON B;  1EXD A;  1QRS A;  1E60 A;  3X2L A;  1OA7 A;  1WC2 A;  4CRZ A;  2A68 D; 
#chains in the Genus database with same CATH homology
 2VPW A;  4GA5 A;  5T5M D;  2PIC A;  4FER A;  1AA6 A;  4JS7 A;  3FKI A;  3X2K A;  2KI8 A;  2E7Z A;  5DYI A;  4CRY G;  4KLN A;  5FTJ A;  2JIR A;  5GLF A;  2V3V A;  4CS0 A;  1ZYR D;  3HU1 A;  3O5A A;  1TWC A;  2NVY A;  3M3G A;  4C2M A;  2YUJ A;  1I50 A;  2NAP A;  5GM9 A;  3HU3 A;  5GLX A;  1CR5 A;  3CF2 A;  5T5I D;  1R7R A;  2JA5 A;  1HD5 A;  2VPX A;  1TWF A;  4FG2 A;  3SUJ A;  3CZB A;  2G6G A;  3HKZ A;  3QQ8 A;  5FTL A;  1KQG A;  3D30 A;  1PYU B;  1TWG A;  5FTK A;  2G5D A;  3HU2 A;  1G8K A;  1H0H A;  2KQA A;  3GTO A;  1SMY D;  4L48 A;  1R27 A;  4AYB A;  1Y5I A;  1S3S A;  2A69 D;  1OGY A;  3OUG A;  1PYQ A;  4RV0 A;  2VPZ A;  2VUM A;  1E18 A;  3SUK A;  3X2N A;  3X2O A;  1SIW A;  1BW3 A;  1PT1 A;  4KDL A;  5H4U A;  1FDO A;  4JJO A;  2BE5 D;  1WLF A;  2JA7 A;  1FDI A;  3H0G A;  4FG4 A;  1E61 A;  1PT0 A;  2JIM A;  4GA6 A;  1QCS A;  2Y0S A;  3X2G A;  2R93 A;  4JCW A;  4ENG A;  1G8J A;  1DMR A;  2HCZ X;  3DMR A;  1UHE A;  3GTP A;  4KO8 A;  1KQF A;  3X2M A;  4JP7 A;  4FFT A;  1YNJ D;  3TM7 B;  3IR7 A;  3IR6 A;  3X2P A;  4D7Z B;  1EU1 A;  2A6E D;  2PMZ A;  3GTG A;  2C45 A;  2VPY A;  2PJJ A;  3X2J A;  1PQF A;  4AAY A;  3SUL A;  1YLE A;  3QWZ A;  2JIP A;  4KOD A;  1SFO A;  5B6C A;  1TMO A;  4JP6 A;  1PPY A;  1VC3 B;  1R9T A;  2EEO B;  3X2H A;  1TWA A;  1TWH A;  2BH0 A;  5EPP A;  4KDI A;  2E2I A;  1Y1W A;  2NVX A;  4DMR A;  2DMR A;  3GTL A;  2PNW A;  1PQE A;  1OA9 A;  5DYG A;  2WAQ A;  2PJH B;  2E2H A;  3TIW A;  2O5J D;  5GLY A;  2JIQ A;  3ENG A;  3GTQ A;  5C18 A;  3GTK A;  3X2I A;  1QDN A;  3ML1 A;  2JA6 A;  1UHD A;  3IR5 A;  2NYA A;  2WB1 A;  1CZ4 A;  1E5V A;  1Q16 A;  2CW0 D;  2IV2 X;  1DMS A;  1CZ5 A;  2YU9 A;  3QQ7 A;  2R92 A;  1YNN D;  3QC8 A;  4ZM7 A;  1ZC1 A;  1BW4 A;  1H5N A;  2R7Z A;  3GTJ A;  4QIW A;  1WCM A;  2B63 A;  5C1B A;  1I3Q A;  1L8F A;  4AVR A;  1K83 A;  3GTM A;  2V45 A;  1Y4Z A;  4AZD A;  2PI8 A;  1AW8 B;  2AE0 X;  3SUM A;  1IW7 D;  4AOK B;  1N10 A;  1Y1V A;  3PLX B;  3CQZ A;  2GAE A;  2A6H D;  2JIO A;  1PQH A;  5FTN A;  2ENG A;  1E32 A;  4NOH A;  5FTM A;  4AON B;  1E60 A;  3X2L A;  1OA7 A;  1WC2 A;  4CRZ A;  2A68 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...