2PICA

E. coli lytic transglycosylase mlta-d308a in apo-2 form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
336
Chain Sequence
SSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVIIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Structure of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose: implications for peptidoglycan binding and cleavage
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 336
sequence length 336
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2picA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2picA02
4L48A 5H4UA 5GM9A 3SUJA 1BW4A 5GLYA 2GAEA 3D30A 3SUMA 1WC2A 3X2KA 3X2IA 3X2OA 4ZM7A 4JCWA 2PI8A 1HD5A 3X2NA 3X2HA 4JP6A 2ENGA 4ENGA 3X2MA 3X2JA 3X2PA 2AE0X 2G6GA 4AVRA 2PICA 4FG2A 3SULA 3M3GA 1L8FA 1N10A 4JJOA 4FG4A 4FERA 5GLXA 1BW3A 3ENGA 1OA7A 2G5DA 1OA9A 2HCZX 2BH0A 2PJJA 2PNWA 2KQAA 3SUKA 3CZBA 3X2GA 3X2LA 4JS7A 4FFTA 4JP7A
chains in the Genus database with same CATH superfamily
1KQGA 1E5VA 1TWGA 2VPWA 3D30A 3SUMA 3X2KA 3GTJA 1QRSA 1VC3B 4KODA 3X2IA 4C2MA 4U67S 3X2OA 2Y0SA 1PYQA 5GAGW 2PI8A 1HD5A 5FTKA 1Z85A 4H4KA 2ZJQS 2RE8A 1O0CA 2JIMA 4ENGA 1TWHA 3FKIA 1QCSA 2R93A 1WLFA 2JA6A 2E2HA 4NOHA 5DYIA 4CRZA 5C18A 4AZDA 3SULA 3PIPS 1PT0A 5T5MD 5BNZA 4H3SA 2A6ED 4FG4A 5JVGS 1SMYD 5DM6S 2JA7A 1G8KA 2V45A 2VPZA 1H5NA 1AA6A 1YLEA 2PJJA 5DM7S 4RV0A 5GADW 1SFOA 1E61A 4WFBS 4JXZA 1S3SA 1EUQA 5IZNA 1PPYA 5H4UA 3QQ8A 1Y4ZA 4AOKB 1PQEA 3CF5S 2GAEA 1B75A 1TWCA 1I3QA 3X1LB 2JIRA 2NAPA 5JVHS 1Q16A 5DYGA 1NXZA 4JYZA 4ZM7A 2B63A 2ZJRS 3GTGA 3GTQA 4AONB 1TWFA 1PYUB 2KI8A 4KLNA 2IV2X 2ENGA 5FTNA 2E2IA 3X2MA 1Y5IA 1ZJWA 4D7ZB 1YNND 3X2JA 1R9TA 3GTMA 4AVRA 2EGWA 4WFNS 3J7ZV 3DLLS 4FG2A 3TIWA 1E32A 4P2BA 4IO9S 4IOCS 3GTLA 1DFUP 1FEUA 5GLXA 4WFAS 2WB1A 1VHYA 2ZJPS 1FDOA 1FDIA 3ENGA 1BW3A 3HU1A 1E18A 1OA9A 2A6HD 2VUMA 5GAEW 2BH0A 2VPYA 3W2VB 4GA5A 2RD2A 3DMRA 4WF9S 3SUKA 2HCZX 2WAQA 2DMRA 4KDLA 1QTQA 2VPXA 3TM7B 2O5JD 5GM9A 3SUJA 1UHEA 2CW0D 3GTKA 1GTSA 1WC2A 2PJHB 4KDIA 1TWAA 1EU1A 5GLFA 4JCWA 2JA5A 2A69D 5FTJA 2A68D 3X2NA 3X2HA 3GTOA 3QC8A 1PQHA 3O5AA 4JP6A 4GA6A 4E8BA 1EXDA 1IW7D 1WCMA 2V3VA 4IOAS 3HU3A 1UDXA 3X2PA 2E7ZA 2NVXA 5FTMA 2PICA 2YU9A 3M3GA 2YUJA 3GTPA 1N10A 2CX8A 1Y1WA 4AAYA 1SIWA 4V194 1PT1A 3HKZA 1OA7A 5HL7S 1V6ZA 1PQFA 3PIOS 2NWAA 2C45A 2KQAA 3PLXB 3CZBA 3X2GA 3X2LA 1Y1VA 1G8JA 5FTLA 4JP7A 4L48A 3QQ7A 4J3CA 3W2WB 1QRUA 1BW4A 5GLYA 1D6KA 1ZYRD 1YNJD 2EGVA 2Z0YA 1K83A 3CQZA 3KW2A 2NYAA 1QDNA 3CF2A 5EPPA 3AIIA 4CS0A 2R7ZA 4KO8A 5T5ID 3HU2A 5GAHW 1EUYA 1E60A 1DMRA 1KQFA 4UY88 1AW8B 3IR7A 1ZC1A 3QWZA 5C1BA 3IR5A 2R92A 1QRTA 1CZ4A 2AE0X 2G6GA 2JIQA 1VHKA 4L69A 1O0BA 3H0GA 1GTRA 5B6CA 1L8FA 4JJOA 2EEOB 4FERA 1CR5A 4WCES 1DMSA 1OGYA 1R27A 2PMZA 2JIOA 4QIWA 1H0HA 1TMOA 3ML1A 1NYLA 2G5DA 3OUGA 2HZ7A 4JXXA 4CRYG 4DMRA 2BE5D 2JIPA 3IR6A 1I50A 2PNWA 2NVYA 1R7RA 4JS7A 4AYBA 4FFTA 1CZ5A 1UHDA
chains in the Genus database with same CATH topology
1KQGA 1E5VA 1TWGA 2VPWA 3D30A 3SUMA 3X2KA 3GTJA 1VC3B 3X2IA 4KODA 4C2MA 3X2OA 2Y0SA 1PYQA 2PI8A 1HD5A 5FTKA 2JIMA 4ENGA 1TWHA 3FKIA 1QCSA 2R93A 1WLFA 2JA6A 2E2HA 4NOHA 5DYIA 4CRZA 5C18A 4AZDA 3SULA 1PT0A 5T5MD 4FG4A 2A6ED 1SMYD 2JA7A 1G8KA 2V45A 2VPZA 1H5NA 1AA6A 2PJJA 1YLEA 4RV0A 1SFOA 1E61A 1S3SA 5H4UA 1PPYA 3QQ8A 1Y4ZA 4AOKB 1PQEA 2GAEA 1TWCA 1I3QA 2JIRA 2NAPA 2NVYA 1Q16A 5DYGA 4ZM7A 2B63A 3GTGA 3GTQA 4AONB 1TWFA 1PYUB 2KI8A 4KLNA 2IV2X 2ENGA 5FTNA 2E2IA 3X2MA 1Y5IA 4D7ZB 3X2JA 1YNND 1R9TA 3GTMA 4AVRA 4FG2A 3TIWA 1E32A 3GTLA 5GLXA 2WB1A 1FDOA 1BW3A 3ENGA 1FDIA 3HU1A 1E18A 1OA9A 2A6HD 2VUMA 2BH0A 2VPYA 4GA5A 3DMRA 3SUKA 2HCZX 2WAQA 2DMRA 4KDLA 2VPXA 3TM7B 2O5JD 5GM9A 3SUJA 1UHEA 2CW0D 3GTKA 1WC2A 2PJHB 4KDIA 1TWAA 1EU1A 5GLFA 4JCWA 2JA5A 2A69D 3X2NA 2A68D 5FTJA 3X2HA 3GTOA 3QC8A 1PQHA 4JP6A 3O5AA 4GA6A 1IW7D 1WCMA 2V3VA 3HU3A 3X2PA 2E7ZA 2NVXA 5FTMA 2PICA 2YU9A 3M3GA 2YUJA 3GTPA 1N10A 1Y1WA 4AAYA 1SIWA 1PT1A 3HKZA 1OA7A 1PQFA 3X2GA 2KQAA 2C45A 3CZBA 3PLXB 3X2LA 1G8JA 1Y1VA 5FTLA 4JP7A 4L48A 3QQ7A 1BW4A 5GLYA 1ZYRD 1YNJD 1K83A 3CQZA 2NYAA 1QDNA 3CF2A 5EPPA 4CS0A 2R7ZA 4KO8A 5T5ID 3HU2A 1E60A 1DMRA 1KQFA 1AW8B 3IR7A 1ZC1A 3QWZA 5C1BA 3IR5A 2R92A 1CZ4A 2AE0X 2G6GA 2JIQA 3H0GA 5B6CA 1L8FA 4JJOA 2EEOB 1CR5A 1DMSA 1OGYA 1R27A 2PMZA 2JIOA 4QIWA 1H0HA 1TMOA 3ML1A 2G5DA 3OUGA 4CRYG 4DMRA 2BE5D 2JIPA 3IR6A 1I50A 2PNWA 4FERA 1R7RA 4JS7A 4AYBA 4FFTA 1CZ5A 1UHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L48 A;  5H4U A;  5GM9 A;  3SUJ A;  1BW4 A;  5GLY A;  2GAE A;  3D30 A;  3SUM A;  1WC2 A;  3X2K A;  3X2I A;  3X2O A;  4ZM7 A;  4JCW A;  2PI8 A;  1HD5 A;  3X2N A;  3X2H A;  4JP6 A;  2ENG A;  4ENG A;  3X2M A;  3X2J A;  3X2P A;  2AE0 X;  2G6G A;  4AVR A;  2PIC A;  4FG2 A;  3SUL A;  3M3G A;  1L8F A;  1N10 A;  4JJO A;  4FG4 A;  4FER A;  5GLX A;  1BW3 A;  3ENG A;  1OA7 A;  2G5D A;  1OA9 A;  2HCZ X;  2BH0 A;  2PJJ A;  2PNW A;  2KQA A;  3SUK A;  3CZB A;  3X2G A;  3X2L A;  4JS7 A;  4FFT A;  4JP7 A; 
#chains in the Genus database with same CATH topology
 1KQG A;  1E5V A;  1TWG A;  2VPW A;  3D30 A;  3SUM A;  3X2K A;  3GTJ A;  1QRS A;  1VC3 B;  4KOD A;  3X2I A;  4C2M A;  4U67 S;  3X2O A;  2Y0S A;  1PYQ A;  5GAG W;  2PI8 A;  1HD5 A;  5FTK A;  1Z85 A;  4H4K A;  2ZJQ S;  2RE8 A;  1O0C A;  2JIM A;  4ENG A;  1TWH A;  3FKI A;  1QCS A;  2R93 A;  1WLF A;  2JA6 A;  2E2H A;  4NOH A;  5DYI A;  4CRZ A;  5C18 A;  4AZD A;  3SUL A;  3PIP S;  1PT0 A;  5T5M D;  5BNZ A;  4H3S A;  2A6E D;  4FG4 A;  5JVG S;  1SMY D;  5DM6 S;  2JA7 A;  1G8K A;  2V45 A;  2VPZ A;  1H5N A;  1AA6 A;  1YLE A;  2PJJ A;  5DM7 S;  4RV0 A;  5GAD W;  1SFO A;  1E61 A;  4WFB S;  4JXZ A;  1S3S A;  1EUQ A;  5IZN A;  1PPY A;  5H4U A;  3QQ8 A;  1Y4Z A;  4AOK B;  1PQE A;  3CF5 S;  2GAE A;  1B75 A;  1TWC A;  1I3Q A;  3X1L B;  2JIR A;  2NAP A;  5JVH S;  1Q16 A;  5DYG A;  1NXZ A;  4JYZ A;  4ZM7 A;  2B63 A;  2ZJR S;  3GTG A;  3GTQ A;  4AON B;  1TWF A;  1PYU B;  2KI8 A;  4KLN A;  2IV2 X;  2ENG A;  5FTN A;  2E2I A;  3X2M A;  1Y5I A;  1ZJW A;  4D7Z B;  1YNN D;  3X2J A;  1R9T A;  3GTM A;  4AVR A;  2EGW A;  4WFN S;  3J7Z V;  3DLL S;  4FG2 A;  3TIW A;  1E32 A;  4P2B A;  4IO9 S;  4IOC S;  3GTL A;  1DFU P;  1FEU A;  5GLX A;  4WFA S;  2WB1 A;  1VHY A;  2ZJP S;  1FDO A;  1FDI A;  3ENG A;  1BW3 A;  3HU1 A;  1E18 A;  1OA9 A;  2A6H D;  2VUM A;  5GAE W;  2BH0 A;  2VPY A;  3W2V B;  4GA5 A;  2RD2 A;  3DMR A;  4WF9 S;  3SUK A;  2HCZ X;  2WAQ A;  2DMR A;  4KDL A;  1QTQ A;  2VPX A;  3TM7 B;  2O5J D;  5GM9 A;  3SUJ A;  1UHE A;  2CW0 D;  3GTK A;  1GTS A;  1WC2 A;  2PJH B;  4KDI A;  1TWA A;  1EU1 A;  5GLF A;  4JCW A;  2JA5 A;  2A69 D;  5FTJ A;  2A68 D;  3X2N A;  3X2H A;  3GTO A;  3QC8 A;  1PQH A;  3O5A A;  4JP6 A;  4GA6 A;  4E8B A;  1EXD A;  1IW7 D;  1WCM A;  2V3V A;  4IOA S;  3HU3 A;  1UDX A;  3X2P A;  2E7Z A;  2NVX A;  5FTM A;  2PIC A;  2YU9 A;  3M3G A;  2YUJ A;  3GTP A;  1N10 A;  2CX8 A;  1Y1W A;  4AAY A;  1SIW A;  4V19 4;  1PT1 A;  3HKZ A;  1OA7 A;  5HL7 S;  1V6Z A;  1PQF A;  3PIO S;  2NWA A;  2C45 A;  2KQA A;  3PLX B;  3CZB A;  3X2G A;  3X2L A;  1Y1V A;  1G8J A;  5FTL A;  4JP7 A;  4L48 A;  3QQ7 A;  4J3C A;  3W2W B;  1QRU A;  1BW4 A;  5GLY A;  1D6K A;  1ZYR D;  1YNJ D;  2EGV A;  2Z0Y A;  1K83 A;  3CQZ A;  3KW2 A;  2NYA A;  1QDN A;  3CF2 A;  5EPP A;  3AII A;  4CS0 A;  2R7Z A;  4KO8 A;  5T5I D;  3HU2 A;  5GAH W;  1EUY A;  1E60 A;  1DMR A;  1KQF A;  4UY8 8;  1AW8 B;  3IR7 A;  1ZC1 A;  3QWZ A;  5C1B A;  3IR5 A;  2R92 A;  1QRT A;  1CZ4 A;  2AE0 X;  2G6G A;  2JIQ A;  1VHK A;  4L69 A;  1O0B A;  3H0G A;  1GTR A;  5B6C A;  1L8F A;  4JJO A;  2EEO B;  4FER A;  1CR5 A;  4WCE S;  1DMS A;  1OGY A;  1R27 A;  2PMZ A;  2JIO A;  4QIW A;  1H0H A;  1TMO A;  3ML1 A;  1NYL A;  2G5D A;  3OUG A;  2HZ7 A;  4JXX A;  4CRY G;  4DMR A;  2BE5 D;  2JIP A;  3IR6 A;  1I50 A;  2PNW A;  2NVY A;  1R7R A;  4JS7 A;  4AYB A;  4FFT A;  1CZ5 A;  1UHD A; 
#chains in the Genus database with same CATH homology
 1KQG A;  1E5V A;  1TWG A;  2VPW A;  3D30 A;  3SUM A;  3X2K A;  3GTJ A;  1VC3 B;  3X2I A;  4KOD A;  4C2M A;  3X2O A;  2Y0S A;  1PYQ A;  2PI8 A;  1HD5 A;  5FTK A;  2JIM A;  4ENG A;  1TWH A;  3FKI A;  1QCS A;  2R93 A;  1WLF A;  2JA6 A;  2E2H A;  4NOH A;  5DYI A;  4CRZ A;  5C18 A;  4AZD A;  3SUL A;  1PT0 A;  5T5M D;  4FG4 A;  2A6E D;  1SMY D;  2JA7 A;  1G8K A;  2V45 A;  2VPZ A;  1H5N A;  1AA6 A;  2PJJ A;  1YLE A;  4RV0 A;  1SFO A;  1E61 A;  1S3S A;  5H4U A;  1PPY A;  3QQ8 A;  1Y4Z A;  4AOK B;  1PQE A;  2GAE A;  1TWC A;  1I3Q A;  2JIR A;  2NAP A;  2NVY A;  1Q16 A;  5DYG A;  4ZM7 A;  2B63 A;  3GTG A;  3GTQ A;  4AON B;  1TWF A;  1PYU B;  2KI8 A;  4KLN A;  2IV2 X;  2ENG A;  5FTN A;  2E2I A;  3X2M A;  1Y5I A;  4D7Z B;  3X2J A;  1YNN D;  1R9T A;  3GTM A;  4AVR A;  4FG2 A;  3TIW A;  1E32 A;  3GTL A;  5GLX A;  2WB1 A;  1FDO A;  1BW3 A;  3ENG A;  1FDI A;  3HU1 A;  1E18 A;  1OA9 A;  2A6H D;  2VUM A;  2BH0 A;  2VPY A;  4GA5 A;  3DMR A;  3SUK A;  2HCZ X;  2WAQ A;  2DMR A;  4KDL A;  2VPX A;  3TM7 B;  2O5J D;  5GM9 A;  3SUJ A;  1UHE A;  2CW0 D;  3GTK A;  1WC2 A;  2PJH B;  4KDI A;  1TWA A;  1EU1 A;  5GLF A;  4JCW A;  2JA5 A;  2A69 D;  3X2N A;  2A68 D;  5FTJ A;  3X2H A;  3GTO A;  3QC8 A;  1PQH A;  4JP6 A;  3O5A A;  4GA6 A;  1IW7 D;  1WCM A;  2V3V A;  3HU3 A;  3X2P A;  2E7Z A;  2NVX A;  5FTM A;  2PIC A;  2YU9 A;  3M3G A;  2YUJ A;  3GTP A;  1N10 A;  1Y1W A;  4AAY A;  1SIW A;  1PT1 A;  3HKZ A;  1OA7 A;  1PQF A;  3X2G A;  2KQA A;  2C45 A;  3CZB A;  3PLX B;  3X2L A;  1G8J A;  1Y1V A;  5FTL A;  4JP7 A;  4L48 A;  3QQ7 A;  1BW4 A;  5GLY A;  1ZYR D;  1YNJ D;  1K83 A;  3CQZ A;  2NYA A;  1QDN A;  3CF2 A;  5EPP A;  4CS0 A;  2R7Z A;  4KO8 A;  5T5I D;  3HU2 A;  1E60 A;  1DMR A;  1KQF A;  1AW8 B;  3IR7 A;  1ZC1 A;  3QWZ A;  5C1B A;  3IR5 A;  2R92 A;  1CZ4 A;  2AE0 X;  2G6G A;  2JIQ A;  3H0G A;  5B6C A;  1L8F A;  4JJO A;  2EEO B;  1CR5 A;  1DMS A;  1OGY A;  1R27 A;  2PMZ A;  2JIO A;  4QIW A;  1H0H A;  1TMO A;  3ML1 A;  2G5D A;  3OUG A;  4CRY G;  4DMR A;  2BE5 D;  2JIP A;  3IR6 A;  1I50 A;  2PNW A;  4FER A;  1R7R A;  4JS7 A;  4AYB A;  4FFT A;  1CZ5 A;  1UHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...