4IOCS

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4iocS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4iocS02
2ZJRS 1FEUA 1O0BA 1EXDA 4WF9S 4H3SA 4JXZA 3AIIA 4JYZA 3J7ZV 1QRSA 4IOCS 4UY88 2ZJQS 2RE8A 5GAHW 1EUQA 5DM6S 2RD2A 5JVHS 4IO9S 2HZ7A 5HL7S 4WFNS 1O0CA 5GAGW 4JXXA 1GTSA 5GADW 1EUYA 5DM7S 4WCES 2ZJPS 1NYLA 1GTRA 1DFUP 4IOAS 4WFBS 1B75A 3CF5S 4WFAS 1D6KA 3PIOS 3DLLS 5JVGS 4P2BA 1QRTA 1QTQA 1QRUA 5IZNA 5BNZA 3PIPS 5GAEW 1ZJWA 4U67S
chains in the Genus database with same CATH superfamily
2PA8D 3WODA 5D4DA 4LLGA 4OIRA 1EXDA 4QIWD 3GTJC 4H3SA 2A6HA 4YG2A 4XSZA 4YFXA 3J7ZV 4JK1A 5IYCC 4XLPA 3GTGC 3S15C 4A3LC 1NXZA 5GAHW 2R93C 5DM6S 4A3MC 5C4XC 2A6EA 2PNWA 4NOIA 3S2DC 3KW2A 4JXXA 2A69A 5DM7S 2L3UA 1TWGC 4OIOA 3S1RC 4G7ZA 4A3FC 4A3IC 2KQ1A 4C3HC 4MEXA 2G6GA 1TWCC 1D6KA 2JA8C 4V194 2Z0YA 3PIOS 2G5DA 1Z85A 3DLLS 3I4NC 4A3JC 4P2BA 1QRTA 1V6ZA 5C4JC 1SFOC 1QTQA 4Q5SA 5IZNA 1YNJA 1ZYRA 2BE5A 3PO2C 4A3BC 3EQLA 3RZOC 4H4KA 4JXZA 3AIIA 1I3QC 3M3YC 4IOCS 2PJJA 2ZJQS 4YFNA 1EUQA 5JVHS 3M4OC 1HQMA 2NVTC 3LYWA 1VHYA 1O0CA 1Y1VC 5FLMC 4YFKA 3HOVC 2NVQC 4WFBS 2AE0X 1B75A 4KN7A 3S14C 4G7HA 4BXXC 2NWAA 5TMCA 2PMZD 1I6HC 4X6AC 3HOUC 3HOZC 3S1QC 4MEYA 5IYDC 2GAEA 4A3GC 4OIQA 1I6VA 2R7ZC 3S2HC 1TWFC 1WCMC 5BNZA 3S17C 3CQZC 4A93C 4A3KC 3CZBA 4JYZA 2E2JC 1TWAC 1QRSA 1VHKA 1K83C 4BY1C 2E2IC 4UY88 2JA6C 4J3CA 1BDFA 2O5IA 1IW7A 2EGVA 2NVXC 5IP7C 2WB1D 3X1LB 5HL7S 4WFNS 1TWHC 5TMFA 4Y7NC 1GTSA 3H0GC 5GADW 1UDXA 1EUYA 3HKZD 4OINA 2JA5C 4L69A 1DFUP 4AYBD 4C3JC 2VUMC 3S1MC 4GZYA 5C44C 2NVYC 3DXJA 4KMUA 3K7AC 4QJVA 4C3IC 3CF5S 4BY7C 3HOXC 4XSXA 2KXYA 5JVGS 5IP9C 3S16C 1QRUA 3GTQC 4G7OA 3PIPS 1YNNA 3S1NC 2O5JA 4U67S 2ZJRS 1FEUA 2L5NA 4C2MC 2PPBA 3H3VD 1O0BA 1R9TC 4WF9S 2CW0A 2Y0SD 4Y52C 4ZH4A 2RE8A 2RD2A 4BBRC 2A68A 2JA7C 3RZDC 1Y1WC 4IO9S 2HZ7A 4XLNA 3HOYC 4A3CC 5GAGW 3FKIC 4KN4A 5C3EC 2E2HC 3GTMC 4MQ9A 2WAQD 3W2VB 4WCES 1NYLA 2ZJPS 1GTRA 4A3EC 4IOAS 1SMYA 3GTKC 5HQHA 3GTOC 3W2WB 3HOWC 2KPUA 4BBSC 4LK0A 4LJZA 4OIPA 4LK1A 3GTLC 4WFAS 2EGWA 2YU9C 3PO3C 5IYBC 2B63C 4A3DC 2CX8A 2PI8A 2PICA 4Q4ZA 2R92C 3GTPC 3I4MC 4E8BA 1ZJWA 1I50C 5GAEW
chains in the Genus database with same CATH topology
2ZJRS 1FEUA 1O0BA 1EXDA 4WF9S 4H4KA 4H3SA 4JXZA 3AIIA 4JYZA 3J7ZV 1QRSA 4IOCS 4UY88 2ZJQS 2RE8A 5GAHW 1EUQA 5DM6S 2RD2A 5JVHS 4IO9S 2HZ7A 5HL7S 4WFNS 1O0CA 3X1LB 5GAGW 4JXXA 1GTSA 5GADW 1UDXA 5DM7S 1EUYA 3W2VB 4WCES 1NYLA 2ZJPS 1GTRA 1DFUP 4IOAS 4WFBS 3W2WB 1B75A 3CF5S 4WFAS 1D6KA 4V194 3PIOS 3DLLS 5JVGS 4P2BA 1QRTA 1QTQA 1QRUA 5IZNA 5BNZA 3PIPS 5GAEW 1ZJWA 4U67S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJR S;  1FEU A;  1O0B A;  1EXD A;  4WF9 S;  4H3S A;  4JXZ A;  3AII A;  4JYZ A;  3J7Z V;  1QRS A;  4IOC S;  4UY8 8;  2ZJQ S;  2RE8 A;  5GAH W;  1EUQ A;  5DM6 S;  2RD2 A;  5JVH S;  4IO9 S;  2HZ7 A;  5HL7 S;  4WFN S;  1O0C A;  5GAG W;  4JXX A;  1GTS A;  5GAD W;  1EUY A;  5DM7 S;  4WCE S;  2ZJP S;  1NYL A;  1GTR A;  1DFU P;  4IOA S;  4WFB S;  1B75 A;  3CF5 S;  4WFA S;  1D6K A;  3PIO S;  3DLL S;  5JVG S;  4P2B A;  1QRT A;  1QTQ A;  1QRU A;  5IZN A;  5BNZ A;  3PIP S;  5GAE W;  1ZJW A;  4U67 S; 
#chains in the Genus database with same CATH topology
 2PA8 D;  3WOD A;  5D4D A;  4LLG A;  4OIR A;  1EXD A;  4QIW D;  3GTJ C;  4H3S A;  2A6H A;  4YG2 A;  4XSZ A;  4YFX A;  3J7Z V;  4JK1 A;  5IYC C;  4XLP A;  3GTG C;  3S15 C;  4A3L C;  1NXZ A;  5GAH W;  2R93 C;  5DM6 S;  4A3M C;  5C4X C;  2A6E A;  2PNW A;  4NOI A;  3S2D C;  3KW2 A;  4JXX A;  2A69 A;  5DM7 S;  2L3U A;  1TWG C;  4OIO A;  3S1R C;  4G7Z A;  4A3F C;  4A3I C;  2KQ1 A;  4C3H C;  4MEX A;  2G6G A;  1TWC C;  1D6K A;  2JA8 C;  4V19 4;  2Z0Y A;  3PIO S;  2G5D A;  1Z85 A;  3DLL S;  3I4N C;  4A3J C;  4P2B A;  1QRT A;  1V6Z A;  5C4J C;  1SFO C;  1QTQ A;  4Q5S A;  5IZN A;  1YNJ A;  1ZYR A;  2BE5 A;  3PO2 C;  4A3B C;  3EQL A;  3RZO C;  4H4K A;  4JXZ A;  3AII A;  1I3Q C;  3M3Y C;  4IOC S;  2PJJ A;  2ZJQ S;  4YFN A;  1EUQ A;  5JVH S;  3M4O C;  1HQM A;  2NVT C;  3LYW A;  1VHY A;  1O0C A;  1Y1V C;  5FLM C;  4YFK A;  3HOV C;  2NVQ C;  4WFB S;  2AE0 X;  1B75 A;  4KN7 A;  3S14 C;  4G7H A;  4BXX C;  2NWA A;  5TMC A;  2PMZ D;  1I6H C;  4X6A C;  3HOU C;  3HOZ C;  3S1Q C;  4MEY A;  5IYD C;  2GAE A;  4A3G C;  4OIQ A;  1I6V A;  2R7Z C;  3S2H C;  1TWF C;  1WCM C;  5BNZ A;  3S17 C;  3CQZ C;  4A93 C;  4A3K C;  3CZB A;  4JYZ A;  2E2J C;  1TWA C;  1QRS A;  1VHK A;  1K83 C;  4BY1 C;  2E2I C;  4UY8 8;  2JA6 C;  4J3C A;  1BDF A;  2O5I A;  1IW7 A;  2EGV A;  2NVX C;  5IP7 C;  2WB1 D;  3X1L B;  5HL7 S;  4WFN S;  1TWH C;  5TMF A;  4Y7N C;  1GTS A;  3H0G C;  5GAD W;  1UDX A;  1EUY A;  3HKZ D;  4OIN A;  2JA5 C;  4L69 A;  1DFU P;  4AYB D;  4C3J C;  2VUM C;  3S1M C;  4GZY A;  5C44 C;  2NVY C;  3DXJ A;  4KMU A;  3K7A C;  4QJV A;  4C3I C;  3CF5 S;  4BY7 C;  3HOX C;  4XSX A;  2KXY A;  5JVG S;  5IP9 C;  3S16 C;  1QRU A;  3GTQ C;  4G7O A;  3PIP S;  1YNN A;  3S1N C;  2O5J A;  4U67 S;  2ZJR S;  1FEU A;  2L5N A;  4C2M C;  2PPB A;  3H3V D;  1O0B A;  1R9T C;  4WF9 S;  2CW0 A;  2Y0S D;  4Y52 C;  4ZH4 A;  2RE8 A;  2RD2 A;  4BBR C;  2A68 A;  2JA7 C;  3RZD C;  1Y1W C;  4IO9 S;  2HZ7 A;  4XLN A;  3HOY C;  4A3C C;  5GAG W;  3FKI C;  4KN4 A;  5C3E C;  2E2H C;  3GTM C;  4MQ9 A;  2WAQ D;  3W2V B;  4WCE S;  1NYL A;  2ZJP S;  1GTR A;  4A3E C;  4IOA S;  1SMY A;  3GTK C;  5HQH A;  3GTO C;  3W2W B;  3HOW C;  2KPU A;  4BBS C;  4LK0 A;  4LJZ A;  4OIP A;  4LK1 A;  3GTL C;  4WFA S;  2EGW A;  2YU9 C;  3PO3 C;  5IYB C;  2B63 C;  4A3D C;  2CX8 A;  2PI8 A;  2PIC A;  4Q4Z A;  2R92 C;  3GTP C;  3I4M C;  4E8B A;  1ZJW A;  1I50 C;  5GAE W; 
#chains in the Genus database with same CATH homology
 2ZJR S;  1FEU A;  1O0B A;  1EXD A;  4WF9 S;  4H4K A;  4H3S A;  4JXZ A;  3AII A;  4JYZ A;  3J7Z V;  1QRS A;  4IOC S;  4UY8 8;  2ZJQ S;  2RE8 A;  5GAH W;  1EUQ A;  5DM6 S;  2RD2 A;  5JVH S;  4IO9 S;  2HZ7 A;  5HL7 S;  4WFN S;  1O0C A;  3X1L B;  5GAG W;  4JXX A;  1GTS A;  5GAD W;  1UDX A;  5DM7 S;  1EUY A;  3W2V B;  4WCE S;  1NYL A;  2ZJP S;  1GTR A;  1DFU P;  4IOA S;  4WFB S;  3W2W B;  1B75 A;  3CF5 S;  4WFA S;  1D6K A;  4V19 4;  3PIO S;  3DLL S;  5JVG S;  4P2B A;  1QRT A;  1QTQ A;  1QRU A;  5IZN A;  5BNZ A;  3PIP S;  5GAE W;  1ZJW A;  4U67 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...