4IOCS

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4iocS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4iocS02
4IOAS 3DLLS 4U67S 2RE8A 4IO9S 1GTSA 1EUQA 4WF9S 1QRSA 4JXZA 5JVGS 2ZJQS 4H3SA 4JXXA 1O0BA 3PIOS 3AIIA 1DFUP 4WCES 1O0CA 3CF5S 5GAGW 3PIPS 1ZJWA 5BNZA 4JYZA 1EXDA 4IOCS 5GAHW 4P2BA 1QTQA 2RD2A 5DM7S 4WFNS 2ZJPS 4UY88 1EUYA 1FEUA 2ZJRS 4WFAS 5HL7S 1D6KA 1GTRA 5GADW 5DM6S 1QRUA 2HZ7A 1NYLA 3J7ZV 5IZNA 5GAEW 1B75A 1QRTA 4WFBS 5JVHS
chains in the Genus database with same CATH superfamily
4A3DC 2YU9C 3DLLS 2NWAA 4A3BC 4WF9S 5IYCC 2E2JC 5JVGS 3KW2A 2CW0A 4A3MC 4NOIA 4A93C 1TWFC 2JA6C 3PO3C 2O5JA 2L5NA 3CZBA 2KQ1A 4WCES 3W2VB 4BBRC 2GAEA 4A3FC 4MEXA 2PNWA 2EGVA 1TWGC 4KN4A 3S1QC 4G7ZA 3FKIC 4OIPA 4C3IC 1V6ZA 1NXZA 3H3VD 4MQ9A 2R92C 4WFNS 4A3JC 4GZYA 4A3GC 3S14C 1FEUA 1Y1WC 5IYBC 2VUMC 4OIOA 3RZOC 1D6KA 1GTRA 5GADW 4QIWD 3S16C 2NVQC 2CX8A 2HZ7A 1YNJA 4AYBD 3S1RC 4QJVA 3I4MC 4BXXC 5GAEW 4X6AC 2Z0YA 5C44C 4IO9S 5JVHS 1R9TC 1Y1VC 2A68A 5C4XC 1GTSA 1EUQA 4ZH4A 3HOXC 3GTMC 2PMZD 4H3SA 2JA7C 1O0BA 3PIOS 4C3HC 4YFKA 1TWHC 4OIRA 1SMYA 3I4NC 2R93C 3PIPS 3S2HC 5BNZA 4JYZA 4KMUA 1VHYA 1YNNA 5GAHW 1WCMC 4XSXA 3S1MC 2JA8C 5C4JC 3PO2C 4XLPA 3HOYC 4P2BA 4A3CC 1SFOC 2RD2A 2ZJPS 3S2DC 1TWAC 1EUYA 2PA8D 2AE0X 2E2IC 3HOUC 2PPBA 5IYDC 3X1LB 4LLGA 1NYLA 4A3IC 4BBSC 4LK0A 3WODA 3J7ZV 5IZNA 1K83C 5HQHA 3GTOC 1I50C 2R7ZC 2EGWA 2NVYC 4U67S 4A3LC 5C3EC 2WAQD 3LYWA 3M4OC 4JXXA 2PJJA 4Q4ZA 5FLMC 3GTKC 3GTPC 4KN7A 2KPUA 3EQLA 3AIIA 4BY1C 1VHKA 3CF5S 5GAGW 3RZDC 3HOZC 4C2MC 2PICA 1I6VA 4G7OA 1QTQA 5TMFA 2O5IA 3S1NC 3DXJA 4UY88 5HL7S 1BDFA 2JA5C 4OIQA 3M3YC 3H0GC 4LJZA 2E2HC 4V194 3GTLC 3GTQC 3GTJC 2B63C 5DM6S 1QRUA 3HKZD 4JK1A 4MEYA 4LK1A 4A3KC 2KXYA 3GTGC 1I6HC 4Y52C 5IP9C 4BY7C 2A6HA 4WFBS 2WB1D 2NVXC 4IOAS 2RE8A 4YFXA 4XLNA 4Q5SA 1QRSA 4JXZA 4E8BA 2ZJQS 1Z85A 4A3EC 4YG2A 1UDXA 3HOVC 4H4KA 2NVTC 1O0CA 2G5DA 1ZJWA 1EXDA 4G7HA 4J3CA 4IOCS 1IW7A 4XSZA 5DM7S 1HQMA 5IP7C 2ZJRS 4WFAS 2A69A 5D4DA 3K7AC 4C3JC 2PI8A 4OINA 4L69A 2G6GA 3W2WB 1TWCC 3CQZC 3S15C 3S17C 3HOWC 2BE5A 5TMCA 4Y7NC 4YFNA 2L3UA 1ZYRA 2A6EA 1B75A 1QRTA 1I3QC 2Y0SD 1DFUP
chains in the Genus database with same CATH topology
4IOAS 3DLLS 4U67S 2RE8A 4IO9S 1GTSA 1EUQA 4WF9S 1QRSA 4JXZA 5JVGS 2ZJQS 4H3SA 4JXXA 1O0BA 3PIOS 3AIIA 1DFUP 1UDXA 3W2VB 4WCES 4H4KA 1O0CA 3CF5S 5GAGW 3PIPS 1ZJWA 5BNZA 4JYZA 1EXDA 4IOCS 5GAHW 4P2BA 1QTQA 2RD2A 5DM7S 4WFNS 2ZJPS 4UY88 1EUYA 1FEUA 2ZJRS 4WFAS 5HL7S 3W2WB 1D6KA 1GTRA 4V194 5GADW 5DM6S 1QRUA 2HZ7A 3X1LB 1NYLA 3J7ZV 5IZNA 5GAEW 1B75A 1QRTA 4WFBS 5JVHS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOA S;  3DLL S;  4U67 S;  2RE8 A;  4IO9 S;  1GTS A;  1EUQ A;  4WF9 S;  1QRS A;  4JXZ A;  5JVG S;  2ZJQ S;  4H3S A;  4JXX A;  1O0B A;  3PIO S;  3AII A;  1DFU P;  4WCE S;  1O0C A;  3CF5 S;  5GAG W;  3PIP S;  1ZJW A;  5BNZ A;  4JYZ A;  1EXD A;  4IOC S;  5GAH W;  4P2B A;  1QTQ A;  2RD2 A;  5DM7 S;  4WFN S;  2ZJP S;  4UY8 8;  1EUY A;  1FEU A;  2ZJR S;  4WFA S;  5HL7 S;  1D6K A;  1GTR A;  5GAD W;  5DM6 S;  1QRU A;  2HZ7 A;  1NYL A;  3J7Z V;  5IZN A;  5GAE W;  1B75 A;  1QRT A;  4WFB S;  5JVH S; 
#chains in the Genus database with same CATH topology
 4A3D C;  2YU9 C;  3DLL S;  2NWA A;  4A3B C;  4WF9 S;  5IYC C;  2E2J C;  5JVG S;  3KW2 A;  2CW0 A;  4A3M C;  4NOI A;  4A93 C;  1TWF C;  2JA6 C;  3PO3 C;  2O5J A;  2L5N A;  3CZB A;  2KQ1 A;  4WCE S;  3W2V B;  4BBR C;  2GAE A;  4A3F C;  4MEX A;  2PNW A;  2EGV A;  1TWG C;  4KN4 A;  3S1Q C;  4G7Z A;  3FKI C;  4OIP A;  4C3I C;  1V6Z A;  1NXZ A;  3H3V D;  4MQ9 A;  2R92 C;  4WFN S;  4A3J C;  4GZY A;  4A3G C;  3S14 C;  1FEU A;  1Y1W C;  5IYB C;  2VUM C;  4OIO A;  3RZO C;  1D6K A;  1GTR A;  5GAD W;  4QIW D;  3S16 C;  2NVQ C;  2CX8 A;  2HZ7 A;  1YNJ A;  4AYB D;  3S1R C;  4QJV A;  3I4M C;  4BXX C;  5GAE W;  4X6A C;  2Z0Y A;  5C44 C;  4IO9 S;  5JVH S;  1R9T C;  1Y1V C;  2A68 A;  5C4X C;  1GTS A;  1EUQ A;  4ZH4 A;  3HOX C;  3GTM C;  2PMZ D;  4H3S A;  2JA7 C;  1O0B A;  3PIO S;  4C3H C;  4YFK A;  1TWH C;  4OIR A;  1SMY A;  3I4N C;  2R93 C;  3PIP S;  3S2H C;  5BNZ A;  4JYZ A;  4KMU A;  1VHY A;  1YNN A;  5GAH W;  1WCM C;  4XSX A;  3S1M C;  2JA8 C;  5C4J C;  3PO2 C;  4XLP A;  3HOY C;  4P2B A;  4A3C C;  1SFO C;  2RD2 A;  2ZJP S;  3S2D C;  1TWA C;  1EUY A;  2PA8 D;  2AE0 X;  2E2I C;  3HOU C;  2PPB A;  5IYD C;  3X1L B;  4LLG A;  1NYL A;  4A3I C;  4BBS C;  4LK0 A;  3WOD A;  3J7Z V;  5IZN A;  1K83 C;  5HQH A;  3GTO C;  1I50 C;  2R7Z C;  2EGW A;  2NVY C;  4U67 S;  4A3L C;  5C3E C;  2WAQ D;  3LYW A;  3M4O C;  4JXX A;  2PJJ A;  4Q4Z A;  5FLM C;  3GTK C;  3GTP C;  4KN7 A;  2KPU A;  3EQL A;  3AII A;  4BY1 C;  1VHK A;  3CF5 S;  5GAG W;  3RZD C;  3HOZ C;  4C2M C;  2PIC A;  1I6V A;  4G7O A;  1QTQ A;  5TMF A;  2O5I A;  3S1N C;  3DXJ A;  4UY8 8;  5HL7 S;  1BDF A;  2JA5 C;  4OIQ A;  3M3Y C;  3H0G C;  4LJZ A;  2E2H C;  4V19 4;  3GTL C;  3GTQ C;  3GTJ C;  2B63 C;  5DM6 S;  1QRU A;  3HKZ D;  4JK1 A;  4MEY A;  4LK1 A;  4A3K C;  2KXY A;  3GTG C;  1I6H C;  4Y52 C;  5IP9 C;  4BY7 C;  2A6H A;  4WFB S;  2WB1 D;  2NVX C;  4IOA S;  2RE8 A;  4YFX A;  4XLN A;  4Q5S A;  1QRS A;  4JXZ A;  4E8B A;  2ZJQ S;  1Z85 A;  4A3E C;  4YG2 A;  1UDX A;  3HOV C;  4H4K A;  2NVT C;  1O0C A;  2G5D A;  1ZJW A;  1EXD A;  4G7H A;  4J3C A;  4IOC S;  1IW7 A;  4XSZ A;  5DM7 S;  1HQM A;  5IP7 C;  2ZJR S;  4WFA S;  2A69 A;  5D4D A;  3K7A C;  4C3J C;  2PI8 A;  4OIN A;  4L69 A;  2G6G A;  3W2W B;  1TWC C;  3CQZ C;  3S15 C;  3S17 C;  3HOW C;  2BE5 A;  5TMC A;  4Y7N C;  4YFN A;  2L3U A;  1ZYR A;  2A6E A;  1B75 A;  1QRT A;  1I3Q C;  2Y0S D;  1DFU P; 
#chains in the Genus database with same CATH homology
 4IOA S;  3DLL S;  4U67 S;  2RE8 A;  4IO9 S;  1GTS A;  1EUQ A;  4WF9 S;  1QRS A;  4JXZ A;  5JVG S;  2ZJQ S;  4H3S A;  4JXX A;  1O0B A;  3PIO S;  3AII A;  1DFU P;  1UDX A;  3W2V B;  4WCE S;  4H4K A;  1O0C A;  3CF5 S;  5GAG W;  3PIP S;  1ZJW A;  5BNZ A;  4JYZ A;  1EXD A;  4IOC S;  5GAH W;  4P2B A;  1QTQ A;  2RD2 A;  5DM7 S;  4WFN S;  2ZJP S;  4UY8 8;  1EUY A;  1FEU A;  2ZJR S;  4WFA S;  5HL7 S;  3W2W B;  1D6K A;  1GTR A;  4V19 4;  5GAD W;  5DM6 S;  1QRU A;  2HZ7 A;  3X1L B;  1NYL A;  3J7Z V;  5IZN A;  5GAE W;  1B75 A;  1QRT A;  4WFB S;  5JVH S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...