4IOCS

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4iocS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4iocS02
4WCES 2RE8A 1GTSA 1GTRA 1QTQA 2HZ7A 2ZJQS 5BNZA 1B75A 1FEUA 1NYLA 4IOAS 1DFUP 2ZJRS 5DM6S 3PIPS 1EUYA 5JVGS 2ZJPS 1EXDA 5GAHW 1QRSA 1O0BA 5JVHS 4JXXA 4WFBS 1ZJWA 4H3SA 1EUQA 4UY88 3PIOS 4P2BA 5GAEW 5HL7S 3DLLS 4WF9S 4U67S 4WFAS 5GADW 1O0CA 1QRUA 1QRTA 4JXZA 5IZNA 5DM7S 1D6KA 4IOCS 3AIIA 2RD2A 4IO9S 4JYZA 5GAGW 3J7ZV 4WFNS 3CF5S
chains in the Genus database with same CATH superfamily
4WCES 3EQLA 1TWGC 1B75A 5BNZA 4A3GC 4XLNA 3S1RC 4A3BC 5IYCC 4IOAS 2YU9C 1DFUP 3RZDC 3H0GC 1I3QC 4LLGA 3PIPS 1EUYA 5D4DA 5JVGS 2ZJPS 4A3IC 1Y1WC 3GTKC 1TWFC 5GAHW 3HOXC 3HOWC 5JVHS 2CW0A 2JA7C 4E8BA 2EGVA 2NWAA 4JXXA 2L5NA 3WODA 2KXYA 5GAEW 1TWAC 4H4KA 3S1NC 5GADW 1QRUA 5TMFA 4JXZA 5C4XC 3HOYC 1WCMC 4IOCS 2RD2A 3W2VB 4GZYA 4JYZA 1HQMA 5GAGW 1R9TC 2NVTC 3DXJA 2RE8A 3I4NC 1SMYA 2HZ7A 5IYDC 3S16C 1Z85A 4QJVA 2PICA 5HQHA 2KPUA 1NYLA 3S17C 4A3CC 2PJJA 3H3VD 5FLMC 5C4JC 1EXDA 4C3JC 4XSZA 3HOUC 4Y7NC 3S1MC 4XSXA 1O0BA 4OIPA 1NXZA 4G7OA 2NVXC 3S15C 3GTPC 4C3HC 1VHKA 4WFBS 1ZJWA 4H3SA 4MEYA 4MEXA 3PIOS 4P2BA 4V194 2E2HC 2B63C 2VUMC 2JA8C 3DLLS 4A3FC 4BXXC 4WF9S 3LYWA 2PMZD 3PO3C 4WFAS 3W2WB 3GTMC 5IZNA 2G5DA 1D6KA 4BBSC 2O5JA 3K7AC 5IP7C 4X6AC 4A93C 4IO9S 3GTGC 4WFNS 1UDXA 5IYBC 2EGWA 1YNJA 4A3KC 4OIOA 1QTQA 3CZBA 2PI8A 3GTLC 2KQ1A 4OINA 4OIQA 2E2IC 4YFXA 3GTOC 4QIWD 4A3LC 2A69A 2WB1D 1BDFA 4C2MC 4YFKA 3KW2A 3FKIC 3GTJC 4JK1A 4G7HA 4Q5SA 4LK1A 2PA8D 4LK0A 1QRSA 2NVYC 4Q4ZA 2A68A 3M4OC 2Y0SD 1V6ZA 3X1LB 1I50C 1I6VA 1EUQA 2WAQD 4LJZA 4KMUA 4KN7A 3S2DC 2JA6C 4U67S 3I4MC 3CQZC 2AE0X 1ZYRA 3S14C 1IW7A 5DM7S 4YG2A 2JA5C 3AIIA 4A3EC 1K83C 2R7ZC 5IP9C 3HKZD 4AYBD 4Y52C 3CF5S 1VHYA 1GTSA 2A6EA 4ZH4A 4MQ9A 2ZJQS 4BBRC 4YFNA 1FEUA 4L69A 2PNWA 4BY1C 4KN4A 2R92C 3HOZC 1SFOC 3PO2C 2GAEA 2ZJRS 5C44C 5DM6S 3S2HC 4BY7C 2L3UA 4NOIA 1YNNA 2G6GA 3RZOC 4J3CA 2E2JC 2A6HA 2O5IA 2NVQC 3GTQC 4A3DC 2CX8A 4UY88 2PPBA 3M3YC 5HL7S 1Y1VC 2Z0YA 2BE5A 4A3MC 1TWHC 1QRTA 1O0CA 4G7ZA 4C3IC 3HOVC 3S1QC 5C3EC 4OIRA 4A3JC 1I6HC 3J7ZV 1GTRA 5TMCA 2R93C 4XLPA 1TWCC
chains in the Genus database with same CATH topology
4WCES 2RE8A 1GTSA 1GTRA 1QTQA 2HZ7A 2ZJQS 5BNZA 1UDXA 1B75A 1FEUA 1NYLA 4IOAS 1DFUP 2ZJRS 5DM6S 3PIPS 1EUYA 5JVGS 2ZJPS 1EXDA 5GAHW 1QRSA 1O0BA 5JVHS 4JXXA 3X1LB 4WFBS 1ZJWA 4H3SA 1EUQA 4UY88 3PIOS 4P2BA 5GAEW 4V194 5HL7S 3DLLS 4H4KA 4WF9S 4U67S 5GADW 4WFAS 3W2WB 1O0CA 1QRUA 1QRTA 5IZNA 4JXZA 5DM7S 1D6KA 4IOCS 3AIIA 3W2VB 2RD2A 4IO9S 4JYZA 5GAGW 3J7ZV 4WFNS 3CF5S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE S;  2RE8 A;  1GTS A;  1GTR A;  1QTQ A;  2HZ7 A;  2ZJQ S;  5BNZ A;  1B75 A;  1FEU A;  1NYL A;  4IOA S;  1DFU P;  2ZJR S;  5DM6 S;  3PIP S;  1EUY A;  5JVG S;  2ZJP S;  1EXD A;  5GAH W;  1QRS A;  1O0B A;  5JVH S;  4JXX A;  4WFB S;  1ZJW A;  4H3S A;  1EUQ A;  4UY8 8;  3PIO S;  4P2B A;  5GAE W;  5HL7 S;  3DLL S;  4WF9 S;  4U67 S;  4WFA S;  5GAD W;  1O0C A;  1QRU A;  1QRT A;  4JXZ A;  5IZN A;  5DM7 S;  1D6K A;  4IOC S;  3AII A;  2RD2 A;  4IO9 S;  4JYZ A;  5GAG W;  3J7Z V;  4WFN S;  3CF5 S; 
#chains in the Genus database with same CATH topology
 4WCE S;  3EQL A;  1TWG C;  1B75 A;  5BNZ A;  4A3G C;  4XLN A;  3S1R C;  4A3B C;  5IYC C;  4IOA S;  2YU9 C;  1DFU P;  3RZD C;  3H0G C;  1I3Q C;  4LLG A;  3PIP S;  1EUY A;  5D4D A;  5JVG S;  2ZJP S;  4A3I C;  1Y1W C;  3GTK C;  1TWF C;  5GAH W;  3HOX C;  3HOW C;  5JVH S;  2CW0 A;  2JA7 C;  4E8B A;  2EGV A;  2NWA A;  4JXX A;  2L5N A;  3WOD A;  2KXY A;  5GAE W;  1TWA C;  4H4K A;  3S1N C;  5GAD W;  1QRU A;  5TMF A;  4JXZ A;  5C4X C;  3HOY C;  1WCM C;  4IOC S;  2RD2 A;  3W2V B;  4GZY A;  4JYZ A;  1HQM A;  5GAG W;  1R9T C;  2NVT C;  3DXJ A;  2RE8 A;  3I4N C;  1SMY A;  2HZ7 A;  5IYD C;  3S16 C;  1Z85 A;  4QJV A;  2PIC A;  5HQH A;  2KPU A;  1NYL A;  3S17 C;  4A3C C;  2PJJ A;  3H3V D;  5FLM C;  5C4J C;  1EXD A;  4C3J C;  4XSZ A;  3HOU C;  4Y7N C;  3S1M C;  4XSX A;  1O0B A;  4OIP A;  1NXZ A;  4G7O A;  2NVX C;  3S15 C;  3GTP C;  4C3H C;  1VHK A;  4WFB S;  1ZJW A;  4H3S A;  4MEY A;  4MEX A;  3PIO S;  4P2B A;  4V19 4;  2E2H C;  2B63 C;  2VUM C;  2JA8 C;  3DLL S;  4A3F C;  4BXX C;  4WF9 S;  3LYW A;  2PMZ D;  3PO3 C;  4WFA S;  3W2W B;  3GTM C;  5IZN A;  2G5D A;  1D6K A;  4BBS C;  2O5J A;  3K7A C;  5IP7 C;  4X6A C;  4A93 C;  4IO9 S;  3GTG C;  4WFN S;  1UDX A;  5IYB C;  2EGW A;  1YNJ A;  4A3K C;  4OIO A;  1QTQ A;  3CZB A;  2PI8 A;  3GTL C;  2KQ1 A;  4OIN A;  4OIQ A;  2E2I C;  4YFX A;  3GTO C;  4QIW D;  4A3L C;  2A69 A;  2WB1 D;  1BDF A;  4C2M C;  4YFK A;  3KW2 A;  3FKI C;  3GTJ C;  4JK1 A;  4G7H A;  4Q5S A;  4LK1 A;  2PA8 D;  4LK0 A;  1QRS A;  2NVY C;  4Q4Z A;  2A68 A;  3M4O C;  2Y0S D;  1V6Z A;  3X1L B;  1I50 C;  1I6V A;  1EUQ A;  2WAQ D;  4LJZ A;  4KMU A;  4KN7 A;  3S2D C;  2JA6 C;  4U67 S;  3I4M C;  3CQZ C;  2AE0 X;  1ZYR A;  3S14 C;  1IW7 A;  5DM7 S;  4YG2 A;  2JA5 C;  3AII A;  4A3E C;  1K83 C;  2R7Z C;  5IP9 C;  3HKZ D;  4AYB D;  4Y52 C;  3CF5 S;  1VHY A;  1GTS A;  2A6E A;  4ZH4 A;  4MQ9 A;  2ZJQ S;  4BBR C;  4YFN A;  1FEU A;  4L69 A;  2PNW A;  4BY1 C;  4KN4 A;  2R92 C;  3HOZ C;  1SFO C;  3PO2 C;  2GAE A;  2ZJR S;  5C44 C;  5DM6 S;  3S2H C;  4BY7 C;  2L3U A;  4NOI A;  1YNN A;  2G6G A;  3RZO C;  4J3C A;  2E2J C;  2A6H A;  2O5I A;  2NVQ C;  3GTQ C;  4A3D C;  2CX8 A;  4UY8 8;  2PPB A;  3M3Y C;  5HL7 S;  1Y1V C;  2Z0Y A;  2BE5 A;  4A3M C;  1TWH C;  1QRT A;  1O0C A;  4G7Z A;  4C3I C;  3HOV C;  3S1Q C;  5C3E C;  4OIR A;  4A3J C;  1I6H C;  3J7Z V;  1GTR A;  5TMC A;  2R93 C;  4XLP A;  1TWC C; 
#chains in the Genus database with same CATH homology
 4WCE S;  2RE8 A;  1GTS A;  1GTR A;  1QTQ A;  2HZ7 A;  2ZJQ S;  5BNZ A;  1UDX A;  1B75 A;  1FEU A;  1NYL A;  4IOA S;  1DFU P;  2ZJR S;  5DM6 S;  3PIP S;  1EUY A;  5JVG S;  2ZJP S;  1EXD A;  5GAH W;  1QRS A;  1O0B A;  5JVH S;  4JXX A;  3X1L B;  4WFB S;  1ZJW A;  4H3S A;  1EUQ A;  4UY8 8;  3PIO S;  4P2B A;  5GAE W;  4V19 4;  5HL7 S;  3DLL S;  4H4K A;  4WF9 S;  4U67 S;  5GAD W;  4WFA S;  3W2W B;  1O0C A;  1QRU A;  1QRT A;  5IZN A;  4JXZ A;  5DM7 S;  1D6K A;  4IOC S;  3AII A;  3W2V B;  2RD2 A;  4IO9 S;  4JYZ A;  5GAG W;  3J7Z V;  4WFN S;  3CF5 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...