4IOCS

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4iocS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4iocS02
4WFNS 2ZJQS 4IOCS 1EUYA 4WFAS 1FEUA 5JVGS 5IZNA 4IO9S 1DFUP 4UY88 1NYLA 4H3SA 4JXZA 2RE8A 2RD2A 1ZJWA 3CF5S 5BNZA 1O0CA 5JVHS 1QTQA 1EXDA 3DLLS 4P2BA 5GAGW 4WF9S 5GAEW 1EUQA 3PIPS 2ZJRS 1QRSA 5DM7S 5GADW 2HZ7A 3PIOS 4JXXA 3AIIA 1QRTA 4WFBS 1GTSA 1QRUA 1B75A 1D6KA 1O0BA 4U67S 5GAHW 4JYZA 5DM6S 2ZJPS 4IOAS 4WCES 5HL7S 1GTRA 3J7ZV
chains in the Genus database with same CATH superfamily
4YG2A 4IOCS 4MQ9A 1HQMA 3X1LB 4H4KA 5IZNA 3S1QC 4UY88 4C3HC 2VUMC 4Q4ZA 2PICA 3RZOC 2NVXC 3HKZD 5JVHS 4G7ZA 4J3CA 2G6GA 5TMCA 3W2WB 2YU9C 3GTQC 3LYWA 2PMZD 4C3IC 1EUQA 2WAQD 5DM7S 4XSXA 2AE0X 2HZ7A 3HOZC 4L69A 2R7ZC 1TWFC 4BBRC 4A93C 1QRUA 1TWAC 1TWCC 1D6KA 4GZYA 4A3GC 1I6HC 1O0BA 4U67S 2A68A 3S2HC 4A3BC 2ZJPS 4IOAS 5IP7C 3I4MC 3S16C 2KPUA 3S15C 4YFKA 2G5DA 1GTRA 2E2HC 3GTJC 5C4XC 4OIRA 3KW2A 3S1MC 4WFNS 4KN7A 4LK1A 1WCMC 1DFUP 4BY1C 4A3JC 1NYLA 3FKIC 2Y0SD 4A3MC 1O0CA 5BNZA 4C2MC 4Q5SA 1EXDA 3HOXC 2B63C 4BXXC 2O5JA 3DLLS 3K7AC 4A3DC 5GAGW 2CW0A 2EGWA 1BDFA 2BE5A 4Y52C 4A3KC 4YFXA 1SFOC 3CQZC 1QRTA 4WFBS 1GTSA 3GTLC 1B75A 1TWGC 5FLMC 4C3JC 4OIOA 3S17C 3S1RC 2PI8A 4KMUA 2JA6C 3RZDC 3J7ZV 1I50C 2O5IA 3S14C 2A69A 1R9TC 4E8BA 2ZJQS 2CX8A 4ZH4A 4WFAS 4IO9S 5IYDC 3GTPC 3S2DC 3H3VD 2E2JC 4LK0A 4BY7C 1VHKA 4BBSC 4V194 2RD2A 4A3CC 1ZJWA 2Z0YA 1YNJA 3EQLA 5TMFA 2R93C 4OIQA 1NXZA 2GAEA 4P2BA 2A6EA 2L5NA 3PO3C 1IW7A 5IYCC 4LLGA 4G7OA 2L3UA 1YNNA 1SMYA 2PJJA 1VHYA 3PIPS 2ZJRS 1I6VA 5IYBC 4MEYA 5GADW 5D4DA 3HOVC 3DXJA 3I4NC 2R92C 1ZYRA 1V6ZA 3GTOC 3M4OC 1UDXA 4LJZA 4JYZA 5DM6S 2A6HA 4KN4A 5C4JC 4A3EC 4WCES 5HQHA 4NOIA 4G7HA 4QJVA 2NWAA 2PA8D 2PPBA 3GTKC 3CZBA 4Y7NC 1EUYA 2JA7C 1FEUA 5JVGS 2KXYA 1Y1WC 2NVTC 4H3SA 4JXZA 2RE8A 1TWHC 4JK1A 1QTQA 3CF5S 4MEXA 1K83C 4XLNA 1Z85A 1I3QC 4OIPA 3W2VB 4AYBD 3GTGC 3HOWC 3HOUC 4WF9S 2KQ1A 5GAEW 2PNWA 2NVYC 4XSZA 1QRSA 3M3YC 4XLPA 2NVQC 3PIOS 2E2IC 4JXXA 3PO2C 3AIIA 4X6AC 3WODA 4YFNA 4OINA 3GTMC 1Y1VC 3HOYC 3S1NC 2WB1D 5IP9C 5GAHW 5C44C 4A3LC 4A3FC 2JA8C 3H0GC 4QIWD 5C3EC 5HL7S 2EGVA 2JA5C 4A3IC
chains in the Genus database with same CATH topology
4WFNS 2ZJQS 4IOCS 1EUYA 4WFAS 3X1LB 5JVGS 4H4KA 5IZNA 4IO9S 4UY88 1DFUP 1FEUA 1NYLA 4H3SA 4JXZA 2RE8A 4V194 2RD2A 1ZJWA 3CF5S 5BNZA 1O0CA 5JVHS 1QTQA 1EXDA 3DLLS 4P2BA 3W2VB 3W2WB 5GAGW 4WF9S 5GAEW 1EUQA 3PIPS 2ZJRS 1QRSA 5DM7S 5GADW 2HZ7A 3PIOS 4JXXA 3AIIA 1QRTA 4WFBS 1GTSA 1QRUA 1B75A 1D6KA 1UDXA 4U67S 5GAHW 4JYZA 5DM6S 1O0BA 2ZJPS 4IOAS 4WCES 5HL7S 1GTRA 3J7ZV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFN S;  2ZJQ S;  4IOC S;  1EUY A;  4WFA S;  1FEU A;  5JVG S;  5IZN A;  4IO9 S;  1DFU P;  4UY8 8;  1NYL A;  4H3S A;  4JXZ A;  2RE8 A;  2RD2 A;  1ZJW A;  3CF5 S;  5BNZ A;  1O0C A;  5JVH S;  1QTQ A;  1EXD A;  3DLL S;  4P2B A;  5GAG W;  4WF9 S;  5GAE W;  1EUQ A;  3PIP S;  2ZJR S;  1QRS A;  5DM7 S;  5GAD W;  2HZ7 A;  3PIO S;  4JXX A;  3AII A;  1QRT A;  4WFB S;  1GTS A;  1QRU A;  1B75 A;  1D6K A;  1O0B A;  4U67 S;  5GAH W;  4JYZ A;  5DM6 S;  2ZJP S;  4IOA S;  4WCE S;  5HL7 S;  1GTR A;  3J7Z V; 
#chains in the Genus database with same CATH topology
 4YG2 A;  4IOC S;  4MQ9 A;  1HQM A;  3X1L B;  4H4K A;  5IZN A;  3S1Q C;  4UY8 8;  4C3H C;  2VUM C;  4Q4Z A;  2PIC A;  3RZO C;  2NVX C;  3HKZ D;  5JVH S;  4G7Z A;  4J3C A;  2G6G A;  5TMC A;  3W2W B;  2YU9 C;  3GTQ C;  3LYW A;  2PMZ D;  4C3I C;  1EUQ A;  2WAQ D;  5DM7 S;  4XSX A;  2AE0 X;  2HZ7 A;  3HOZ C;  4L69 A;  2R7Z C;  1TWF C;  4BBR C;  4A93 C;  1QRU A;  1TWA C;  1TWC C;  1D6K A;  4GZY A;  4A3G C;  1I6H C;  1O0B A;  4U67 S;  2A68 A;  3S2H C;  4A3B C;  2ZJP S;  4IOA S;  5IP7 C;  3I4M C;  3S16 C;  2KPU A;  3S15 C;  4YFK A;  2G5D A;  1GTR A;  2E2H C;  3GTJ C;  5C4X C;  4OIR A;  3KW2 A;  3S1M C;  4WFN S;  4KN7 A;  4LK1 A;  1WCM C;  1DFU P;  4BY1 C;  4A3J C;  1NYL A;  3FKI C;  2Y0S D;  4A3M C;  1O0C A;  5BNZ A;  4C2M C;  4Q5S A;  1EXD A;  3HOX C;  2B63 C;  4BXX C;  2O5J A;  3DLL S;  3K7A C;  4A3D C;  5GAG W;  2CW0 A;  2EGW A;  1BDF A;  2BE5 A;  4Y52 C;  4A3K C;  4YFX A;  1SFO C;  3CQZ C;  1QRT A;  4WFB S;  1GTS A;  3GTL C;  1B75 A;  1TWG C;  5FLM C;  4C3J C;  4OIO A;  3S17 C;  3S1R C;  2PI8 A;  4KMU A;  2JA6 C;  3RZD C;  3J7Z V;  1I50 C;  2O5I A;  3S14 C;  2A69 A;  1R9T C;  4E8B A;  2ZJQ S;  2CX8 A;  4ZH4 A;  4WFA S;  4IO9 S;  5IYD C;  3GTP C;  3S2D C;  3H3V D;  2E2J C;  4LK0 A;  4BY7 C;  1VHK A;  4BBS C;  4V19 4;  2RD2 A;  4A3C C;  1ZJW A;  2Z0Y A;  1YNJ A;  3EQL A;  5TMF A;  2R93 C;  4OIQ A;  1NXZ A;  2GAE A;  4P2B A;  2A6E A;  2L5N A;  3PO3 C;  1IW7 A;  5IYC C;  4LLG A;  4G7O A;  2L3U A;  1YNN A;  1SMY A;  2PJJ A;  1VHY A;  3PIP S;  2ZJR S;  1I6V A;  5IYB C;  4MEY A;  5GAD W;  5D4D A;  3HOV C;  3DXJ A;  3I4N C;  2R92 C;  1ZYR A;  1V6Z A;  3GTO C;  3M4O C;  1UDX A;  4LJZ A;  4JYZ A;  5DM6 S;  2A6H A;  4KN4 A;  5C4J C;  4A3E C;  4WCE S;  5HQH A;  4NOI A;  4G7H A;  4QJV A;  2NWA A;  2PA8 D;  2PPB A;  3GTK C;  3CZB A;  4Y7N C;  1EUY A;  2JA7 C;  1FEU A;  5JVG S;  2KXY A;  1Y1W C;  2NVT C;  4H3S A;  4JXZ A;  2RE8 A;  1TWH C;  4JK1 A;  1QTQ A;  3CF5 S;  4MEX A;  1K83 C;  4XLN A;  1Z85 A;  1I3Q C;  4OIP A;  3W2V B;  4AYB D;  3GTG C;  3HOW C;  3HOU C;  4WF9 S;  2KQ1 A;  5GAE W;  2PNW A;  2NVY C;  4XSZ A;  1QRS A;  3M3Y C;  4XLP A;  2NVQ C;  3PIO S;  2E2I C;  4JXX A;  3PO2 C;  3AII A;  4X6A C;  3WOD A;  4YFN A;  4OIN A;  3GTM C;  1Y1V C;  3HOY C;  3S1N C;  2WB1 D;  5IP9 C;  5GAH W;  5C44 C;  4A3L C;  4A3F C;  2JA8 C;  3H0G C;  4QIW D;  5C3E C;  5HL7 S;  2EGV A;  2JA5 C;  4A3I C; 
#chains in the Genus database with same CATH homology
 4WFN S;  2ZJQ S;  4IOC S;  1EUY A;  4WFA S;  3X1L B;  5JVG S;  4H4K A;  5IZN A;  4IO9 S;  4UY8 8;  1DFU P;  1FEU A;  1NYL A;  4H3S A;  4JXZ A;  2RE8 A;  4V19 4;  2RD2 A;  1ZJW A;  3CF5 S;  5BNZ A;  1O0C A;  5JVH S;  1QTQ A;  1EXD A;  3DLL S;  4P2B A;  3W2V B;  3W2W B;  5GAG W;  4WF9 S;  5GAE W;  1EUQ A;  3PIP S;  2ZJR S;  1QRS A;  5DM7 S;  5GAD W;  2HZ7 A;  3PIO S;  4JXX A;  3AII A;  1QRT A;  4WFB S;  1GTS A;  1QRU A;  1B75 A;  1D6K A;  1UDX A;  4U67 S;  5GAH W;  4JYZ A;  5DM6 S;  1O0B A;  2ZJP S;  4IOA S;  4WCE S;  5HL7 S;  1GTR A;  3J7Z V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...