4IOCS

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome/ribosome inhibitor
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4iocS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4iocS02
3PIPS 1B75A 3AIIA 2RE8A 5BNZA 4UY88 4U67S 1QRTA 1D6KA 5GAGW 1QTQA 1EUYA 3DLLS 4WFAS 5GADW 5JVGS 3J7ZV 5DM7S 2ZJPS 4WCES 2ZJQS 1EUQA 2HZ7A 4H3SA 1O0BA 4P2BA 1EXDA 1GTSA 4JYZA 5GAEW 1QRUA 4JXZA 4WFNS 1QRSA 4WFBS 2RD2A 4WF9S 5DM6S 3PIOS 2ZJRS 1GTRA 5JVHS 1DFUP 1FEUA 5IZNA 1NYLA 4JXXA 5GAHW 3CF5S 5HL7S 4IO9S 1ZJWA 1O0CA 4IOCS 4IOAS
chains in the Genus database with same CATH superfamily
3LYWA 3S14C 4LLGA 3S1RC 2RE8A 3CQZC 3RZDC 4U67S 4X6AC 2O5IA 4OIRA 1IW7A 5IYCC 2A68A 4L69A 3W2VB 4C3HC 4A3JC 3HOWC 2R93C 2NVXC 3W2WB 1SFOC 2AE0X 3HOYC 5IP7C 2L3UA 4Q5SA 2GAEA 2PPBA 5GADW 3HOXC 1EUQA 1Y1VC 3FKIC 4YFKA 2A6EA 3S1NC 3HOZC 3HOUC 4MQ9A 2KQ1A 3S2DC 2JA8C 4MEYA 4JYZA 4GZYA 2PNWA 4JK1A 2Y0SD 4XSZA 1QRSA 4WFBS 4YG2A 1UDXA 4WF9S 2R7ZC 1DFUP 3PIOS 2ZJRS 5C3EC 3H3VD 5IZNA 3K7AC 4JXXA 3WODA 3S16C 3M3YC 1TWGC 1I3QC 2E2HC 4IOAS 4OIOA 4A3DC 3PIPS 4Y7NC 2JA7C 4BBSC 1QRTA 1D6KA 1NXZA 4KMUA 5C4JC 3CZBA 3I4NC 4A93C 3DLLS 4A3MC 4ZH4A 4G7OA 2ZJPS 2ZJQS 4WCES 2EGWA 4A3CC 5C44C 4Q4ZA 4A3FC 1EXDA 3I4MC 2PICA 1GTSA 2JA5C 2NVQC 2JA6C 4OIPA 1TWHC 3GTGC 1QRUA 2PA8D 3GTJC 4WFNS 1YNNA 2O5JA 3S1QC 4C3IC 1GTRA 1WCMC 1TWCC 3PO3C 1VHKA 1NYLA 4BBRC 2NVYC 2KPUA 2NWAA 1YNJA 5HL7S 4XSXA 3M4OC 4OIQA 1ZJWA 4A3BC 1O0CA 4IOCS 4LK1A 4E8BA 1B75A 1SMYA 5TMFA 4KN7A 2PI8A 3GTMC 2R92C 5GAGW 4A3EC 4AYBD 4C3JC 1QTQA 3DXJA 1EUYA 4XLNA 1I6VA 2EGVA 5D4DA 2L5NA 5IYDC 3GTPC 5JVGS 2A6HA 3J7ZV 2B63C 1Y1WC 2CW0A 1VHYA 4QIWD 2HZ7A 4G7HA 3GTQC 4H3SA 2G6GA 4P2BA 3HOVC 5GAEW 3EQLA 4BXXC 3S1MC 2YU9C 4BY7C 2RD2A 5C4XC 4BY1C 5DM6S 1K83C 3KW2A 1FEUA 3PO2C 4NOIA 3CF5S 3S2HC 4A3IC 4YFXA 4V194 4KN4A 2CX8A 3GTLC 4IO9S 4Y52C 2KXYA 3HKZD 5FLMC 3AIIA 4A3KC 2E2IC 5BNZA 4UY88 2A69A 3GTOC 5IP9C 5TMCA 4LK0A 5IYBC 1R9TC 1TWAC 2WB1D 2G5DA 3S15C 2VUMC 2PMZD 4XLPA 1ZYRA 4YFNA 1Z85A 4WFAS 4MEXA 5DM7S 4QJVA 4G7ZA 1I6HC 1V6ZA 2Z0YA 2WAQD 1O0BA 4C2MC 2NVTC 2BE5A 2E2JC 4OINA 4A3LC 4JXZA 4A3GC 4LJZA 3RZOC 1BDFA 1HQMA 4J3CA 3X1LB 1I50C 5JVHS 1TWFC 5GAHW 2PJJA 5HQHA 4H4KA 3H0GC 3S17C 3GTKC
chains in the Genus database with same CATH topology
3PIPS 1B75A 3AIIA 2RE8A 5BNZA 4UY88 4U67S 1QRTA 1D6KA 5GAGW 3W2VB 1QTQA 1EUYA 3W2WB 3DLLS 4WFAS 5GADW 5JVGS 3J7ZV 5DM7S 2ZJPS 4WCES 2ZJQS 1EUQA 2HZ7A 4H3SA 1O0BA 4P2BA 1EXDA 1GTSA 4JYZA 5GAEW 1QRUA 4JXZA 4WFNS 1QRSA 4WFBS 2RD2A 1UDXA 4WF9S 5DM6S 3PIOS 2ZJRS 1GTRA 5JVHS 3X1LB 1DFUP 5IZNA 1FEUA 1NYLA 4JXXA 5GAHW 3CF5S 4V194 4H4KA 5HL7S 4IO9S 1ZJWA 1O0CA 4IOCS 4IOAS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP S;  1B75 A;  3AII A;  2RE8 A;  5BNZ A;  4UY8 8;  4U67 S;  1QRT A;  1D6K A;  5GAG W;  1QTQ A;  1EUY A;  3DLL S;  4WFA S;  5GAD W;  5JVG S;  3J7Z V;  5DM7 S;  2ZJP S;  4WCE S;  2ZJQ S;  1EUQ A;  2HZ7 A;  4H3S A;  1O0B A;  4P2B A;  1EXD A;  1GTS A;  4JYZ A;  5GAE W;  1QRU A;  4JXZ A;  4WFN S;  1QRS A;  4WFB S;  2RD2 A;  4WF9 S;  5DM6 S;  3PIO S;  2ZJR S;  1GTR A;  5JVH S;  1DFU P;  1FEU A;  5IZN A;  1NYL A;  4JXX A;  5GAH W;  3CF5 S;  5HL7 S;  4IO9 S;  1ZJW A;  1O0C A;  4IOC S;  4IOA S; 
#chains in the Genus database with same CATH topology
 3LYW A;  3S14 C;  4LLG A;  3S1R C;  2RE8 A;  3CQZ C;  3RZD C;  4U67 S;  4X6A C;  2O5I A;  4OIR A;  1IW7 A;  5IYC C;  2A68 A;  4L69 A;  3W2V B;  4C3H C;  4A3J C;  3HOW C;  2R93 C;  2NVX C;  3W2W B;  1SFO C;  2AE0 X;  3HOY C;  5IP7 C;  2L3U A;  4Q5S A;  2GAE A;  2PPB A;  5GAD W;  3HOX C;  1EUQ A;  1Y1V C;  3FKI C;  4YFK A;  2A6E A;  3S1N C;  3HOZ C;  3HOU C;  4MQ9 A;  2KQ1 A;  3S2D C;  2JA8 C;  4MEY A;  4JYZ A;  4GZY A;  2PNW A;  4JK1 A;  2Y0S D;  4XSZ A;  1QRS A;  4WFB S;  4YG2 A;  1UDX A;  4WF9 S;  2R7Z C;  1DFU P;  3PIO S;  2ZJR S;  5C3E C;  3H3V D;  5IZN A;  3K7A C;  4JXX A;  3WOD A;  3S16 C;  3M3Y C;  1TWG C;  1I3Q C;  2E2H C;  4IOA S;  4OIO A;  4A3D C;  3PIP S;  4Y7N C;  2JA7 C;  4BBS C;  1QRT A;  1D6K A;  1NXZ A;  4KMU A;  5C4J C;  3CZB A;  3I4N C;  4A93 C;  3DLL S;  4A3M C;  4ZH4 A;  4G7O A;  2ZJP S;  2ZJQ S;  4WCE S;  2EGW A;  4A3C C;  5C44 C;  4Q4Z A;  4A3F C;  1EXD A;  3I4M C;  2PIC A;  1GTS A;  2JA5 C;  2NVQ C;  2JA6 C;  4OIP A;  1TWH C;  3GTG C;  1QRU A;  2PA8 D;  3GTJ C;  4WFN S;  1YNN A;  2O5J A;  3S1Q C;  4C3I C;  1GTR A;  1WCM C;  1TWC C;  3PO3 C;  1VHK A;  1NYL A;  4BBR C;  2NVY C;  2KPU A;  2NWA A;  1YNJ A;  5HL7 S;  4XSX A;  3M4O C;  4OIQ A;  1ZJW A;  4A3B C;  1O0C A;  4IOC S;  4LK1 A;  4E8B A;  1B75 A;  1SMY A;  5TMF A;  4KN7 A;  2PI8 A;  3GTM C;  2R92 C;  5GAG W;  4A3E C;  4AYB D;  4C3J C;  1QTQ A;  3DXJ A;  1EUY A;  4XLN A;  1I6V A;  2EGV A;  5D4D A;  2L5N A;  5IYD C;  3GTP C;  5JVG S;  2A6H A;  3J7Z V;  2B63 C;  1Y1W C;  2CW0 A;  1VHY A;  4QIW D;  2HZ7 A;  4G7H A;  3GTQ C;  4H3S A;  2G6G A;  4P2B A;  3HOV C;  5GAE W;  3EQL A;  4BXX C;  3S1M C;  2YU9 C;  4BY7 C;  2RD2 A;  5C4X C;  4BY1 C;  5DM6 S;  1K83 C;  3KW2 A;  1FEU A;  3PO2 C;  4NOI A;  3CF5 S;  3S2H C;  4A3I C;  4YFX A;  4V19 4;  4KN4 A;  2CX8 A;  3GTL C;  4IO9 S;  4Y52 C;  2KXY A;  3HKZ D;  5FLM C;  3AII A;  4A3K C;  2E2I C;  5BNZ A;  4UY8 8;  2A69 A;  3GTO C;  5IP9 C;  5TMC A;  4LK0 A;  5IYB C;  1R9T C;  1TWA C;  2WB1 D;  2G5D A;  3S15 C;  2VUM C;  2PMZ D;  4XLP A;  1ZYR A;  4YFN A;  1Z85 A;  4WFA S;  4MEX A;  5DM7 S;  4QJV A;  4G7Z A;  1I6H C;  1V6Z A;  2Z0Y A;  2WAQ D;  1O0B A;  4C2M C;  2NVT C;  2BE5 A;  2E2J C;  4OIN A;  4A3L C;  4JXZ A;  4A3G C;  4LJZ A;  3RZO C;  1BDF A;  1HQM A;  4J3C A;  3X1L B;  1I50 C;  5JVH S;  1TWF C;  5GAH W;  2PJJ A;  5HQH A;  4H4K A;  3H0G C;  3S17 C;  3GTK C; 
#chains in the Genus database with same CATH homology
 3PIP S;  1B75 A;  3AII A;  2RE8 A;  5BNZ A;  4UY8 8;  4U67 S;  1QRT A;  1D6K A;  5GAG W;  3W2V B;  1QTQ A;  1EUY A;  3W2W B;  3DLL S;  4WFA S;  5GAD W;  5JVG S;  3J7Z V;  5DM7 S;  2ZJP S;  4WCE S;  2ZJQ S;  1EUQ A;  2HZ7 A;  4H3S A;  1O0B A;  4P2B A;  1EXD A;  1GTS A;  4JYZ A;  5GAE W;  1QRU A;  4JXZ A;  4WFN S;  1QRS A;  4WFB S;  2RD2 A;  1UDX A;  4WF9 S;  5DM6 S;  3PIO S;  2ZJR S;  1GTR A;  5JVH S;  3X1L B;  1DFU P;  5IZN A;  1FEU A;  1NYL A;  4JXX A;  5GAH W;  3CF5 S;  4V19 4;  4H4K A;  5HL7 S;  4IO9 S;  1ZJW A;  1O0C A;  4IOC S;  4IOA S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...