4IOCS

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4iocS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4iocS02
5GAHW 3DLLS 5HL7S 4WFAS 5JVHS 4JXXA 1D6KA 1QTQA 4IOAS 4WF9S 3J7ZV 4U67S 4WFNS 1EUQA 5GAGW 5DM6S 5IZNA 4JXZA 5BNZA 4IOCS 5DM7S 1O0BA 1B75A 2HZ7A 1QRSA 5GADW 5GAEW 2ZJRS 1EXDA 1GTRA 3AIIA 3PIOS 1EUYA 3CF5S 4JYZA 1NYLA 1QRUA 4P2BA 1ZJWA 2RD2A 4WCES 2ZJPS 2ZJQS 3PIPS 1GTSA 5JVGS 1DFUP 4H3SA 4UY88 4IO9S 1FEUA 1O0CA 2RE8A 1QRTA 4WFBS
chains in the Genus database with same CATH superfamily
3DLLS 5IP7C 5HL7S 1D6KA 5FLMC 4A3BC 2A69A 3S1MC 2Y0SD 1NXZA 1TWFC 4YG2A 4JXZA 3EQLA 5IYCC 3LYWA 3S17C 4C2MC 5C4JC 2R93C 4MEXA 2YU9C 2PI8A 3M3YC 4H4KA 1QRSA 5GADW 4OIPA 3GTPC 4A3GC 4JYZA 1QRUA 5TMFA 4KN7A 4P2BA 4Y7NC 4MQ9A 1YNNA 4XSXA 5IP9C 3S2DC 3GTQC 3S1QC 5C4XC 3PIPS 4Q4ZA 2PNWA 1Y1WC 4UY88 2PA8D 4IO9S 2JA6C 2RE8A 1QRTA 4Y52C 3HKZD 5TMCA 4G7HA 2KXYA 2JA7C 3H3VD 1TWHC 3J7ZV 4J3CA 3M4OC 4U67S 4LLGA 5GAGW 5DM6S 3W2VB 2JA5C 3S16C 4LK1A 5C3EC 4BBSC 4A3CC 1UDXA 3GTMC 4A3DC 1V6ZA 5BNZA 4IOCS 2VUMC 2R7ZC 2CX8A 2WAQD 3HOVC 1VHYA 1EXDA 5GAEW 2ZJRS 1GTRA 4LK0A 4YFNA 4A3IC 3RZDC 3GTOC 3W2WB 3PIOS 4L69A 2PMZD 3S1RC 2E2JC 3H0GC 3DXJA 2NVXC 3CQZC 4G7ZA 4OINA 4C3IC 4BY1C 4XLPA 4WCES 1SFOC 1DFUP 4H3SA 1K83C 4BXXC 2L5NA 4C3JC 4GZYA 1O0CA 5IYDC 3HOWC 1VHKA 3PO3C 5GAHW 3I4NC 2PPBA 2L3UA 1IW7A 1TWGC 2CW0A 1EUQA 1HQMA 2JA8C 2EGVA 5IZNA 4KMUA 4OIOA 1Z85A 3PO2C 4AYBD 2E2HC 4Q5SA 2A6EA 4JK1A 5DM7S 3GTJC 3I4MC 1I50C 1ZYRA 4KN4A 3K7AC 4A3JC 3WODA 4QIWD 4A3EC 1TWAC 3HOXC 2E2IC 4A3FC 4BY7C 4X6AC 3AIIA 1SMYA 4BBRC 2O5IA 2Z0YA 2G5DA 2NVYC 3CF5S 1I3QC 1NYLA 3CZBA 1ZJWA 2RD2A 4A3MC 2ZJPS 3FKIC 2NVTC 4ZH4A 2AE0X 5JVGS 3S15C 1YNJA 3HOYC 3S2HC 1WCMC 4WF9S 4C3HC 4IOAS 4A3LC 4WFBS 2PJJA 4JXXA 4WFAS 2NWAA 5JVHS 2KQ1A 1QTQA 4YFXA 2G6GA 4OIRA 4WFNS 3GTKC 4OIQA 3S14C 2A6HA 2PICA 3X1LB 3HOZC 3S1NC 1TWCC 1I6VA 4V194 4YFKA 3GTGC 1O0BA 1B75A 1Y1VC 4NOIA 5HQHA 2HZ7A 4A93C 4LJZA 3KW2A 2R92C 1I6HC 1BDFA 3HOUC 4MEYA 2NVQC 5C44C 1EUYA 4QJVA 4A3KC 2GAEA 2EGWA 3GTLC 2KPUA 4XSZA 4E8BA 2ZJQS 1GTSA 5D4DA 3RZOC 1R9TC 2O5JA 2WB1D 4XLNA 5IYBC 2BE5A 1FEUA 2B63C 2A68A 4G7OA
chains in the Genus database with same CATH topology
5GAHW 3DLLS 5HL7S 4WFAS 5JVHS 4JXXA 1D6KA 1QTQA 4IOAS 4WF9S 3J7ZV 4U67S 4WFNS 1EUQA 5GAGW 5DM6S 3W2VB 5IZNA 3X1LB 1UDXA 4JXZA 5BNZA 4IOCS 4V194 5DM7S 1O0BA 1B75A 2HZ7A 4H4KA 1QRSA 5GADW 5GAEW 2ZJRS 1EXDA 1GTRA 3AIIA 3W2WB 3PIOS 1EUYA 3CF5S 4JYZA 1NYLA 1QRUA 4P2BA 1ZJWA 2RD2A 4WCES 2ZJPS 2ZJQS 3PIPS 1GTSA 5JVGS 1DFUP 4H3SA 4UY88 4IO9S 1FEUA 1O0CA 2RE8A 1QRTA 4WFBS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAH W;  3DLL S;  5HL7 S;  4WFA S;  5JVH S;  4JXX A;  1D6K A;  1QTQ A;  4IOA S;  4WF9 S;  3J7Z V;  4U67 S;  4WFN S;  1EUQ A;  5GAG W;  5DM6 S;  5IZN A;  4JXZ A;  5BNZ A;  4IOC S;  5DM7 S;  1O0B A;  1B75 A;  2HZ7 A;  1QRS A;  5GAD W;  5GAE W;  2ZJR S;  1EXD A;  1GTR A;  3AII A;  3PIO S;  1EUY A;  3CF5 S;  4JYZ A;  1NYL A;  1QRU A;  4P2B A;  1ZJW A;  2RD2 A;  4WCE S;  2ZJP S;  2ZJQ S;  3PIP S;  1GTS A;  5JVG S;  1DFU P;  4H3S A;  4UY8 8;  4IO9 S;  1FEU A;  1O0C A;  2RE8 A;  1QRT A;  4WFB S; 
#chains in the Genus database with same CATH topology
 3DLL S;  5IP7 C;  5HL7 S;  1D6K A;  5FLM C;  4A3B C;  2A69 A;  3S1M C;  2Y0S D;  1NXZ A;  1TWF C;  4YG2 A;  4JXZ A;  3EQL A;  5IYC C;  3LYW A;  3S17 C;  4C2M C;  5C4J C;  2R93 C;  4MEX A;  2YU9 C;  2PI8 A;  3M3Y C;  4H4K A;  1QRS A;  5GAD W;  4OIP A;  3GTP C;  4A3G C;  4JYZ A;  1QRU A;  5TMF A;  4KN7 A;  4P2B A;  4Y7N C;  4MQ9 A;  1YNN A;  4XSX A;  5IP9 C;  3S2D C;  3GTQ C;  3S1Q C;  5C4X C;  3PIP S;  4Q4Z A;  2PNW A;  1Y1W C;  4UY8 8;  2PA8 D;  4IO9 S;  2JA6 C;  2RE8 A;  1QRT A;  4Y52 C;  3HKZ D;  5TMC A;  4G7H A;  2KXY A;  2JA7 C;  3H3V D;  1TWH C;  3J7Z V;  4J3C A;  3M4O C;  4U67 S;  4LLG A;  5GAG W;  5DM6 S;  3W2V B;  2JA5 C;  3S16 C;  4LK1 A;  5C3E C;  4BBS C;  4A3C C;  1UDX A;  3GTM C;  4A3D C;  1V6Z A;  5BNZ A;  4IOC S;  2VUM C;  2R7Z C;  2CX8 A;  2WAQ D;  3HOV C;  1VHY A;  1EXD A;  5GAE W;  2ZJR S;  1GTR A;  4LK0 A;  4YFN A;  4A3I C;  3RZD C;  3GTO C;  3W2W B;  3PIO S;  4L69 A;  2PMZ D;  3S1R C;  2E2J C;  3H0G C;  3DXJ A;  2NVX C;  3CQZ C;  4G7Z A;  4OIN A;  4C3I C;  4BY1 C;  4XLP A;  4WCE S;  1SFO C;  1DFU P;  4H3S A;  1K83 C;  4BXX C;  2L5N A;  4C3J C;  4GZY A;  1O0C A;  5IYD C;  3HOW C;  1VHK A;  3PO3 C;  5GAH W;  3I4N C;  2PPB A;  2L3U A;  1IW7 A;  1TWG C;  2CW0 A;  1EUQ A;  1HQM A;  2JA8 C;  2EGV A;  5IZN A;  4KMU A;  4OIO A;  1Z85 A;  3PO2 C;  4AYB D;  2E2H C;  4Q5S A;  2A6E A;  4JK1 A;  5DM7 S;  3GTJ C;  3I4M C;  1I50 C;  1ZYR A;  4KN4 A;  3K7A C;  4A3J C;  3WOD A;  4QIW D;  4A3E C;  1TWA C;  3HOX C;  2E2I C;  4A3F C;  4BY7 C;  4X6A C;  3AII A;  1SMY A;  4BBR C;  2O5I A;  2Z0Y A;  2G5D A;  2NVY C;  3CF5 S;  1I3Q C;  1NYL A;  3CZB A;  1ZJW A;  2RD2 A;  4A3M C;  2ZJP S;  3FKI C;  2NVT C;  4ZH4 A;  2AE0 X;  5JVG S;  3S15 C;  1YNJ A;  3HOY C;  3S2H C;  1WCM C;  4WF9 S;  4C3H C;  4IOA S;  4A3L C;  4WFB S;  2PJJ A;  4JXX A;  4WFA S;  2NWA A;  5JVH S;  2KQ1 A;  1QTQ A;  4YFX A;  2G6G A;  4OIR A;  4WFN S;  3GTK C;  4OIQ A;  3S14 C;  2A6H A;  2PIC A;  3X1L B;  3HOZ C;  3S1N C;  1TWC C;  1I6V A;  4V19 4;  4YFK A;  3GTG C;  1O0B A;  1B75 A;  1Y1V C;  4NOI A;  5HQH A;  2HZ7 A;  4A93 C;  4LJZ A;  3KW2 A;  2R92 C;  1I6H C;  1BDF A;  3HOU C;  4MEY A;  2NVQ C;  5C44 C;  1EUY A;  4QJV A;  4A3K C;  2GAE A;  2EGW A;  3GTL C;  2KPU A;  4XSZ A;  4E8B A;  2ZJQ S;  1GTS A;  5D4D A;  3RZO C;  1R9T C;  2O5J A;  2WB1 D;  4XLN A;  5IYB C;  2BE5 A;  1FEU A;  2B63 C;  2A68 A;  4G7O A; 
#chains in the Genus database with same CATH homology
 5GAH W;  3DLL S;  5HL7 S;  4WFA S;  5JVH S;  4JXX A;  1D6K A;  1QTQ A;  4IOA S;  4WF9 S;  3J7Z V;  4U67 S;  4WFN S;  1EUQ A;  5GAG W;  5DM6 S;  3W2V B;  5IZN A;  3X1L B;  1UDX A;  4JXZ A;  5BNZ A;  4IOC S;  4V19 4;  5DM7 S;  1O0B A;  1B75 A;  2HZ7 A;  4H4K A;  1QRS A;  5GAD W;  5GAE W;  2ZJR S;  1EXD A;  1GTR A;  3AII A;  3W2W B;  3PIO S;  1EUY A;  3CF5 S;  4JYZ A;  1NYL A;  1QRU A;  4P2B A;  1ZJW A;  2RD2 A;  4WCE S;  2ZJP S;  2ZJQ S;  3PIP S;  1GTS A;  5JVG S;  1DFU P;  4H3S A;  4UY8 8;  4IO9 S;  1FEU A;  1O0C A;  2RE8 A;  1QRT A;  4WFB S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...