4IO9S

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 28
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4io9S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4io9S02
4IOCS 1O0BA 1NYLA 1FEUA 2ZJQS 5GADW 5JVHS 5GAGW 5DM7S 1EUYA 2ZJPS 4WCES 5BNZA 1QTQA 1EXDA 4IO9S 4UY88 4WFAS 2RE8A 1EUQA 5DM6S 3AIIA 1QRSA 4WF9S 5HL7S 4WFNS 3CF5S 1O0CA 4H3SA 1QRTA 4IOAS 1ZJWA 2HZ7A 1QRUA 5GAEW 4JXZA 1GTSA 3J7ZV 4JYZA 5GAHW 5IZNA 3DLLS 1B75A 4P2BA 4JXXA 4U67S 2RD2A 3PIOS 4WFBS 3PIPS 2ZJRS 5JVGS 1D6KA 1DFUP 1GTRA
chains in the Genus database with same CATH superfamily
5IYCC 4G7HA 4KMUA 2G6GA 2O5IA 2A6EA 4V194 2ZJQS 1I50C 4A3CC 5JVHS 1HQMA 5DM7S 2R7ZC 4BBSC 2PA8D 3S2HC 2Z0YA 4LJZA 3HOUC 4XLNA 3AIIA 3PO3C 2R93C 3GTPC 4WFNS 4BXXC 5FLMC 1VHYA 4IOAS 4BY1C 2VUMC 3GTQC 1IW7A 4OIQA 4YFXA 3M3YC 3J7ZV 4X6AC 5GAHW 4XSXA 3HOZC 2L3UA 5D4DA 3GTKC 3X1LB 3FKIC 1I6HC 4AYBD 4Y52C 2PI8A 4JXXA 3HOWC 4JK1A 4MQ9A 2JA6C 2O5JA 2ZJRS 5JVGS 2A69A 2KQ1A 4KN4A 4Y7NC 2E2JC 4A3BC 1DFUP 1TWCC 3M4OC 1GTRA 3HKZD 4Q5SA 4A3EC 1K83C 2NWAA 3RZOC 1FEUA 5GADW 1NXZA 5GAGW 4A3JC 3CZBA 3KW2A 4IO9S 2CX8A 3CQZC 4C3JC 4UY88 4QIWD 1VHKA 5C4JC 2JA7C 5DM6S 3GTMC 3I4MC 4Q4ZA 4A3DC 4LK1A 1ZYRA 5TMFA 2B63C 5TMCA 1QRUA 5GAEW 3H0GC 3S2DC 4GZYA 1WCMC 2A68A 5C44C 2EGVA 3W2WB 4L69A 4A3LC 3PIOS 2PJJA 3PIPS 1V6ZA 4KN7A 4OIOA 4MEXA 3S1MC 4BY7C 5C4XC 4YFKA 1TWFC 2KXYA 5HQHA 4MEYA 3S17C 4G7ZA 4IOCS 1TWAC 3LYWA 1SFOC 4QJVA 2R92C 1Y1WC 1Z85A 2PMZD 4LLGA 1EUYA 5BNZA 4E8BA 1EXDA 1QTQA 2PICA 2NVTC 4NOIA 3S1QC 1I6VA 2JA5C 4WF9S 1QRSA 4LK0A 3WODA 2CW0A 3CF5S 2WAQD 4A3IC 4H3SA 2NVQC 4OIRA 2E2IC 1ZJWA 3RZDC 5IZNA 4H4KA 1YNJA 3K7AC 4A3MC 3DXJA 2KPUA 2GAEA 4P2BA 3GTLC 2A6HA 2RD2A 3S16C 4YFNA 2AE0X 1TWHC 2YU9C 3PO2C 1D6KA 3W2VB 1TWGC 1Y1VC 1R9TC 4A3GC 2L5NA 5IP7C 2NVYC 4J3CA 4A3FC 3H3VD 1O0BA 1NYLA 4XSZA 3I4NC 5IYBC 4OINA 1UDXA 2ZJPS 2BE5A 4WCES 4C2MC 5IYDC 4ZH4A 2NVXC 3GTGC 4A93C 1YNNA 4WFAS 2RE8A 2WB1D 1EUQA 3EQLA 1SMYA 4C3IC 4XLPA 5HL7S 1O0CA 1QRTA 4C3HC 3GTJC 2HZ7A 4JXZA 1GTSA 2G5DA 4JYZA 1BDFA 4YG2A 3S14C 4BBRC 5C3EC 3S15C 4G7OA 3DLLS 1B75A 3GTOC 2PNWA 4U67S 1I3QC 4A3KC 3HOVC 3HOYC 2PPBA 5IP9C 2Y0SD 3S1NC 4WFBS 2EGWA 3S1RC 4OIPA 2E2HC 2JA8C 3HOXC
chains in the Genus database with same CATH topology
4IOCS 1O0BA 1NYLA 1FEUA 4V194 2ZJQS 5GADW 5JVHS 5GAGW 5DM7S 1UDXA 1EUYA 2ZJPS 4WCES 5BNZA 1QTQA 1EXDA 4IO9S 4UY88 4WFAS 2RE8A 1EUQA 5DM6S 3AIIA 1QRSA 4WF9S 5HL7S 4WFNS 3CF5S 1O0CA 4H3SA 1QRTA 4IOAS 1ZJWA 2HZ7A 1QRUA 5GAEW 4JXZA 1GTSA 3J7ZV 4JYZA 5GAHW 5IZNA 4H4KA 3DLLS 3X1LB 1B75A 4P2BA 4JXXA 4U67S 2RD2A 3W2WB 1D6KA 3PIOS 4WFBS 3PIPS 2ZJRS 5JVGS 3W2VB 1DFUP 1GTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOC S;  1O0B A;  1NYL A;  1FEU A;  2ZJQ S;  5GAD W;  5JVH S;  5GAG W;  5DM7 S;  1EUY A;  2ZJP S;  4WCE S;  5BNZ A;  1QTQ A;  1EXD A;  4IO9 S;  4UY8 8;  4WFA S;  2RE8 A;  1EUQ A;  5DM6 S;  3AII A;  1QRS A;  4WF9 S;  5HL7 S;  4WFN S;  3CF5 S;  1O0C A;  4H3S A;  1QRT A;  4IOA S;  1ZJW A;  2HZ7 A;  1QRU A;  5GAE W;  4JXZ A;  1GTS A;  3J7Z V;  4JYZ A;  5GAH W;  5IZN A;  3DLL S;  1B75 A;  4P2B A;  4JXX A;  4U67 S;  2RD2 A;  3PIO S;  4WFB S;  3PIP S;  2ZJR S;  5JVG S;  1D6K A;  1DFU P;  1GTR A; 
#chains in the Genus database with same CATH topology
 5IYC C;  4G7H A;  4KMU A;  2G6G A;  2O5I A;  2A6E A;  4V19 4;  2ZJQ S;  1I50 C;  4A3C C;  5JVH S;  1HQM A;  5DM7 S;  2R7Z C;  4BBS C;  2PA8 D;  3S2H C;  2Z0Y A;  4LJZ A;  3HOU C;  4XLN A;  3AII A;  3PO3 C;  2R93 C;  3GTP C;  4WFN S;  4BXX C;  5FLM C;  1VHY A;  4IOA S;  4BY1 C;  2VUM C;  3GTQ C;  1IW7 A;  4OIQ A;  4YFX A;  3M3Y C;  3J7Z V;  4X6A C;  5GAH W;  4XSX A;  3HOZ C;  2L3U A;  5D4D A;  3GTK C;  3X1L B;  3FKI C;  1I6H C;  4AYB D;  4Y52 C;  2PI8 A;  4JXX A;  3HOW C;  4JK1 A;  4MQ9 A;  2JA6 C;  2O5J A;  2ZJR S;  5JVG S;  2A69 A;  2KQ1 A;  4KN4 A;  4Y7N C;  2E2J C;  4A3B C;  1DFU P;  1TWC C;  3M4O C;  1GTR A;  3HKZ D;  4Q5S A;  4A3E C;  1K83 C;  2NWA A;  3RZO C;  1FEU A;  5GAD W;  1NXZ A;  5GAG W;  4A3J C;  3CZB A;  3KW2 A;  4IO9 S;  2CX8 A;  3CQZ C;  4C3J C;  4UY8 8;  4QIW D;  1VHK A;  5C4J C;  2JA7 C;  5DM6 S;  3GTM C;  3I4M C;  4Q4Z A;  4A3D C;  4LK1 A;  1ZYR A;  5TMF A;  2B63 C;  5TMC A;  1QRU A;  5GAE W;  3H0G C;  3S2D C;  4GZY A;  1WCM C;  2A68 A;  5C44 C;  2EGV A;  3W2W B;  4L69 A;  4A3L C;  3PIO S;  2PJJ A;  3PIP S;  1V6Z A;  4KN7 A;  4OIO A;  4MEX A;  3S1M C;  4BY7 C;  5C4X C;  4YFK A;  1TWF C;  2KXY A;  5HQH A;  4MEY A;  3S17 C;  4G7Z A;  4IOC S;  1TWA C;  3LYW A;  1SFO C;  4QJV A;  2R92 C;  1Y1W C;  1Z85 A;  2PMZ D;  4LLG A;  1EUY A;  5BNZ A;  4E8B A;  1EXD A;  1QTQ A;  2PIC A;  2NVT C;  4NOI A;  3S1Q C;  1I6V A;  2JA5 C;  4WF9 S;  1QRS A;  4LK0 A;  3WOD A;  2CW0 A;  3CF5 S;  2WAQ D;  4A3I C;  4H3S A;  2NVQ C;  4OIR A;  2E2I C;  1ZJW A;  3RZD C;  5IZN A;  4H4K A;  1YNJ A;  3K7A C;  4A3M C;  3DXJ A;  2KPU A;  2GAE A;  4P2B A;  3GTL C;  2A6H A;  2RD2 A;  3S16 C;  4YFN A;  2AE0 X;  1TWH C;  2YU9 C;  3PO2 C;  1D6K A;  3W2V B;  1TWG C;  1Y1V C;  1R9T C;  4A3G C;  2L5N A;  5IP7 C;  2NVY C;  4J3C A;  4A3F C;  3H3V D;  1O0B A;  1NYL A;  4XSZ A;  3I4N C;  5IYB C;  4OIN A;  1UDX A;  2ZJP S;  2BE5 A;  4WCE S;  4C2M C;  5IYD C;  4ZH4 A;  2NVX C;  3GTG C;  4A93 C;  1YNN A;  4WFA S;  2RE8 A;  2WB1 D;  1EUQ A;  3EQL A;  1SMY A;  4C3I C;  4XLP A;  5HL7 S;  1O0C A;  1QRT A;  4C3H C;  3GTJ C;  2HZ7 A;  4JXZ A;  1GTS A;  2G5D A;  4JYZ A;  1BDF A;  4YG2 A;  3S14 C;  4BBR C;  5C3E C;  3S15 C;  4G7O A;  3DLL S;  1B75 A;  3GTO C;  2PNW A;  4U67 S;  1I3Q C;  4A3K C;  3HOV C;  3HOY C;  2PPB A;  5IP9 C;  2Y0S D;  3S1N C;  4WFB S;  2EGW A;  3S1R C;  4OIP A;  2E2H C;  2JA8 C;  3HOX C; 
#chains in the Genus database with same CATH homology
 4IOC S;  1O0B A;  1NYL A;  1FEU A;  4V19 4;  2ZJQ S;  5GAD W;  5JVH S;  5GAG W;  5DM7 S;  1UDX A;  1EUY A;  2ZJP S;  4WCE S;  5BNZ A;  1QTQ A;  1EXD A;  4IO9 S;  4UY8 8;  4WFA S;  2RE8 A;  1EUQ A;  5DM6 S;  3AII A;  1QRS A;  4WF9 S;  5HL7 S;  4WFN S;  3CF5 S;  1O0C A;  4H3S A;  1QRT A;  4IOA S;  1ZJW A;  2HZ7 A;  1QRU A;  5GAE W;  4JXZ A;  1GTS A;  3J7Z V;  4JYZ A;  5GAH W;  5IZN A;  4H4K A;  3DLL S;  3X1L B;  1B75 A;  4P2B A;  4JXX A;  4U67 S;  2RD2 A;  3W2W B;  1D6K A;  3PIO S;  4WFB S;  3PIP S;  2ZJR S;  5JVG S;  3W2V B;  1DFU P;  1GTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...