4IO9S

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 28
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4io9S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4io9S02
5HL7S 4IOAS 3PIPS 1ZJWA 4JYZA 4U67S 5DM7S 1B75A 1EUQA 1D6KA 2ZJPS 1QRTA 1NYLA 5JVGS 1GTRA 1QRSA 2ZJQS 4JXZA 2RE8A 4P2BA 5BNZA 1EUYA 1GTSA 1QRUA 4WFNS 1DFUP 3J7ZV 5GAEW 2ZJRS 2RD2A 3AIIA 1EXDA 4WCES 4UY88 4IOCS 5IZNA 4WFAS 3CF5S 1QTQA 2HZ7A 5GAGW 5JVHS 4JXXA 4WF9S 1O0CA 3PIOS 3DLLS 4WFBS 4IO9S 1O0BA 4H3SA 1FEUA 5DM6S 5GADW 5GAHW
chains in the Genus database with same CATH superfamily
4XLPA 2PJJA 2Y0SD 2PPBA 4JYZA 3H0GC 1EUQA 1WCMC 3HKZD 2O5IA 4YFNA 1QRTA 1TWGC 5JVGS 1QRSA 4LK0A 4QIWD 3S14C 4A3BC 4A3CC 2GAEA 2BE5A 4BY7C 2RE8A 2NWAA 4JK1A 1DFUP 5C3EC 4G7ZA 4ZH4A 3WODA 4A3JC 2A68A 3S1NC 5TMCA 2B63C 3S1MC 3RZDC 2CW0A 2G5DA 4G7HA 2NVXC 3H3VD 3S16C 2HZ7A 5GAGW 4WF9S 2PA8D 4A3FC 4A3LC 3W2VB 5IP7C 3PIOS 4OIPA 3DLLS 4MEXA 3EQLA 4OIRA 5IYDC 2L5NA 2JA6C 3PO3C 2R92C 3CQZC 1I6VA 5HL7S 3S1QC 2CX8A 4IOAS 1IW7A 3K7AC 2KPUA 3GTKC 3GTLC 4A3MC 2ZJPS 1I50C 1NYLA 1GTRA 2NVTC 4V194 3X1LB 2JA7C 3GTMC 4JXZA 5D4DA 3HOVC 4P2BA 1V6ZA 2PICA 1EUYA 4C3HC 5C4JC 2PNWA 4KN4A 4MEYA 2NVYC 3GTQC 1TWHC 3W2WB 4XSXA 2EGWA 4OIQA 3LYWA 1QTQA 4BBRC 5C44C 2L3UA 5JVHS 4JXXA 1K83C 2KQ1A 5HQHA 3GTPC 2WB1D 4BY1C 2EGVA 1ZYRA 4Q5SA 4WFBS 4LK1A 4NOIA 4G7OA 3PO2C 4A3GC 4Q4ZA 4C3IC 1VHKA 5IYBC 4A3KC 4MQ9A 3M3YC 1Z85A 3PIPS 1UDXA 1ZJWA 1B75A 4U67S 2WAQD 4KN7A 4E8BA 4Y52C 4C2MC 2E2JC 5IYCC 2ZJQS 3DXJA 3I4NC 3S1RC 1Y1VC 2VUMC 3S17C 4A3EC 1QRUA 5BNZA 3GTGC 3KW2A 4XSZA 4A3DC 3M4OC 4YG2A 3J7ZV 2RD2A 4J3CA 3AIIA 1BDFA 2E2IC 4UY88 3S2DC 4IOCS 5IZNA 3FKIC 4KMUA 4A3IC 2A69A 5IP9C 1SFOC 2PI8A 1O0CA 1SMYA 4BBSC 1NXZA 4YFKA 2G6GA 1FEUA 1O0BA 4H3SA 4A93C 5DM6S 3CZBA 5GADW 4YFXA 2AE0X 2R7ZC 4LJZA 1TWCC 4Y7NC 2Z0YA 4QJVA 5TMFA 2JA5C 5DM7S 3RZOC 1I6HC 1R9TC 1D6KA 1VHYA 4H4KA 3S15C 3S2HC 2A6HA 4OIOA 2PMZD 1GTSA 2R93C 1TWAC 1YNJA 3HOYC 4WFNS 3HOUC 1HQMA 5GAEW 2ZJRS 1EXDA 2JA8C 4L69A 1I3QC 1TWFC 3I4MC 3HOXC 4WCES 1Y1WC 4WFAS 3CF5S 4OINA 2E2HC 3HOWC 3HOZC 4BXXC 4LLGA 5C4XC 3GTJC 4X6AC 2A6EA 4XLNA 4C3JC 2YU9C 2NVQC 4GZYA 4IO9S 3GTOC 1YNNA 4AYBD 2O5JA 5FLMC 5GAHW 2KXYA
chains in the Genus database with same CATH topology
5HL7S 4IOAS 3PIPS 1ZJWA 1UDXA 4JYZA 4U67S 5DM7S 1B75A 1EUQA 1D6KA 2ZJPS 1QRTA 1NYLA 5JVGS 1GTRA 1QRSA 4H4KA 4V194 2ZJQS 3X1LB 4JXZA 2RE8A 4P2BA 5BNZA 1EUYA 1GTSA 1QRUA 4WFNS 1DFUP 3J7ZV 5GAEW 2ZJRS 2RD2A 3AIIA 1EXDA 3W2WB 4WCES 4UY88 4IOCS 5IZNA 4WFAS 3CF5S 1QTQA 2HZ7A 5GAGW 5JVHS 4JXXA 4WF9S 3W2VB 1O0CA 3PIOS 3DLLS 4WFBS 4IO9S 1O0BA 4H3SA 1FEUA 5DM6S 5GADW 5GAHW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL7 S;  4IOA S;  3PIP S;  1ZJW A;  4JYZ A;  4U67 S;  5DM7 S;  1B75 A;  1EUQ A;  1D6K A;  2ZJP S;  1QRT A;  1NYL A;  5JVG S;  1GTR A;  1QRS A;  2ZJQ S;  4JXZ A;  2RE8 A;  4P2B A;  5BNZ A;  1EUY A;  1GTS A;  1QRU A;  4WFN S;  1DFU P;  3J7Z V;  5GAE W;  2ZJR S;  2RD2 A;  3AII A;  1EXD A;  4WCE S;  4UY8 8;  4IOC S;  5IZN A;  4WFA S;  3CF5 S;  1QTQ A;  2HZ7 A;  5GAG W;  5JVH S;  4JXX A;  4WF9 S;  1O0C A;  3PIO S;  3DLL S;  4WFB S;  4IO9 S;  1O0B A;  4H3S A;  1FEU A;  5DM6 S;  5GAD W;  5GAH W; 
#chains in the Genus database with same CATH topology
 4XLP A;  2PJJ A;  2Y0S D;  2PPB A;  4JYZ A;  3H0G C;  1EUQ A;  1WCM C;  3HKZ D;  2O5I A;  4YFN A;  1QRT A;  1TWG C;  5JVG S;  1QRS A;  4LK0 A;  4QIW D;  3S14 C;  4A3B C;  4A3C C;  2GAE A;  2BE5 A;  4BY7 C;  2RE8 A;  2NWA A;  4JK1 A;  1DFU P;  5C3E C;  4G7Z A;  4ZH4 A;  3WOD A;  4A3J C;  2A68 A;  3S1N C;  5TMC A;  2B63 C;  3S1M C;  3RZD C;  2CW0 A;  2G5D A;  4G7H A;  2NVX C;  3H3V D;  3S16 C;  2HZ7 A;  5GAG W;  4WF9 S;  2PA8 D;  4A3F C;  4A3L C;  3W2V B;  5IP7 C;  3PIO S;  4OIP A;  3DLL S;  4MEX A;  3EQL A;  4OIR A;  5IYD C;  2L5N A;  2JA6 C;  3PO3 C;  2R92 C;  3CQZ C;  1I6V A;  5HL7 S;  3S1Q C;  2CX8 A;  4IOA S;  1IW7 A;  3K7A C;  2KPU A;  3GTK C;  3GTL C;  4A3M C;  2ZJP S;  1I50 C;  1NYL A;  1GTR A;  2NVT C;  4V19 4;  3X1L B;  2JA7 C;  3GTM C;  4JXZ A;  5D4D A;  3HOV C;  4P2B A;  1V6Z A;  2PIC A;  1EUY A;  4C3H C;  5C4J C;  2PNW A;  4KN4 A;  4MEY A;  2NVY C;  3GTQ C;  1TWH C;  3W2W B;  4XSX A;  2EGW A;  4OIQ A;  3LYW A;  1QTQ A;  4BBR C;  5C44 C;  2L3U A;  5JVH S;  4JXX A;  1K83 C;  2KQ1 A;  5HQH A;  3GTP C;  2WB1 D;  4BY1 C;  2EGV A;  1ZYR A;  4Q5S A;  4WFB S;  4LK1 A;  4NOI A;  4G7O A;  3PO2 C;  4A3G C;  4Q4Z A;  4C3I C;  1VHK A;  5IYB C;  4A3K C;  4MQ9 A;  3M3Y C;  1Z85 A;  3PIP S;  1UDX A;  1ZJW A;  1B75 A;  4U67 S;  2WAQ D;  4KN7 A;  4E8B A;  4Y52 C;  4C2M C;  2E2J C;  5IYC C;  2ZJQ S;  3DXJ A;  3I4N C;  3S1R C;  1Y1V C;  2VUM C;  3S17 C;  4A3E C;  1QRU A;  5BNZ A;  3GTG C;  3KW2 A;  4XSZ A;  4A3D C;  3M4O C;  4YG2 A;  3J7Z V;  2RD2 A;  4J3C A;  3AII A;  1BDF A;  2E2I C;  4UY8 8;  3S2D C;  4IOC S;  5IZN A;  3FKI C;  4KMU A;  4A3I C;  2A69 A;  5IP9 C;  1SFO C;  2PI8 A;  1O0C A;  1SMY A;  4BBS C;  1NXZ A;  4YFK A;  2G6G A;  1FEU A;  1O0B A;  4H3S A;  4A93 C;  5DM6 S;  3CZB A;  5GAD W;  4YFX A;  2AE0 X;  2R7Z C;  4LJZ A;  1TWC C;  4Y7N C;  2Z0Y A;  4QJV A;  5TMF A;  2JA5 C;  5DM7 S;  3RZO C;  1I6H C;  1R9T C;  1D6K A;  1VHY A;  4H4K A;  3S15 C;  3S2H C;  2A6H A;  4OIO A;  2PMZ D;  1GTS A;  2R93 C;  1TWA C;  1YNJ A;  3HOY C;  4WFN S;  3HOU C;  1HQM A;  5GAE W;  2ZJR S;  1EXD A;  2JA8 C;  4L69 A;  1I3Q C;  1TWF C;  3I4M C;  3HOX C;  4WCE S;  1Y1W C;  4WFA S;  3CF5 S;  4OIN A;  2E2H C;  3HOW C;  3HOZ C;  4BXX C;  4LLG A;  5C4X C;  3GTJ C;  4X6A C;  2A6E A;  4XLN A;  4C3J C;  2YU9 C;  2NVQ C;  4GZY A;  4IO9 S;  3GTO C;  1YNN A;  4AYB D;  2O5J A;  5FLM C;  5GAH W;  2KXY A; 
#chains in the Genus database with same CATH homology
 5HL7 S;  4IOA S;  3PIP S;  1ZJW A;  1UDX A;  4JYZ A;  4U67 S;  5DM7 S;  1B75 A;  1EUQ A;  1D6K A;  2ZJP S;  1QRT A;  1NYL A;  5JVG S;  1GTR A;  1QRS A;  4H4K A;  4V19 4;  2ZJQ S;  3X1L B;  4JXZ A;  2RE8 A;  4P2B A;  5BNZ A;  1EUY A;  1GTS A;  1QRU A;  4WFN S;  1DFU P;  3J7Z V;  5GAE W;  2ZJR S;  2RD2 A;  3AII A;  1EXD A;  3W2W B;  4WCE S;  4UY8 8;  4IOC S;  5IZN A;  4WFA S;  3CF5 S;  1QTQ A;  2HZ7 A;  5GAG W;  5JVH S;  4JXX A;  4WF9 S;  3W2V B;  1O0C A;  3PIO S;  3DLL S;  4WFB S;  4IO9 S;  1O0B A;  4H3S A;  1FEU A;  5DM6 S;  5GAD W;  5GAH W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...