4IO9S

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 28
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4io9S01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4io9S02
4H3SA 4UY88 2RE8A 2HZ7A 5GAGW 1QTQA 1QRTA 1DFUP 1NYLA 1GTRA 1B75A 3J7ZV 2ZJPS 1O0CA 2ZJRS 4JXXA 1EXDA 5IZNA 5BNZA 3CF5S 1EUYA 1QRUA 1EUQA 5GAEW 4IO9S 3AIIA 5DM6S 5DM7S 4WFNS 5JVGS 3PIPS 4WF9S 5GAHW 2RD2A 1O0BA 4WFBS 4JYZA 4JXZA 4P2BA 5JVHS 4IOCS 3PIOS 1ZJWA 4WFAS 4WCES 2ZJQS 1D6KA 3DLLS 4IOAS 5HL7S 1FEUA 5GADW 4U67S 1GTSA 1QRSA
chains in the Genus database with same CATH superfamily
4XLNA 4UY88 1I6VA 2JA5C 3CZBA 2HZ7A 4LJZA 1R9TC 4C3JC 2O5IA 3S14C 3HOYC 2JA8C 1O0CA 2E2HC 5HQHA 4YFNA 3W2WB 4LLGA 4A3FC 3HOWC 1EUYA 1QRUA 5C4JC 1VHYA 4OIRA 2BE5A 4MEYA 2JA7C 4IO9S 5IYBC 4C3HC 5TMCA 3HOZC 2PICA 2KQ1A 4Q4ZA 2NVXC 3GTOC 4WF9S 4BBSC 4WFBS 4MEXA 2E2IC 2B63C 4JXZA 5C4XC 5JVHS 4AYBD 4XLPA 5IYDC 3GTJC 3GTMC 1HQMA 2R7ZC 1NXZA 4L69A 4IOAS 3GTPC 1TWHC 3GTKC 4YFXA 1GTSA 3S2DC 2R92C 3S1MC 4V194 1QRSA 2Y0SD 4H3SA 1SMYA 3HOXC 5D4DA 3S2HC 4MQ9A 2WB1D 4XSZA 1ZYRA 4G7HA 3I4NC 1YNNA 2ZJPS 2ZJRS 3X1LB 1Y1WC 5BNZA 4A3KC 4BXXC 1YNJA 2A6EA 2G5DA 1EUQA 3AIIA 3HOUC 4WFNS 4J3CA 1O0BA 4XSXA 3PO2C 3PO3C 4OIOA 1UDXA 4BY7C 1I6HC 2NVTC 3KW2A 4IOCS 3S1NC 1ZJWA 3RZOC 4WFAS 2AE0X 3DXJA 4BBRC 1SFOC 3K7AC 2PMZD 3DLLS 3CQZC 4QJVA 4A3EC 3S15C 1FEUA 1WCMC 3HKZD 4A3LC 4U67S 3S1QC 1V6ZA 1Y1VC 4C3IC 4A3BC 1IW7A 1Z85A 3EQLA 2RE8A 3WODA 3HOVC 2PNWA 5GAGW 1QTQA 4ZH4A 5C3EC 1QRTA 4G7ZA 1NYLA 1GTRA 2YU9C 4A3MC 4LK0A 3GTQC 4BY1C 2EGWA 2CW0A 3CF5S 4JK1A 4GZYA 3S1RC 2O5JA 4KN4A 1VHKA 2KXYA 5DM6S 2CX8A 4A93C 5JVGS 3PIPS 1I50C 2RD2A 2PI8A 4A3CC 3GTLC 1TWFC 4OIQA 4YG2A 3PIOS 4KMUA 2NVYC 4QIWD 2G6GA 2PJJA 3H3VD 2PPBA 3W2VB 4A3DC 2NWAA 3FKIC 5HL7S 3M3YC 5IP7C 4NOIA 2KPUA 3RZDC 4KN7A 1TWAC 4C2MC 2E2JC 2L5NA 4H4KA 3GTGC 1BDFA 1DFUP 1B75A 2NVQC 4A3GC 4OIPA 3J7ZV 1K83C 2WAQD 3I4MC 4JXXA 4Y52C 4G7OA 1EXDA 5IZNA 2A6HA 3M4OC 4X6AC 3H0GC 2Z0YA 2EGVA 5GAEW 3S16C 5FLMC 2R93C 5DM7S 5TMFA 4A3IC 5GAHW 5IP9C 4A3JC 2PA8D 1TWCC 4JYZA 4E8BA 2A68A 4Y7NC 4P2BA 2VUMC 2GAEA 1TWGC 2L3UA 4Q5SA 2A69A 4LK1A 4WCES 2ZJQS 1D6KA 3LYWA 5IYCC 3S17C 5GADW 5C44C 4OINA 2JA6C 4YFKA 1I3QC
chains in the Genus database with same CATH topology
4H3SA 4UY88 2RE8A 2HZ7A 4H4KA 5GAGW 1QTQA 1QRTA 1DFUP 1NYLA 1GTRA 1B75A 3J7ZV 2ZJPS 1O0CA 2ZJRS 4JXXA 3X1LB 3W2WB 1EXDA 5IZNA 5BNZA 3CF5S 1EUYA 1QRUA 1EUQA 5GAEW 4IO9S 3AIIA 5DM6S 5DM7S 4WFNS 5JVGS 3PIPS 4WF9S 5GAHW 2RD2A 1O0BA 4WFBS 4JYZA 1UDXA 4JXZA 4P2BA 5JVHS 4IOCS 3PIOS 1ZJWA 4WFAS 4WCES 2ZJQS 1D6KA 3W2VB 3DLLS 4IOAS 5HL7S 1FEUA 5GADW 4U67S 1GTSA 4V194 1QRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H3S A;  4UY8 8;  2RE8 A;  2HZ7 A;  5GAG W;  1QTQ A;  1QRT A;  1DFU P;  1NYL A;  1GTR A;  1B75 A;  3J7Z V;  2ZJP S;  1O0C A;  2ZJR S;  4JXX A;  1EXD A;  5IZN A;  5BNZ A;  3CF5 S;  1EUY A;  1QRU A;  1EUQ A;  5GAE W;  4IO9 S;  3AII A;  5DM6 S;  5DM7 S;  4WFN S;  5JVG S;  3PIP S;  4WF9 S;  5GAH W;  2RD2 A;  1O0B A;  4WFB S;  4JYZ A;  4JXZ A;  4P2B A;  5JVH S;  4IOC S;  3PIO S;  1ZJW A;  4WFA S;  4WCE S;  2ZJQ S;  1D6K A;  3DLL S;  4IOA S;  5HL7 S;  1FEU A;  5GAD W;  4U67 S;  1GTS A;  1QRS A; 
#chains in the Genus database with same CATH topology
 4XLN A;  4UY8 8;  1I6V A;  2JA5 C;  3CZB A;  2HZ7 A;  4LJZ A;  1R9T C;  4C3J C;  2O5I A;  3S14 C;  3HOY C;  2JA8 C;  1O0C A;  2E2H C;  5HQH A;  4YFN A;  3W2W B;  4LLG A;  4A3F C;  3HOW C;  1EUY A;  1QRU A;  5C4J C;  1VHY A;  4OIR A;  2BE5 A;  4MEY A;  2JA7 C;  4IO9 S;  5IYB C;  4C3H C;  5TMC A;  3HOZ C;  2PIC A;  2KQ1 A;  4Q4Z A;  2NVX C;  3GTO C;  4WF9 S;  4BBS C;  4WFB S;  4MEX A;  2E2I C;  2B63 C;  4JXZ A;  5C4X C;  5JVH S;  4AYB D;  4XLP A;  5IYD C;  3GTJ C;  3GTM C;  1HQM A;  2R7Z C;  1NXZ A;  4L69 A;  4IOA S;  3GTP C;  1TWH C;  3GTK C;  4YFX A;  1GTS A;  3S2D C;  2R92 C;  3S1M C;  4V19 4;  1QRS A;  2Y0S D;  4H3S A;  1SMY A;  3HOX C;  5D4D A;  3S2H C;  4MQ9 A;  2WB1 D;  4XSZ A;  1ZYR A;  4G7H A;  3I4N C;  1YNN A;  2ZJP S;  2ZJR S;  3X1L B;  1Y1W C;  5BNZ A;  4A3K C;  4BXX C;  1YNJ A;  2A6E A;  2G5D A;  1EUQ A;  3AII A;  3HOU C;  4WFN S;  4J3C A;  1O0B A;  4XSX A;  3PO2 C;  3PO3 C;  4OIO A;  1UDX A;  4BY7 C;  1I6H C;  2NVT C;  3KW2 A;  4IOC S;  3S1N C;  1ZJW A;  3RZO C;  4WFA S;  2AE0 X;  3DXJ A;  4BBR C;  1SFO C;  3K7A C;  2PMZ D;  3DLL S;  3CQZ C;  4QJV A;  4A3E C;  3S15 C;  1FEU A;  1WCM C;  3HKZ D;  4A3L C;  4U67 S;  3S1Q C;  1V6Z A;  1Y1V C;  4C3I C;  4A3B C;  1IW7 A;  1Z85 A;  3EQL A;  2RE8 A;  3WOD A;  3HOV C;  2PNW A;  5GAG W;  1QTQ A;  4ZH4 A;  5C3E C;  1QRT A;  4G7Z A;  1NYL A;  1GTR A;  2YU9 C;  4A3M C;  4LK0 A;  3GTQ C;  4BY1 C;  2EGW A;  2CW0 A;  3CF5 S;  4JK1 A;  4GZY A;  3S1R C;  2O5J A;  4KN4 A;  1VHK A;  2KXY A;  5DM6 S;  2CX8 A;  4A93 C;  5JVG S;  3PIP S;  1I50 C;  2RD2 A;  2PI8 A;  4A3C C;  3GTL C;  1TWF C;  4OIQ A;  4YG2 A;  3PIO S;  4KMU A;  2NVY C;  4QIW D;  2G6G A;  2PJJ A;  3H3V D;  2PPB A;  3W2V B;  4A3D C;  2NWA A;  3FKI C;  5HL7 S;  3M3Y C;  5IP7 C;  4NOI A;  2KPU A;  3RZD C;  4KN7 A;  1TWA C;  4C2M C;  2E2J C;  2L5N A;  4H4K A;  3GTG C;  1BDF A;  1DFU P;  1B75 A;  2NVQ C;  4A3G C;  4OIP A;  3J7Z V;  1K83 C;  2WAQ D;  3I4M C;  4JXX A;  4Y52 C;  4G7O A;  1EXD A;  5IZN A;  2A6H A;  3M4O C;  4X6A C;  3H0G C;  2Z0Y A;  2EGV A;  5GAE W;  3S16 C;  5FLM C;  2R93 C;  5DM7 S;  5TMF A;  4A3I C;  5GAH W;  5IP9 C;  4A3J C;  2PA8 D;  1TWC C;  4JYZ A;  4E8B A;  2A68 A;  4Y7N C;  4P2B A;  2VUM C;  2GAE A;  1TWG C;  2L3U A;  4Q5S A;  2A69 A;  4LK1 A;  4WCE S;  2ZJQ S;  1D6K A;  3LYW A;  5IYC C;  3S17 C;  5GAD W;  5C44 C;  4OIN A;  2JA6 C;  4YFK A;  1I3Q C; 
#chains in the Genus database with same CATH homology
 4H3S A;  4UY8 8;  2RE8 A;  2HZ7 A;  4H4K A;  5GAG W;  1QTQ A;  1QRT A;  1DFU P;  1NYL A;  1GTR A;  1B75 A;  3J7Z V;  2ZJP S;  1O0C A;  2ZJR S;  4JXX A;  3X1L B;  3W2W B;  1EXD A;  5IZN A;  5BNZ A;  3CF5 S;  1EUY A;  1QRU A;  1EUQ A;  5GAE W;  4IO9 S;  3AII A;  5DM6 S;  5DM7 S;  4WFN S;  5JVG S;  3PIP S;  4WF9 S;  5GAH W;  2RD2 A;  1O0B A;  4WFB S;  4JYZ A;  1UDX A;  4JXZ A;  4P2B A;  5JVH S;  4IOC S;  3PIO S;  1ZJW A;  4WFA S;  4WCE S;  2ZJQ S;  1D6K A;  3W2V B;  3DLL S;  4IOA S;  5HL7 S;  1FEU A;  5GAD W;  4U67 S;  1GTS A;  4V19 4;  1QRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...