3CZBA

Crystal structure of putative transglycosylase from caulobacter crescentus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
338
structure length
325
Chain Sequence
MPAALSFAGLAGWAEEDHLAALNAFRAGCGVSKDPAAARVCGLAKATKDLDVSGAKAFIEANFRVEAVDGGGDGLLTAYFAPQYEARMSRNAEFSAPLRGLPADLVVLDLGPFEPALVGKKITGHVEGSTFVPYPDRAEIEATPSDKPLAWMRPEELFFLQIQGSGVLVLPDGRRVRAVFAGTNGKPFVGIAIAMRDKGLLADAIRTWLAEHRGPEADAIMRLNPRYVFFRTVPDDGKEPAGAAGVALPPGRAIAVDPGYHAYGGFYWLDAAFPVYRRAVTALDTGGAIKGEVRADLYMGSGAVAGVEAGRVRHTLRLYRLTPNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative transglycosylase from Caulobacter crescentus.
rcsb
source organism Caulobacter crescentus
molecule tags Structural genomics, unknown function
molecule keywords Putative transglycosylase
total genus 85
structure length 325
sequence length 338
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3czbA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 3czbA02
4L48A 3X2JA 3X2NA 5GLXA 3X2MA 2PNWA 1L8FA 4JJOA 4JP6A 3X2KA 3CZBA 1N10A 5GLYA 3X2IA 4FG2A 3ENGA 3SUMA 2GAEA 4JCWA 3X2PA 2AE0X 3D30A 2ENGA 4AVRA 4ZM7A 1HD5A 1BW4A 2HCZX 1OA9A 2BH0A 1OA7A 5GM9A 2PI8A 3SULA 3M3GA 1BW3A 2PICA 3X2GA 3X2HA 2G5DA 2KQAA 2G6GA 4FFTA 4FERA 3SUJA 5H4UA 2PJJA 4JS7A 4JP7A 3SUKA 4FG4A 1WC2A 3X2LA 4ENGA 3X2OA
chains in the Genus database with same CATH superfamily
4L48A 1QRUA 3HU3A 3PIOS 1E32A 3GTKA 4KO8A 2R7ZA 1QRTA 4JP6A 3AIIA 4QIWA 2B63A 1QCSA 3CZBA 3QC8A 5B6CA 5GLYA 3W2WB 1Y4ZA 3GTJA 3ENGA 2Y0SA 3FKIA 5HL7S 3X2PA 4J3CA 2ENGA 3QQ7A 4AVRA 1G8KA 1H5NA 1KQGA 1I3QA 3GTMA 2E2IA 2E7ZA 2JIPA 1D6KA 1UDXA 1EUYA 1NYLA 1TWCA 3O5AA 1OA9A 1VC3B 1NXZA 5GM9A 4WFBS 2PICA 2DMRA 3X2GA 4AAYA 5T5ID 2CX8A 5JVHS 5C18A 4KDIA 2NVXA 4FFTA 1AA6A 1TWGA 2A68D 3CQZA 2O5JD 1UHDA 4JP7A 5GAGW 1Y1VA 4ENGA 4IOAS 1PQFA 1CZ5A 4JXZA 1ZC1A 1DFUP 3X2NA 2R93A 4WF9S 5GLXA 4IOCS 1B75A 5FTLA 2RD2A 1E18A 3ML1A 3DMRA 2JA7A 2V3VA 4KODA 3PIPS 4AZDA 1QRSA 1V6ZA 1DMRA 1SFOA 3GTPA 5T5MD 4AONB 4WFAS 4WFNS 4GA5A 2HZ7A 1O0CA 2HCZX 2RE8A 4GA6A 1PYUB 3GTLA 1QTQA 3SULA 2WAQA 1VHYA 2VPZA 1BW3A 1VHKA 3QQ8A 5DM7S 3X2HA 2KQAA 4P2BA 2VPYA 4C2MA 3H0GA 1TWHA 2NAPA 2PJJA 2E2HA 3DLLS 1E5VA 4CRYG 3X2MA 3HU1A 1GTRA 3PLXB 1SMYD 3OUGA 1WCMA 3X2JA 1ZJWA 5DYGA 1L8FA 1QDNA 5DYIA 2NVYA 5IZNA 5GAHW 2A6HD 2WB1A 2KI8A 4KLNA 1OGYA 2VPWA 2JIOA 1R9TA 5GADW 4V194 1PT1A 3X2IA 4FG2A 3SUMA 2PJHB 4JYZA 1TMOA 2A6ED 2GAEA 2IV2X 2NYAA 4WCES 4H3SA 3GTOA 4JCWA 1E61A 1YLEA 2AE0X 2PMZA 2VPXA 3D30A 2YU9A 4IO9S 1HD5A 2EEOB 1FEUA 1CZ4A 1YNJD 4KDLA 1K83A 1PPYA 2JA5A 3IR7A 2ZJRS 2NWAA 2A69D 1OA7A 2JIRA 3IR6A 4RV0A 4AOKB 1Y1WA 1Z85A 2JIQA 1FDOA 5GLFA 4CRZA 2ZJPS 4JXXA 1DMSA 1AW8B 1TWFA 2G6GA 2EGVA 1PQEA 4FERA 3SUJA 4AYBA 1E60A 2V45A 1R27A 3SUKA 4FG4A 3GTGA 1WLFA 3IR5A 1UHEA 3QWZA 1I50A 2VUMA 4D7ZB 5C1BA 3GTQA 5GAEW 2ZJQS 4NOHA 1IW7D 1R7RA 2PNWA 4JJOA 3J7ZV 1Q16A 2BE5D 2C45A 1Y5IA 1PT0A 3X2KA 5FTNA 3CF5S 1S3SA 1N10A 1O0BA 2Z0YA 3HU2A 5DM6S 2CW0D 1KQFA 1EU1A 2R92A 3TIWA 2YUJA 4DMRA 4ZM7A 4U67S 1YNND 4H4KA 1H0HA 1BW4A 1EXDA 5EPPA 2JA6A 4UY88 5FTMA 2BH0A 1SIWA 1CR5A 1TWAA 3HKZA 4E8BA 3W2VB 2PI8A 5BNZA 1FDIA 3M3GA 1ZYRD 5FTJA 1EUQA 3CF2A 2EGWA 2G5DA 3X1LB 1PQHA 3KW2A 4L69A 5JVGS 1G8JA 2JIMA 1PYQA 5H4UA 4CS0A 4JS7A 1WC2A 1GTSA 3X2LA 3TM7B 3X2OA 5FTKA
chains in the Genus database with same CATH topology
4L48A 3HU3A 1E32A 3GTKA 4KO8A 2R7ZA 4JP6A 4QIWA 2B63A 3CZBA 1QCSA 3QC8A 5B6CA 5GLYA 1Y4ZA 3GTJA 3ENGA 2Y0SA 3FKIA 3X2PA 2ENGA 4AVRA 3QQ7A 1H5NA 1G8KA 1KQGA 1I3QA 3GTMA 2E2IA 2E7ZA 2JIPA 1TWCA 3O5AA 1OA9A 1VC3B 5GM9A 2PICA 3X2GA 2DMRA 4AAYA 5T5ID 5C18A 4KDIA 2NVXA 4FFTA 1AA6A 1TWGA 2A68D 3CQZA 2O5JD 1UHDA 4JP7A 4ENGA 1Y1VA 1PQFA 1CZ5A 1ZC1A 3X2NA 2R93A 5GLXA 5FTLA 1E18A 3ML1A 3DMRA 2JA7A 2V3VA 4KODA 4AZDA 1DMRA 1SFOA 3GTPA 5T5MD 4AONB 4GA5A 2HCZX 4GA6A 1PYUB 3GTLA 3SULA 2WAQA 2VPZA 1BW3A 3QQ8A 3X2HA 2KQAA 2VPYA 4C2MA 3H0GA 1TWHA 2PJJA 2NAPA 2E2HA 1E5VA 4CRYG 3X2MA 3HU1A 3PLXB 1SMYD 3X2JA 1WCMA 3OUGA 5DYGA 1L8FA 1QDNA 5DYIA 2NVYA 2A6HD 2WB1A 2KI8A 4KLNA 1OGYA 2VPWA 2JIOA 1R9TA 1PT1A 3X2IA 4FG2A 3SUMA 2PJHB 1TMOA 2A6ED 2GAEA 2IV2X 2NYAA 3GTOA 4JCWA 1E61A 1YLEA 2AE0X 3D30A 2PMZA 2VPXA 2YU9A 1HD5A 2EEOB 1CZ4A 1YNJD 4KDLA 1K83A 1PPYA 2JA5A 3IR7A 2A69D 1OA7A 2JIRA 3IR6A 4RV0A 4AOKB 1Y1WA 2JIQA 1FDOA 5GLFA 4CRZA 1DMSA 2G6GA 1AW8B 1TWFA 1PQEA 4FERA 3SUJA 4AYBA 3SUKA 1E60A 1R27A 2V45A 4FG4A 3GTGA 1WLFA 3IR5A 1UHEA 3QWZA 1I50A 2VUMA 4D7ZB 5C1BA 3GTQA 4NOHA 1IW7D 1R7RA 2PNWA 4JJOA 1Q16A 3X2KA 2C45A 2BE5D 1PT0A 1Y5IA 5FTNA 1S3SA 1N10A 3HU2A 2CW0D 1KQFA 1EU1A 2R92A 3TIWA 2YUJA 4DMRA 4ZM7A 1YNND 1BW4A 1H0HA 5EPPA 2JA6A 5FTMA 2BH0A 1SIWA 1CR5A 1TWAA 3HKZA 2PI8A 3M3GA 1FDIA 1ZYRD 5FTJA 3CF2A 2G5DA 1PQHA 1G8JA 2JIMA 1PYQA 5H4UA 4CS0A 4JS7A 1WC2A 3X2LA 3TM7B 3X2OA 5FTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L48 A;  3X2J A;  3X2N A;  5GLX A;  3X2M A;  2PNW A;  1L8F A;  4JJO A;  4JP6 A;  3X2K A;  3CZB A;  1N10 A;  5GLY A;  3X2I A;  4FG2 A;  3ENG A;  3SUM A;  2GAE A;  4JCW A;  3X2P A;  2AE0 X;  3D30 A;  2ENG A;  4AVR A;  4ZM7 A;  1HD5 A;  1BW4 A;  2HCZ X;  1OA9 A;  2BH0 A;  1OA7 A;  5GM9 A;  2PI8 A;  3SUL A;  3M3G A;  1BW3 A;  2PIC A;  3X2G A;  3X2H A;  2G5D A;  2KQA A;  2G6G A;  4FFT A;  4FER A;  3SUJ A;  5H4U A;  2PJJ A;  4JS7 A;  4JP7 A;  3SUK A;  4FG4 A;  1WC2 A;  3X2L A;  4ENG A;  3X2O A; 
#chains in the Genus database with same CATH topology
 4L48 A;  1QRU A;  3HU3 A;  3PIO S;  1E32 A;  3GTK A;  4KO8 A;  2R7Z A;  1QRT A;  4JP6 A;  3AII A;  4QIW A;  2B63 A;  1QCS A;  3CZB A;  3QC8 A;  5B6C A;  5GLY A;  3W2W B;  1Y4Z A;  3GTJ A;  3ENG A;  2Y0S A;  3FKI A;  5HL7 S;  3X2P A;  4J3C A;  2ENG A;  3QQ7 A;  4AVR A;  1G8K A;  1H5N A;  1KQG A;  1I3Q A;  3GTM A;  2E2I A;  2E7Z A;  2JIP A;  1D6K A;  1UDX A;  1EUY A;  1NYL A;  1TWC A;  3O5A A;  1OA9 A;  1VC3 B;  1NXZ A;  5GM9 A;  4WFB S;  2PIC A;  2DMR A;  3X2G A;  4AAY A;  5T5I D;  2CX8 A;  5JVH S;  5C18 A;  4KDI A;  2NVX A;  4FFT A;  1AA6 A;  1TWG A;  2A68 D;  3CQZ A;  2O5J D;  1UHD A;  4JP7 A;  5GAG W;  1Y1V A;  4ENG A;  4IOA S;  1PQF A;  1CZ5 A;  4JXZ A;  1ZC1 A;  1DFU P;  3X2N A;  2R93 A;  4WF9 S;  5GLX A;  4IOC S;  1B75 A;  5FTL A;  2RD2 A;  1E18 A;  3ML1 A;  3DMR A;  2JA7 A;  2V3V A;  4KOD A;  3PIP S;  4AZD A;  1QRS A;  1V6Z A;  1DMR A;  1SFO A;  3GTP A;  5T5M D;  4AON B;  4WFA S;  4WFN S;  4GA5 A;  2HZ7 A;  1O0C A;  2HCZ X;  2RE8 A;  4GA6 A;  1PYU B;  3GTL A;  1QTQ A;  3SUL A;  2WAQ A;  1VHY A;  2VPZ A;  1BW3 A;  1VHK A;  3QQ8 A;  5DM7 S;  3X2H A;  2KQA A;  4P2B A;  2VPY A;  4C2M A;  3H0G A;  1TWH A;  2NAP A;  2PJJ A;  2E2H A;  3DLL S;  1E5V A;  4CRY G;  3X2M A;  3HU1 A;  1GTR A;  3PLX B;  1SMY D;  3OUG A;  1WCM A;  3X2J A;  1ZJW A;  5DYG A;  1L8F A;  1QDN A;  5DYI A;  2NVY A;  5IZN A;  5GAH W;  2A6H D;  2WB1 A;  2KI8 A;  4KLN A;  1OGY A;  2VPW A;  2JIO A;  1R9T A;  5GAD W;  4V19 4;  1PT1 A;  3X2I A;  4FG2 A;  3SUM A;  2PJH B;  4JYZ A;  1TMO A;  2A6E D;  2GAE A;  2IV2 X;  2NYA A;  4WCE S;  4H3S A;  3GTO A;  4JCW A;  1E61 A;  1YLE A;  2AE0 X;  2PMZ A;  2VPX A;  3D30 A;  2YU9 A;  4IO9 S;  1HD5 A;  2EEO B;  1FEU A;  1CZ4 A;  1YNJ D;  4KDL A;  1K83 A;  1PPY A;  2JA5 A;  3IR7 A;  2ZJR S;  2NWA A;  2A69 D;  1OA7 A;  2JIR A;  3IR6 A;  4RV0 A;  4AOK B;  1Y1W A;  1Z85 A;  2JIQ A;  1FDO A;  5GLF A;  4CRZ A;  2ZJP S;  4JXX A;  1DMS A;  1AW8 B;  1TWF A;  2G6G A;  2EGV A;  1PQE A;  4FER A;  3SUJ A;  4AYB A;  1E60 A;  2V45 A;  1R27 A;  3SUK A;  4FG4 A;  3GTG A;  1WLF A;  3IR5 A;  1UHE A;  3QWZ A;  1I50 A;  2VUM A;  4D7Z B;  5C1B A;  3GTQ A;  5GAE W;  2ZJQ S;  4NOH A;  1IW7 D;  1R7R A;  2PNW A;  4JJO A;  3J7Z V;  1Q16 A;  2BE5 D;  2C45 A;  1Y5I A;  1PT0 A;  3X2K A;  5FTN A;  3CF5 S;  1S3S A;  1N10 A;  1O0B A;  2Z0Y A;  3HU2 A;  5DM6 S;  2CW0 D;  1KQF A;  1EU1 A;  2R92 A;  3TIW A;  2YUJ A;  4DMR A;  4ZM7 A;  4U67 S;  1YNN D;  4H4K A;  1H0H A;  1BW4 A;  1EXD A;  5EPP A;  2JA6 A;  4UY8 8;  5FTM A;  2BH0 A;  1SIW A;  1CR5 A;  1TWA A;  3HKZ A;  4E8B A;  3W2V B;  2PI8 A;  5BNZ A;  1FDI A;  3M3G A;  1ZYR D;  5FTJ A;  1EUQ A;  3CF2 A;  2EGW A;  2G5D A;  3X1L B;  1PQH A;  3KW2 A;  4L69 A;  5JVG S;  1G8J A;  2JIM A;  1PYQ A;  5H4U A;  4CS0 A;  4JS7 A;  1WC2 A;  1GTS A;  3X2L A;  3TM7 B;  3X2O A;  5FTK A; 
#chains in the Genus database with same CATH homology
 4L48 A;  3HU3 A;  1E32 A;  3GTK A;  4KO8 A;  2R7Z A;  4JP6 A;  4QIW A;  2B63 A;  3CZB A;  1QCS A;  3QC8 A;  5B6C A;  5GLY A;  1Y4Z A;  3GTJ A;  3ENG A;  2Y0S A;  3FKI A;  3X2P A;  2ENG A;  4AVR A;  3QQ7 A;  1H5N A;  1G8K A;  1KQG A;  1I3Q A;  3GTM A;  2E2I A;  2E7Z A;  2JIP A;  1TWC A;  3O5A A;  1OA9 A;  1VC3 B;  5GM9 A;  2PIC A;  3X2G A;  2DMR A;  4AAY A;  5T5I D;  5C18 A;  4KDI A;  2NVX A;  4FFT A;  1AA6 A;  1TWG A;  2A68 D;  3CQZ A;  2O5J D;  1UHD A;  4JP7 A;  4ENG A;  1Y1V A;  1PQF A;  1CZ5 A;  1ZC1 A;  3X2N A;  2R93 A;  5GLX A;  5FTL A;  1E18 A;  3ML1 A;  3DMR A;  2JA7 A;  2V3V A;  4KOD A;  4AZD A;  1DMR A;  1SFO A;  3GTP A;  5T5M D;  4AON B;  4GA5 A;  2HCZ X;  4GA6 A;  1PYU B;  3GTL A;  3SUL A;  2WAQ A;  2VPZ A;  1BW3 A;  3QQ8 A;  3X2H A;  2KQA A;  2VPY A;  4C2M A;  3H0G A;  1TWH A;  2PJJ A;  2NAP A;  2E2H A;  1E5V A;  4CRY G;  3X2M A;  3HU1 A;  3PLX B;  1SMY D;  3X2J A;  1WCM A;  3OUG A;  5DYG A;  1L8F A;  1QDN A;  5DYI A;  2NVY A;  2A6H D;  2WB1 A;  2KI8 A;  4KLN A;  1OGY A;  2VPW A;  2JIO A;  1R9T A;  1PT1 A;  3X2I A;  4FG2 A;  3SUM A;  2PJH B;  1TMO A;  2A6E D;  2GAE A;  2IV2 X;  2NYA A;  3GTO A;  4JCW A;  1E61 A;  1YLE A;  2AE0 X;  3D30 A;  2PMZ A;  2VPX A;  2YU9 A;  1HD5 A;  2EEO B;  1CZ4 A;  1YNJ D;  4KDL A;  1K83 A;  1PPY A;  2JA5 A;  3IR7 A;  2A69 D;  1OA7 A;  2JIR A;  3IR6 A;  4RV0 A;  4AOK B;  1Y1W A;  2JIQ A;  1FDO A;  5GLF A;  4CRZ A;  1DMS A;  2G6G A;  1AW8 B;  1TWF A;  1PQE A;  4FER A;  3SUJ A;  4AYB A;  3SUK A;  1E60 A;  1R27 A;  2V45 A;  4FG4 A;  3GTG A;  1WLF A;  3IR5 A;  1UHE A;  3QWZ A;  1I50 A;  2VUM A;  4D7Z B;  5C1B A;  3GTQ A;  4NOH A;  1IW7 D;  1R7R A;  2PNW A;  4JJO A;  1Q16 A;  3X2K A;  2C45 A;  2BE5 D;  1PT0 A;  1Y5I A;  5FTN A;  1S3S A;  1N10 A;  3HU2 A;  2CW0 D;  1KQF A;  1EU1 A;  2R92 A;  3TIW A;  2YUJ A;  4DMR A;  4ZM7 A;  1YNN D;  1BW4 A;  1H0H A;  5EPP A;  2JA6 A;  5FTM A;  2BH0 A;  1SIW A;  1CR5 A;  1TWA A;  3HKZ A;  2PI8 A;  3M3G A;  1FDI A;  1ZYR D;  5FTJ A;  3CF2 A;  2G5D A;  1PQH A;  1G8J A;  2JIM A;  1PYQ A;  5H4U A;  4CS0 A;  4JS7 A;  1WC2 A;  3X2L A;  3TM7 B;  3X2O A;  5FTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...