3CZBA

Crystal structure of putative transglycosylase from caulobacter crescentus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
338
structure length
325
Chain Sequence
b'MPAALSFAGLAGWAEEDHLAALNAFRAGCGVSKDPAAARVCGLAKATKDLDVSGAKAFIEANFRVEAVDGGGDGLLTAYFAPQYEARMSRNAEFSAPLRGLPADLVVLDLGPFEPALVGKKITGHVEGSTFVPYPDRAEIEATPSDKPLAWMRPEELFFLQIQGSGVLVLPDGRRVRAVFAGTNGKPFVGIAIAMRDKGLLADAIRTWLAEHRGPEADAIMRLNPRYVFFRTVPDDGKEPAGAAGVALPPGRAIAVDPGYHAYGGFYWLDAAFPVYRRAVTALDTGGAIKGEVRADLYMGSGAVAGVEAGRVRHTLRLYRLTPNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transglycosylase
publication title Crystal structure of putative transglycosylase from Caulobacter crescentus.
rcsb
source organism Caulobacter crescentus
molecule tags Structural genomics, unknown function
total genus 85
structure length 325
sequence length 338
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3czbA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 3czbA02
3X2HA 4ENGA 1HD5A 3SUJA 1L8FA 2BH0A 3X2IA 1BW4A 2G6GA 3X2NA 2KQAA 2GAEA 2PNWA 4FG2A 3SUMA 2PI8A 1BW3A 5GM9A 5GLYA 2ENGA 3X2OA 3ENGA 3X2LA 5H4UA 2AE0X 2PICA 3X2KA 4FG4A 2PJJA 4L48A 3CZBA 1OA9A 3D30A 3SUKA 1OA7A 4FFTA 3X2MA 3M3GA 3X2GA 2HCZX 4JP7A 3X2JA 4JS7A 1N10A 5GLXA 4JP6A 4AVRA 4JJOA 4ZM7A 4FERA 4JCWA 2G5DA 1WC2A 3X2PA 3SULA
chains in the Genus database with same CATH superfamily
4KDIA 3SUJA 1PT0A 2A6ED 1R7RA 4KODA 3X2NA 1TWAA 2KQAA 5C18A 2V45A 2R7ZA 2ZJQS 2NVXA 2JA7A 2A6HD 2CW0D 4DMRA 3J7ZV 2EGWA 5BNZA 3PIOS 2R93A 2WAQA 1YNND 2PJHB 1QRUA 3ENGA 2NWAA 2JIQA 1IW7D 4H4KA 2AE0X 3X2KA 3QQ8A 4RV0A 1E60A 1G8KA 4WF9S 2PJJA 1I50A 1PYQA 5GAHW 3SUKA 3GTJA 1R27A 4UY88 2EEOB 2YUJA 1QCSA 1SIWA 1UDXA 1FDIA 3GTOA 3PIPS 2KI8A 3OUGA 2VPXA 4D7ZB 3QC8A 5DYIA 1WLFA 3GTQA 3TIWA 3GTMA 1NXZA 2A68D 5DM7S 1OGYA 4JJOA 2IV2X 4FERA 2G5DA 1WC2A 1UHDA 4JXZA 4J3CA 2JIRA 4WFNS 4L69A 4GA5A 2CX8A 4H3SA 2O5JD 4V194 2GAEA 5JVGS 2JA5A 1V6ZA 4P2BA 3SUMA 2JIPA 1YLEA 1QRSA 1CR5A 3HU1A 2YU9A 2BE5D 1E5VA 4WFAS 2ZJPS 1FDOA 5H4UA 5B6CA 2PICA 4U67S 4AOKB 2DMRA 1WCMA 4KLNA 1I3QA 1D6KA 3QWZA 1H0HA 2NVYA 4L48A 1SFOA 2VUMA 1TMOA 1TWGA 1AW8B 2V3VA 5GLFA 1S3SA 1TWFA 2JIOA 4C2MA 5GAEW 5DM6S 3DLLS 4IOCS 2E2IA 2NAPA 4WCES 3X2GA 2HCZX 4JP7A 3X2JA 3GTGA 4KDLA 3KW2A 5HL7S 4JS7A 2E2HA 1Z85A 3IR7A 5T5MD 1G8JA 2WB1A 1O0BA 3X2MA 1PQEA 3X2HA 4AAYA 5FTMA 4CRYG 1L8FA 2BH0A 3X2IA 2ZJRS 1EUQA 2G6GA 3TM7B 1VHYA 1EXDA 1QRTA 4QIWA 1PQFA 1K83A 4AZDA 1CZ5A 1EUYA 4NOHA 3HKZA 3H0GA 5DYGA 1TWHA 1YNJD 2PI8A 1TWCA 2R92A 2NYAA 2VPYA 1E61A 2ENGA 5GLYA 1E18A 3X2LA 2RD2A 1ZYRD 1PQHA 2VPZA 5IZNA 3GTLA 1R9TA 4FG4A 1UHEA 2PMZA 5FTJA 4WFBS 3W2VB 3D30A 1OA9A 5EPPA 5C1BA 4AONB 1VHKA 1KQGA 2RE8A 1FEUA 5T5ID 2HZ7A 3CF5S 1DMRA 3M3GA 3ML1A 1EU1A 1SMYD 5GLXA 4JP6A 4AVRA 1GTSA 1QTQA 1H5NA 1B75A 1ZJWA 3PLXB 4ENGA 1HD5A 1ZC1A 1BW4A 1AA6A 5GADW 3HU3A 2PNWA 1Y5IA 5FTNA 1Y4ZA 4FG2A 3W2WB 4KO8A 4GA6A 4CRZA 3HU2A 1DMSA 2JA6A 2Z0YA 1PT1A 1BW3A 5GAGW 5GM9A 1E32A 1Y1WA 5FTKA 3X2OA 1DFUP 2Y0SA 4CS0A 1QDNA 1PYUB 1O0CA 3GTPA 3CF2A 3O5AA 3CQZA 3AIIA 5JVHS 3IR5A 3CZBA 3IR6A 2A69D 1Y1VA 2E7ZA 2B63A 2JIMA 1VC3B 1KQFA 3GTKA 1OA7A 1NYLA 4E8BA 4JYZA 4AYBA 2VPWA 2C45A 5FTLA 1CZ4A 2EGVA 1PPYA 1N10A 3DMRA 3QQ7A 1Q16A 3FKIA 4JXXA 4IO9S 4ZM7A 1GTRA 4IOAS 4JCWA 4FFTA 3X2PA 3SULA 3X1LB
chains in the Genus database with same CATH topology
4KDIA 3SUJA 1PT0A 2A6ED 1R7RA 4KODA 3X2NA 2KQAA 1TWAA 5C18A 2V45A 2R7ZA 2NVXA 2JA7A 2A6HD 2CW0D 4DMRA 2R93A 2WAQA 1YNND 2PJHB 3ENGA 2JIQA 1IW7D 2AE0X 3X2KA 3QQ8A 4RV0A 1E60A 1G8KA 2PJJA 1I50A 1PYQA 3GTJA 1R27A 2EEOB 2YUJA 1QCSA 1SIWA 1FDIA 3GTOA 2KI8A 3OUGA 2VPXA 4D7ZB 3QC8A 5DYIA 1WLFA 3GTQA 3TIWA 3GTMA 2A68D 4JJOA 1OGYA 2IV2X 4FERA 2G5DA 1WC2A 1UHDA 2JIRA 4GA5A 2O5JD 2GAEA 2JA5A 3SUMA 2JIPA 1YLEA 1CR5A 3HU1A 2YU9A 2BE5D 1E5VA 1FDOA 5H4UA 5B6CA 2PICA 4AOKB 2DMRA 1WCMA 4KLNA 1I3QA 3QWZA 1H0HA 4L48A 2NVYA 1SFOA 2VUMA 1TMOA 1TWGA 1AW8B 2V3VA 5GLFA 1S3SA 1TWFA 2JIOA 4C2MA 2E2IA 4FFTA 2NAPA 3X2GA 2HCZX 4JP7A 3X2JA 3GTGA 4KDLA 4JS7A 2E2HA 3IR7A 5T5MD 1G8JA 2WB1A 3X2MA 1PQEA 3X2HA 4AAYA 5FTMA 4CRYG 1L8FA 2BH0A 3X2IA 2G6GA 3TM7B 4QIWA 1PQFA 1K83A 4AZDA 1CZ5A 4NOHA 3HKZA 3H0GA 5DYGA 1TWHA 1YNJD 2PI8A 1TWCA 2R92A 2NYAA 5GLYA 2ENGA 1E61A 2VPYA 1E18A 3X2LA 1ZYRD 1PQHA 2VPZA 3GTLA 1R9TA 4FG4A 1UHEA 2PMZA 5FTJA 3D30A 1OA9A 5EPPA 5C1BA 4AONB 1KQGA 5T5ID 1DMRA 3M3GA 3ML1A 1EU1A 1SMYD 5GLXA 4JP6A 4AVRA 1H5NA 4ENGA 3PLXB 1HD5A 1ZC1A 1BW4A 1AA6A 3HU3A 2PNWA 1Y5IA 5FTNA 1Y4ZA 4FG2A 4KO8A 4GA6A 4CRZA 3HU2A 1DMSA 2JA6A 1PT1A 1BW3A 5GM9A 1E32A 1Y1WA 5FTKA 3X2OA 2Y0SA 4CS0A 1QDNA 1PYUB 3GTPA 3CF2A 3O5AA 3CQZA 3IR5A 3CZBA 3IR6A 2A69D 1Y1VA 2E7ZA 2B63A 2JIMA 1VC3B 1KQFA 3GTKA 1OA7A 4AYBA 2VPWA 2C45A 5FTLA 1CZ4A 1PPYA 1N10A 3DMRA 3QQ7A 1Q16A 3FKIA 4ZM7A 4JCWA 3SUKA 3X2PA 3SULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2H A;  4ENG A;  1HD5 A;  3SUJ A;  1L8F A;  2BH0 A;  3X2I A;  1BW4 A;  2G6G A;  3X2N A;  2KQA A;  2GAE A;  2PNW A;  4FG2 A;  3SUM A;  2PI8 A;  1BW3 A;  5GM9 A;  5GLY A;  2ENG A;  3X2O A;  3ENG A;  3X2L A;  5H4U A;  2AE0 X;  2PIC A;  3X2K A;  4FG4 A;  2PJJ A;  4L48 A;  3CZB A;  1OA9 A;  3D30 A;  3SUK A;  1OA7 A;  4FFT A;  3X2M A;  3M3G A;  3X2G A;  2HCZ X;  4JP7 A;  3X2J A;  4JS7 A;  1N10 A;  5GLX A;  4JP6 A;  4AVR A;  4JJO A;  4ZM7 A;  4FER A;  4JCW A;  2G5D A;  1WC2 A;  3X2P A;  3SUL A; 
#chains in the Genus database with same CATH topology
 4KDI A;  3SUJ A;  1PT0 A;  2A6E D;  1R7R A;  4KOD A;  3X2N A;  1TWA A;  2KQA A;  5C18 A;  2V45 A;  2R7Z A;  2ZJQ S;  2NVX A;  2JA7 A;  2A6H D;  2CW0 D;  4DMR A;  3J7Z V;  2EGW A;  5BNZ A;  3PIO S;  2R93 A;  2WAQ A;  1YNN D;  2PJH B;  1QRU A;  3ENG A;  2NWA A;  2JIQ A;  1IW7 D;  4H4K A;  2AE0 X;  3X2K A;  3QQ8 A;  4RV0 A;  1E60 A;  1G8K A;  4WF9 S;  2PJJ A;  1I50 A;  1PYQ A;  5GAH W;  3SUK A;  3GTJ A;  1R27 A;  4UY8 8;  2EEO B;  2YUJ A;  1QCS A;  1SIW A;  1UDX A;  1FDI A;  3GTO A;  3PIP S;  2KI8 A;  3OUG A;  2VPX A;  4D7Z B;  3QC8 A;  5DYI A;  1WLF A;  3GTQ A;  3TIW A;  3GTM A;  1NXZ A;  2A68 D;  5DM7 S;  1OGY A;  4JJO A;  2IV2 X;  4FER A;  2G5D A;  1WC2 A;  1UHD A;  4JXZ A;  4J3C A;  2JIR A;  4WFN S;  4L69 A;  4GA5 A;  2CX8 A;  4H3S A;  2O5J D;  4V19 4;  2GAE A;  5JVG S;  2JA5 A;  1V6Z A;  4P2B A;  3SUM A;  2JIP A;  1YLE A;  1QRS A;  1CR5 A;  3HU1 A;  2YU9 A;  2BE5 D;  1E5V A;  4WFA S;  2ZJP S;  1FDO A;  5H4U A;  5B6C A;  2PIC A;  4U67 S;  4AOK B;  2DMR A;  1WCM A;  4KLN A;  1I3Q A;  1D6K A;  3QWZ A;  1H0H A;  2NVY A;  4L48 A;  1SFO A;  2VUM A;  1TMO A;  1TWG A;  1AW8 B;  2V3V A;  5GLF A;  1S3S A;  1TWF A;  2JIO A;  4C2M A;  5GAE W;  5DM6 S;  3DLL S;  4IOC S;  2E2I A;  2NAP A;  4WCE S;  3X2G A;  2HCZ X;  4JP7 A;  3X2J A;  3GTG A;  4KDL A;  3KW2 A;  5HL7 S;  4JS7 A;  2E2H A;  1Z85 A;  3IR7 A;  5T5M D;  1G8J A;  2WB1 A;  1O0B A;  3X2M A;  1PQE A;  3X2H A;  4AAY A;  5FTM A;  4CRY G;  1L8F A;  2BH0 A;  3X2I A;  2ZJR S;  1EUQ A;  2G6G A;  3TM7 B;  1VHY A;  1EXD A;  1QRT A;  4QIW A;  1PQF A;  1K83 A;  4AZD A;  1CZ5 A;  1EUY A;  4NOH A;  3HKZ A;  3H0G A;  5DYG A;  1TWH A;  1YNJ D;  2PI8 A;  1TWC A;  2R92 A;  2NYA A;  2VPY A;  1E61 A;  2ENG A;  5GLY A;  1E18 A;  3X2L A;  2RD2 A;  1ZYR D;  1PQH A;  2VPZ A;  5IZN A;  3GTL A;  1R9T A;  4FG4 A;  1UHE A;  2PMZ A;  5FTJ A;  4WFB S;  3W2V B;  3D30 A;  1OA9 A;  5EPP A;  5C1B A;  4AON B;  1VHK A;  1KQG A;  2RE8 A;  1FEU A;  5T5I D;  2HZ7 A;  3CF5 S;  1DMR A;  3M3G A;  3ML1 A;  1EU1 A;  1SMY D;  5GLX A;  4JP6 A;  4AVR A;  1GTS A;  1QTQ A;  1H5N A;  1B75 A;  1ZJW A;  3PLX B;  4ENG A;  1HD5 A;  1ZC1 A;  1BW4 A;  1AA6 A;  5GAD W;  3HU3 A;  2PNW A;  1Y5I A;  5FTN A;  1Y4Z A;  4FG2 A;  3W2W B;  4KO8 A;  4GA6 A;  4CRZ A;  3HU2 A;  1DMS A;  2JA6 A;  2Z0Y A;  1PT1 A;  1BW3 A;  5GAG W;  5GM9 A;  1E32 A;  1Y1W A;  5FTK A;  3X2O A;  1DFU P;  2Y0S A;  4CS0 A;  1QDN A;  1PYU B;  1O0C A;  3GTP A;  3CF2 A;  3O5A A;  3CQZ A;  3AII A;  5JVH S;  3IR5 A;  3CZB A;  3IR6 A;  2A69 D;  1Y1V A;  2E7Z A;  2B63 A;  2JIM A;  1VC3 B;  1KQF A;  3GTK A;  1OA7 A;  1NYL A;  4E8B A;  4JYZ A;  4AYB A;  2VPW A;  2C45 A;  5FTL A;  1CZ4 A;  2EGV A;  1PPY A;  1N10 A;  3DMR A;  3QQ7 A;  1Q16 A;  3FKI A;  4JXX A;  4IO9 S;  4ZM7 A;  1GTR A;  4IOA S;  4JCW A;  4FFT A;  3X2P A;  3SUL A;  3X1L B; 
#chains in the Genus database with same CATH homology
 4KDI A;  3SUJ A;  1PT0 A;  2A6E D;  1R7R A;  4KOD A;  3X2N A;  2KQA A;  1TWA A;  5C18 A;  2V45 A;  2R7Z A;  2NVX A;  2JA7 A;  2A6H D;  2CW0 D;  4DMR A;  2R93 A;  2WAQ A;  1YNN D;  2PJH B;  3ENG A;  2JIQ A;  1IW7 D;  2AE0 X;  3X2K A;  3QQ8 A;  4RV0 A;  1E60 A;  1G8K A;  2PJJ A;  1I50 A;  1PYQ A;  3GTJ A;  1R27 A;  2EEO B;  2YUJ A;  1QCS A;  1SIW A;  1FDI A;  3GTO A;  2KI8 A;  3OUG A;  2VPX A;  4D7Z B;  3QC8 A;  5DYI A;  1WLF A;  3GTQ A;  3TIW A;  3GTM A;  2A68 D;  4JJO A;  1OGY A;  2IV2 X;  4FER A;  2G5D A;  1WC2 A;  1UHD A;  2JIR A;  4GA5 A;  2O5J D;  2GAE A;  2JA5 A;  3SUM A;  2JIP A;  1YLE A;  1CR5 A;  3HU1 A;  2YU9 A;  2BE5 D;  1E5V A;  1FDO A;  5H4U A;  5B6C A;  2PIC A;  4AOK B;  2DMR A;  1WCM A;  4KLN A;  1I3Q A;  3QWZ A;  1H0H A;  4L48 A;  2NVY A;  1SFO A;  2VUM A;  1TMO A;  1TWG A;  1AW8 B;  2V3V A;  5GLF A;  1S3S A;  1TWF A;  2JIO A;  4C2M A;  2E2I A;  4FFT A;  2NAP A;  3X2G A;  2HCZ X;  4JP7 A;  3X2J A;  3GTG A;  4KDL A;  4JS7 A;  2E2H A;  3IR7 A;  5T5M D;  1G8J A;  2WB1 A;  3X2M A;  1PQE A;  3X2H A;  4AAY A;  5FTM A;  4CRY G;  1L8F A;  2BH0 A;  3X2I A;  2G6G A;  3TM7 B;  4QIW A;  1PQF A;  1K83 A;  4AZD A;  1CZ5 A;  4NOH A;  3HKZ A;  3H0G A;  5DYG A;  1TWH A;  1YNJ D;  2PI8 A;  1TWC A;  2R92 A;  2NYA A;  5GLY A;  2ENG A;  1E61 A;  2VPY A;  1E18 A;  3X2L A;  1ZYR D;  1PQH A;  2VPZ A;  3GTL A;  1R9T A;  4FG4 A;  1UHE A;  2PMZ A;  5FTJ A;  3D30 A;  1OA9 A;  5EPP A;  5C1B A;  4AON B;  1KQG A;  5T5I D;  1DMR A;  3M3G A;  3ML1 A;  1EU1 A;  1SMY D;  5GLX A;  4JP6 A;  4AVR A;  1H5N A;  4ENG A;  3PLX B;  1HD5 A;  1ZC1 A;  1BW4 A;  1AA6 A;  3HU3 A;  2PNW A;  1Y5I A;  5FTN A;  1Y4Z A;  4FG2 A;  4KO8 A;  4GA6 A;  4CRZ A;  3HU2 A;  1DMS A;  2JA6 A;  1PT1 A;  1BW3 A;  5GM9 A;  1E32 A;  1Y1W A;  5FTK A;  3X2O A;  2Y0S A;  4CS0 A;  1QDN A;  1PYU B;  3GTP A;  3CF2 A;  3O5A A;  3CQZ A;  3IR5 A;  3CZB A;  3IR6 A;  2A69 D;  1Y1V A;  2E7Z A;  2B63 A;  2JIM A;  1VC3 B;  1KQF A;  3GTK A;  1OA7 A;  4AYB A;  2VPW A;  2C45 A;  5FTL A;  1CZ4 A;  1PPY A;  1N10 A;  3DMR A;  3QQ7 A;  1Q16 A;  3FKI A;  4ZM7 A;  4JCW A;  3SUK A;  3X2P A;  3SUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...