3CZBA

Crystal structure of putative transglycosylase from caulobacter crescentus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
338
structure length
325
Chain Sequence
MPAALSFAGLAGWAEEDHLAALNAFRAGCGVSKDPAAARVCGLAKATKDLDVSGAKAFIEANFRVEAVDGGGDGLLTAYFAPQYEARMSRNAEFSAPLRGLPADLVVLDLGPFEPALVGKKITGHVEGSTFVPYPDRAEIEATPSDKPLAWMRPEELFFLQIQGSGVLVLPDGRRVRAVFAGTNGKPFVGIAIAMRDKGLLADAIRTWLAEHRGPEADAIMRLNPRYVFFRTVPDDGKEPAGAAGVALPPGRAIAVDPGYHAYGGFYWLDAAFPVYRRAVTALDTGGAIKGEVRADLYMGSGAVAGVEAGRVRHTLRLYRLTPNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative transglycosylase from Caulobacter crescentus.
rcsb
source organism Caulobacter crescentus
molecule tags Structural genomics, unknown function
molecule keywords Putative transglycosylase
total genus 85
structure length 325
sequence length 338
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 3czbA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 3czbA02
4FFTA 5GLXA 3X2JA 3SUJA 2BH0A 3M3GA 1BW4A 1HD5A 3X2HA 2PJJA 5GLYA 3X2KA 1N10A 1OA9A 3SULA 4JJOA 3SUKA 4JP6A 4JCWA 1OA7A 3SUMA 5H4UA 3X2LA 4JS7A 3ENGA 3X2NA 4JP7A 3X2IA 1L8FA 4FG2A 2AE0X 3X2PA 5GM9A 2PI8A 4ENGA 4ZM7A 2PNWA 4FG4A 4L48A 1WC2A 3CZBA 3X2OA 2HCZX 4AVRA 4FERA 2ENGA 1BW3A 3X2GA 2GAEA 2G5DA 2G6GA 2PICA 2KQAA 3D30A 3X2MA
chains in the Genus database with same CATH superfamily
1PYQA 4JXXA 2NWAA 5B6CA 4CRZA 3M3GA 4CS0A 1BW4A 5DYIA 1B75A 4NOHA 1SFOA 2PJJA 2Y0SA 2JIPA 1SIWA 4RV0A 2E2HA 1N10A 1OA9A 2CW0D 2R7ZA 5FTLA 2B63A 4JJOA 1UHDA 1DMRA 4JCWA 1OA7A 2EGVA 4H4KA 4IOCS 1O0CA 1PQEA 4C2MA 1IW7D 1E60A 1S3SA 1GTRA 4JP7A 5IZNA 1L8FA 1PYUB 4QIWA 1AW8B 5GAHW 2JIOA 1NYLA 4ENGA 1WLFA 1CZ5A 3W2VB 4JYZA 1I3QA 2BE5D 2R93A 4WFAS 3DLLS 2RE8A 3CZBA 5FTKA 1K83A 2CX8A 3X1LB 2HCZX 3DMRA 2ZJQS 4WF9S 3X2GA 2V3VA 2ZJPS 1E18A 3CF2A 1TWHA 1Y1VA 1TWCA 2G5DA 1CZ4A 3QC8A 5T5MD 3PIPS 1Y1WA 3IR7A 1WCMA 1VHYA 3SUJA 5BNZA 3O5AA 2WAQA 2NYAA 4IOAS 4GA6A 5FTMA 3H0GA 2WB1A 3HU1A 3SULA 1O0BA 4KLNA 2JIRA 5C18A 4IO9S 1FEUA 4AONB 2KI8A 3ENGA 3IR5A 3X2NA 4KO8A 1QCSA 1R7RA 1ZC1A 4J3CA 3W2WB 5JVHS 4WFNS 4V194 5GM9A 2PI8A 1Y5IA 5HL7S 3TM7B 4L48A 4L69A 1DFUP 3CQZA 4AVRA 1EUYA 4FERA 1UHEA 5FTNA 4D7ZB 4AZDA 3QQ8A 3GTLA 1BW3A 5JVGS 2EEOB 1TWFA 4KDLA 2NVXA 3QWZA 1FDOA 1TWAA 2A68D 1KQGA 1KQFA 4E8BA 3X2JA 1ZJWA 3ML1A 1PT0A 3GTQA 1PQFA 2EGWA 1G8JA 1HD5A 1PQHA 1QRUA 5GLYA 3HU2A 3X2KA 3PLXB 5DM6S 4UY88 2DMRA 4KDIA 4GA5A 5GLFA 3SUKA 3SUMA 3IR6A 5H4UA 2E7ZA 1E5VA 2PJHB 4AAYA 3J7ZV 2AE0X 4H3SA 1CR5A 4AOKB 3PIOS 3X2PA 2A6ED 3HU3A 3GTKA 1TWGA 1R9TA 1H0HA 3GTPA 2PNWA 1R27A 4FG4A 5GADW 1QRTA 1QTQA 1V6ZA 2V45A 1OGYA 2VPXA 4AYBA 2JA5A 2ENGA 2JIMA 1Z85A 1TMOA 1EUQA 1ZYRD 3GTJA 1Y4ZA 1QRSA 4JXZA 3OUGA 4P2BA 1EU1A 2PICA 3X2OA 1H5NA 3FKIA 3X2MA 1VHKA 4CRYG 1YLEA 3TIWA 2VUMA 4FFTA 1FDIA 1PPYA 5GLXA 3GTOA 5GAEW 1E61A 2BH0A 2VPWA 5C1BA 2C45A 1YNND 1GTSA 2YU9A 1E32A 3X2HA 1PT1A 2IV2X 2VPZA 1G8KA 2Z0YA 2A69D 2NVYA 2E2IA 2HZ7A 4JP6A 2JA6A 5T5ID 3X2LA 1NXZA 2JA7A 4JS7A 1QDNA 3GTGA 5DM7S 1DMSA 2R92A 5DYGA 3X2IA 3AIIA 1SMYD 3HKZA 1Q16A 1UDXA 2NAPA 3QQ7A 4FG2A 1D6KA 5EPPA 2JIQA 4ZM7A 2YUJA 1YNJD 4WCES 2O5JD 3KW2A 1WC2A 2PMZA 5FTJA 1VC3B 3GTMA 4KODA 5GAGW 2ZJRS 2A6HD 1I50A 4U67S 3CF5S 1AA6A 2RD2A 1EXDA 2GAEA 2VPYA 2G6GA 4WFBS 4DMRA 2KQAA 3D30A
chains in the Genus database with same CATH topology
1PYQA 5B6CA 4CRZA 3M3GA 1BW4A 4CS0A 5DYIA 4NOHA 1SFOA 2PJJA 2Y0SA 2JIPA 1SIWA 4RV0A 2E2HA 1N10A 1OA9A 2CW0D 2R7ZA 5FTLA 2B63A 4JJOA 1UHDA 1DMRA 4JCWA 1OA7A 1PQEA 4C2MA 1IW7D 1E60A 1S3SA 4JP7A 1L8FA 1PYUB 4QIWA 1AW8B 2JIOA 4ENGA 1WLFA 1CZ5A 1I3QA 2BE5D 2R93A 3CZBA 5FTKA 1K83A 2HCZX 3DMRA 3X2GA 2V3VA 1E18A 3CF2A 1TWHA 1CZ4A 2G5DA 1TWCA 1Y1VA 3QC8A 5T5MD 1Y1WA 3IR7A 1WCMA 3SUJA 3O5AA 2WAQA 2NYAA 4GA6A 5FTMA 3H0GA 2WB1A 3SULA 3HU1A 4KLNA 2JIRA 5C18A 4AONB 2KI8A 3ENGA 3IR5A 3X2NA 4KO8A 1QCSA 1R7RA 1ZC1A 5GM9A 2PI8A 1Y5IA 3TM7B 4L48A 3CQZA 4AVRA 4FERA 1BW3A 1UHEA 5FTNA 4AZDA 3QQ8A 4D7ZB 3GTLA 2EEOB 1TWFA 4KDLA 2NVXA 3QWZA 1FDOA 1TWAA 2A68D 1KQGA 1KQFA 3X2JA 3ML1A 1PT0A 3GTQA 1PQFA 1HD5A 1G8JA 1PQHA 5GLYA 3X2KA 3HU2A 3PLXB 2DMRA 4KDIA 4GA5A 3SUKA 5GLFA 3SUMA 3IR6A 5H4UA 2E7ZA 1E5VA 2PJHB 4AAYA 2AE0X 1CR5A 4AOKB 3X2PA 2A6ED 3HU3A 3GTKA 1TWGA 1R9TA 1H0HA 3GTPA 2PNWA 4FG4A 1R27A 2V45A 1OGYA 2VPXA 4AYBA 2JA5A 2ENGA 2JIMA 1TMOA 1ZYRD 3GTJA 1Y4ZA 3OUGA 1EU1A 3X2OA 2PICA 1H5NA 3X2MA 3FKIA 4CRYG 1YLEA 3TIWA 2VUMA 4FFTA 5GLXA 1FDIA 1PPYA 3GTOA 1E61A 2BH0A 2VPWA 5C1BA 2C45A 1YNND 2YU9A 1E32A 3X2HA 1PT1A 2IV2X 2VPZA 1G8KA 2A69D 2NVYA 2E2IA 4JP6A 2JA6A 5T5ID 3X2LA 2JA7A 4JS7A 1QDNA 3GTGA 1DMSA 2R92A 5DYGA 3X2IA 1SMYD 3HKZA 1Q16A 4FG2A 2NAPA 3QQ7A 5EPPA 2JIQA 4ZM7A 2YUJA 1YNJD 2O5JD 1WC2A 2PMZA 5FTJA 1VC3B 3GTMA 4KODA 2A6HD 1I50A 1AA6A 2GAEA 2VPYA 2G6GA 4DMRA 2KQAA 3D30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FFT A;  5GLX A;  3X2J A;  3SUJ A;  2BH0 A;  3M3G A;  1BW4 A;  1HD5 A;  3X2H A;  2PJJ A;  5GLY A;  3X2K A;  1N10 A;  1OA9 A;  3SUL A;  4JJO A;  3SUK A;  4JP6 A;  4JCW A;  1OA7 A;  3SUM A;  5H4U A;  3X2L A;  4JS7 A;  3ENG A;  3X2N A;  4JP7 A;  3X2I A;  1L8F A;  4FG2 A;  2AE0 X;  3X2P A;  5GM9 A;  2PI8 A;  4ENG A;  4ZM7 A;  2PNW A;  4FG4 A;  4L48 A;  1WC2 A;  3CZB A;  3X2O A;  2HCZ X;  4AVR A;  4FER A;  2ENG A;  1BW3 A;  3X2G A;  2GAE A;  2G5D A;  2G6G A;  2PIC A;  2KQA A;  3D30 A;  3X2M A; 
#chains in the Genus database with same CATH topology
 1PYQ A;  4JXX A;  2NWA A;  5B6C A;  4CRZ A;  3M3G A;  4CS0 A;  1BW4 A;  5DYI A;  1B75 A;  4NOH A;  1SFO A;  2PJJ A;  2Y0S A;  2JIP A;  1SIW A;  4RV0 A;  2E2H A;  1N10 A;  1OA9 A;  2CW0 D;  2R7Z A;  5FTL A;  2B63 A;  4JJO A;  1UHD A;  1DMR A;  4JCW A;  1OA7 A;  2EGV A;  4H4K A;  4IOC S;  1O0C A;  1PQE A;  4C2M A;  1IW7 D;  1E60 A;  1S3S A;  1GTR A;  4JP7 A;  5IZN A;  1L8F A;  1PYU B;  4QIW A;  1AW8 B;  5GAH W;  2JIO A;  1NYL A;  4ENG A;  1WLF A;  1CZ5 A;  3W2V B;  4JYZ A;  1I3Q A;  2BE5 D;  2R93 A;  4WFA S;  3DLL S;  2RE8 A;  3CZB A;  5FTK A;  1K83 A;  2CX8 A;  3X1L B;  2HCZ X;  3DMR A;  2ZJQ S;  4WF9 S;  3X2G A;  2V3V A;  2ZJP S;  1E18 A;  3CF2 A;  1TWH A;  1Y1V A;  1TWC A;  2G5D A;  1CZ4 A;  3QC8 A;  5T5M D;  3PIP S;  1Y1W A;  3IR7 A;  1WCM A;  1VHY A;  3SUJ A;  5BNZ A;  3O5A A;  2WAQ A;  2NYA A;  4IOA S;  4GA6 A;  5FTM A;  3H0G A;  2WB1 A;  3HU1 A;  3SUL A;  1O0B A;  4KLN A;  2JIR A;  5C18 A;  4IO9 S;  1FEU A;  4AON B;  2KI8 A;  3ENG A;  3IR5 A;  3X2N A;  4KO8 A;  1QCS A;  1R7R A;  1ZC1 A;  4J3C A;  3W2W B;  5JVH S;  4WFN S;  4V19 4;  5GM9 A;  2PI8 A;  1Y5I A;  5HL7 S;  3TM7 B;  4L48 A;  4L69 A;  1DFU P;  3CQZ A;  4AVR A;  1EUY A;  4FER A;  1UHE A;  5FTN A;  4D7Z B;  4AZD A;  3QQ8 A;  3GTL A;  1BW3 A;  5JVG S;  2EEO B;  1TWF A;  4KDL A;  2NVX A;  3QWZ A;  1FDO A;  1TWA A;  2A68 D;  1KQG A;  1KQF A;  4E8B A;  3X2J A;  1ZJW A;  3ML1 A;  1PT0 A;  3GTQ A;  1PQF A;  2EGW A;  1G8J A;  1HD5 A;  1PQH A;  1QRU A;  5GLY A;  3HU2 A;  3X2K A;  3PLX B;  5DM6 S;  4UY8 8;  2DMR A;  4KDI A;  4GA5 A;  5GLF A;  3SUK A;  3SUM A;  3IR6 A;  5H4U A;  2E7Z A;  1E5V A;  2PJH B;  4AAY A;  3J7Z V;  2AE0 X;  4H3S A;  1CR5 A;  4AOK B;  3PIO S;  3X2P A;  2A6E D;  3HU3 A;  3GTK A;  1TWG A;  1R9T A;  1H0H A;  3GTP A;  2PNW A;  1R27 A;  4FG4 A;  5GAD W;  1QRT A;  1QTQ A;  1V6Z A;  2V45 A;  1OGY A;  2VPX A;  4AYB A;  2JA5 A;  2ENG A;  2JIM A;  1Z85 A;  1TMO A;  1EUQ A;  1ZYR D;  3GTJ A;  1Y4Z A;  1QRS A;  4JXZ A;  3OUG A;  4P2B A;  1EU1 A;  2PIC A;  3X2O A;  1H5N A;  3FKI A;  3X2M A;  1VHK A;  4CRY G;  1YLE A;  3TIW A;  2VUM A;  4FFT A;  1FDI A;  1PPY A;  5GLX A;  3GTO A;  5GAE W;  1E61 A;  2BH0 A;  2VPW A;  5C1B A;  2C45 A;  1YNN D;  1GTS A;  2YU9 A;  1E32 A;  3X2H A;  1PT1 A;  2IV2 X;  2VPZ A;  1G8K A;  2Z0Y A;  2A69 D;  2NVY A;  2E2I A;  2HZ7 A;  4JP6 A;  2JA6 A;  5T5I D;  3X2L A;  1NXZ A;  2JA7 A;  4JS7 A;  1QDN A;  3GTG A;  5DM7 S;  1DMS A;  2R92 A;  5DYG A;  3X2I A;  3AII A;  1SMY D;  3HKZ A;  1Q16 A;  1UDX A;  2NAP A;  3QQ7 A;  4FG2 A;  1D6K A;  5EPP A;  2JIQ A;  4ZM7 A;  2YUJ A;  1YNJ D;  4WCE S;  2O5J D;  3KW2 A;  1WC2 A;  2PMZ A;  5FTJ A;  1VC3 B;  3GTM A;  4KOD A;  5GAG W;  2ZJR S;  2A6H D;  1I50 A;  4U67 S;  3CF5 S;  1AA6 A;  2RD2 A;  1EXD A;  2GAE A;  2VPY A;  2G6G A;  4WFB S;  4DMR A;  2KQA A;  3D30 A; 
#chains in the Genus database with same CATH homology
 1PYQ A;  5B6C A;  4CRZ A;  3M3G A;  1BW4 A;  4CS0 A;  5DYI A;  4NOH A;  1SFO A;  2PJJ A;  2Y0S A;  2JIP A;  1SIW A;  4RV0 A;  2E2H A;  1N10 A;  1OA9 A;  2CW0 D;  2R7Z A;  5FTL A;  2B63 A;  4JJO A;  1UHD A;  1DMR A;  4JCW A;  1OA7 A;  1PQE A;  4C2M A;  1IW7 D;  1E60 A;  1S3S A;  4JP7 A;  1L8F A;  1PYU B;  4QIW A;  1AW8 B;  2JIO A;  4ENG A;  1WLF A;  1CZ5 A;  1I3Q A;  2BE5 D;  2R93 A;  3CZB A;  5FTK A;  1K83 A;  2HCZ X;  3DMR A;  3X2G A;  2V3V A;  1E18 A;  3CF2 A;  1TWH A;  1CZ4 A;  2G5D A;  1TWC A;  1Y1V A;  3QC8 A;  5T5M D;  1Y1W A;  3IR7 A;  1WCM A;  3SUJ A;  3O5A A;  2WAQ A;  2NYA A;  4GA6 A;  5FTM A;  3H0G A;  2WB1 A;  3SUL A;  3HU1 A;  4KLN A;  2JIR A;  5C18 A;  4AON B;  2KI8 A;  3ENG A;  3IR5 A;  3X2N A;  4KO8 A;  1QCS A;  1R7R A;  1ZC1 A;  5GM9 A;  2PI8 A;  1Y5I A;  3TM7 B;  4L48 A;  3CQZ A;  4AVR A;  4FER A;  1BW3 A;  1UHE A;  5FTN A;  4AZD A;  3QQ8 A;  4D7Z B;  3GTL A;  2EEO B;  1TWF A;  4KDL A;  2NVX A;  3QWZ A;  1FDO A;  1TWA A;  2A68 D;  1KQG A;  1KQF A;  3X2J A;  3ML1 A;  1PT0 A;  3GTQ A;  1PQF A;  1HD5 A;  1G8J A;  1PQH A;  5GLY A;  3X2K A;  3HU2 A;  3PLX B;  2DMR A;  4KDI A;  4GA5 A;  3SUK A;  5GLF A;  3SUM A;  3IR6 A;  5H4U A;  2E7Z A;  1E5V A;  2PJH B;  4AAY A;  2AE0 X;  1CR5 A;  4AOK B;  3X2P A;  2A6E D;  3HU3 A;  3GTK A;  1TWG A;  1R9T A;  1H0H A;  3GTP A;  2PNW A;  4FG4 A;  1R27 A;  2V45 A;  1OGY A;  2VPX A;  4AYB A;  2JA5 A;  2ENG A;  2JIM A;  1TMO A;  1ZYR D;  3GTJ A;  1Y4Z A;  3OUG A;  1EU1 A;  3X2O A;  2PIC A;  1H5N A;  3X2M A;  3FKI A;  4CRY G;  1YLE A;  3TIW A;  2VUM A;  4FFT A;  5GLX A;  1FDI A;  1PPY A;  3GTO A;  1E61 A;  2BH0 A;  2VPW A;  5C1B A;  2C45 A;  1YNN D;  2YU9 A;  1E32 A;  3X2H A;  1PT1 A;  2IV2 X;  2VPZ A;  1G8K A;  2A69 D;  2NVY A;  2E2I A;  4JP6 A;  2JA6 A;  5T5I D;  3X2L A;  2JA7 A;  4JS7 A;  1QDN A;  3GTG A;  1DMS A;  2R92 A;  5DYG A;  3X2I A;  1SMY D;  3HKZ A;  1Q16 A;  4FG2 A;  2NAP A;  3QQ7 A;  5EPP A;  2JIQ A;  4ZM7 A;  2YUJ A;  1YNJ D;  2O5J D;  1WC2 A;  2PMZ A;  5FTJ A;  1VC3 B;  3GTM A;  4KOD A;  2A6H D;  1I50 A;  1AA6 A;  2GAE A;  2VPY A;  2G6G A;  4DMR A;  2KQA A;  3D30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...