3W2VB

Crystal structure of the cmr2dhd-cmr3 subcomplex bound to 3'-amp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
322
structure length
281
Chain Sequence
MIEVTFTPYDIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRITVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CRISPR system Cmr subunit Cmr2
publication title Crystal Structure of the Cmr2-Cmr3 Subcomplex in the CRISPR-Cas RNA Silencing Effector Complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 61
structure length 281
sequence length 322
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3w2vB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3w2vB03
4H4KA 3W2WB 3W2VB 3X1LB
chains in the Genus database with same CATH superfamily
2KG1A 5E33A 2ROEA 3AXMA 1FTCA 4YEAA 3MWBA 4N8NA 2RUSA 1M90T 3M1VA 4ANDA 1Z4UA 5U47A 3LP2A 3QZ8A 2I5JB 1BWVA 3Q24A 1YRXA 1NKEA 2FLPA 4QYRA 2HLTA 4AQYJ 3OFHA 2LEPA 3IR5B 1K1SA 2PIIA 3W9JA 2FHOB 2VUGA 2R7XA 4C98A 3W65A 1N32J 3S8SA 2R7OA 1HI8A 4HEA9 5EGYA 3TAPA 4OZ3A 2CQ3A 2LA4A 3AQOA 3OSNA 5DM6S 4A8KA 3GR0A 4P52A 1JLGB 5HMYA 4P75A 1ELOA 2JX2A 1ZYQA 1YLXA 3GJQB 2ZE2B 4YHHJ 2GMHA 1WC1A 3KK1B 4A8WA 1KWMA 3OSPA 2RIJA 4F3OA 1U1KA 4X4VA 4JB8B 2KM8C 4ECVA 2VJVA 4FF4A 2E1AA 2MY8A 3OLBA 1PJ6A 1YJNS 4DV7F 2BA9A 1RAHB 4IOAQ 1XNRJ 2R7VA 2IM1A 3G2XA 3BJYA 4CQ1A 3E01B 4Y2CA 2B4UA 4WZQA 1FK9A 4QWCA 3FCWA 3M2RB 1AFIA 2XS5A 1S48A 4F8RA 2YTCA 3DLEB 2VH7A 4MKBA 4LRDA 2OUGA 3O44A 4B17A 4CDIA 4PYDA 2RRNA 3T5KA 2RMLA 4B9SA 2ZD1B 3GSDA 2CQGA 3BPDA 3G6VA 2AJ1A 4LJMA 4IG3B 1TV6A 2VPZB 1GMWD 1R3NA 4WBFA 2UUCJ 1S1WB 1Z1ZA 1OPZA 3N4WA 2FJEB 1M5KC 4AL5A 2VPWB 3GP9A 1DY3A 2XYGB 2RS8A 4USTA 3JAMY 4P6QA 5D4NA 8AT1B 3EYZA 1NH7A 3MOJB 3BO4A 2AJ2A 4I68A 3HHKA 4O3SA 1NSAA 1FRLA 4V19J 5LSOA 4P71A 1NNDA 2B7BB 5A8WA 4NCAA 2ABYA 3VGUA 2ZC3A 3IG1A 5IOLA 4CM2A 1URRA 2LCWA 1RT4B 4TXSA 3SFGA 3HKZD 1QSLA 4GC6A 4CLFA 3GIIA 3SQGA 1TVRA 1WC6A 1HNIA 3X1LB 5FIIA 5G0RA 2P6TA 3Q8RB 2EGVA 3V4MA 3JQJA 1DLOA 3CCTA 4TY8A 4DSJA 4E8UA 1FRHA 2HNDB 3AD7C 4NLSA 1RTDA 1VK3A 3QFWA 2GMJA 2DXDA 4B9NA 1TK0A 1VQKS 5KOXA 2HLUA 4CH0S 2HHUA 4ILRA 2G1DA 5AE3A 2J9DA 3L7OA 4C8YA 3ETOA 5ETKA 2QA2A 3CMAS 3KG0A 4JBCA 2QJ3A 4FBTA 1O5JA 3NNAA 4UY88 3RW6A 5HLFB 2WVFA 3GE9A 3FCVA 1YWXA 1M5VC 2P6SA 5F3TA 3LTOA 2IVMA 2PFDA 2UUCF 2UU9J 4JXZA 2Y3YA 1T8EA 2Q66A 2JJ4D 2LP4A 1RAGB 1Q82T 5HP1B 3NP5A 2G2YA 2BACA 1HNXJ 1IR1A 2EFPA 1RWXB 2BJ3A 3WDOA 4KGKA 2MMYA 1RAAB 5A6PA 4FF2A 2CJ9A 2IBOA 1KP6A 2KXNB 2MTLA 1B99A 1QAJA 5KG2A 4NYPA 5HL7S 1Q81T 5DO2A 4XO0A 2BQRA 1XMQJ 3NG8A 3OTOF 2XMJA 3BBBA 2HVEA 3IAM9 2IVFB 1TUWA 2GNKA 4QW9A 5SZTA 1HA1A 2MQ8A 3VV2B 3VALA 5DQGA 3CB4A 3TR5A 1RHKB 2IRXA 3OVAA 4OI1A 3CJKA 2KH9A 1PILA 2MKSA 3Q8PB 1PAUB 3PW2A 1QVFR 1BY9A 2ZHOA 3KNAA 5E0OA 1ZAVA 2IJFA 2DHAA 3JSYA 1G6BA 3FZBA 1U6FA 1FRMA 1UPPA 2OHDA 3Q86A 3ITHA 3G4SS 2FHMA 2VASA 5T14A 1QTQA 4DL3A 3Q2TC 2VPYB 5KT5A 9RUBA 1HI0P 2ZVIA 2DPJA 4G65A 3MFIA 4AL7A 5KFNA 2VFRA 4BCAA 2GJ2A 3HFVA 2AYEA 4IOCQ 2QFIA 3N5FA 4TLQA 4ZKAA 4U96A 4OI0A 4DEZA 2N7CA 2V4QA 1NPRA 5EWEA 3NXZA 4GO7X 1XTZA 3BSNA 3GV8B 3HDSA 3AD8C 1IQZA 1HNVA 3M8PB 2FZKB 2F63A 2VFVA 1S57A 1VIOA 1S1UA 2VBWA 4MK8A 2M9KA 4C11A 4L73A 4F26A 5IV4A 4X62J 3SDEA 3GYNA 3OT9A 3MECB 3CCJS 4DV0J 1WEYA 3U1LA 2IRUA 1XMQF 2HBQB 1SC1B 1U1LA 2P9GA 2E9TA 3MR5A 1VOMA 1KLNA 2DO0A 2KXHA 1XK8A 1RTJB 5DDPC 5A0YB 1MROA 4YUDA 3LH2S 4K59A 2R4FA 2X7IA 1HHTP 5KFDA 2QV6A 4I6YA 1W7WA 3FC9A 1U0HA 1KHVA 2BZ2A 2DGOA 2R8GA 1QSYA 3BH7B 3OR1B 5H9FJ 3H5SA 4IG0B 4ECQA 3RB0A 1REVA 5ETSA 4JP8A 2RD5C 3TZWA 1KDNA 1JIHA 1EETB 4ZPDA 1NJIT 3BDEA 4TYBA 4J9OA 1CLFA 4ZPTR 1L3VA 3QWPA 3ENVA 2NYHA 2BW7A 4KC5A 1RP5A 1TAUA 3CMQA 2EG1A 4R8UB 2IJRA 1LWXA 3NMRA 4JI6J 5DZ7A 3DLGA 4KKOB 2DR7A 2CQ4A 3BS9A 4FVMA 4UUXA 5F9NA 3JYTB 4DQRA 2IA6A 2ZBRA 1PJ5A 1T9XA 2DITA 5LSLA 1VIXA 4G1PA 1EZZB 1PKUA 3DOLA 3NGTA 4X62F 1J5OB 2W4DA 4WFBQ 3GZ7A 4NLXA 3UI3A 3AOBA 1NM2A 1PC5A 4DV0F 2HGNA 2YNHA 4Q45A 2R2SA 2E9RX 3HULA 4ED5A 1JX4A 4LRFA 2V2QA 1N5SA 4RUBA 3MUTP 1T9WA 2KXFA 1JLEA 1RTZA 3I9V9 1YIJS 1WACA 3PFEA 1FNXH 5GAEU 4C0BA 3SV4A 4IR1A 2M5YA 3KJNB 3R9LA 5E41A 2E5IA 3EZOA 1U1OA 2ZZTA 3NKYA 2FVQA 2ZM6J 3FSXA 5ETNA 3FQKA 5HK4A 5DGAA 4NEZA 4N5SA 3QGHA 2CA9A 4ZPAA 1MSWD 4LSNA 2DPIA 1N0UA 1FKPA 4YR0A 1HBOA 1N4LA 2B5JB 3VQSA 2G0CA 4KHRA 5B0DA 1KOHA 3GILA 4R5PB 1YRUA 2HNZA 4OX7A 2CX8A 1OQ6A 1VI7A 1CJTA 1YITS 4USHA 3US5A 2GAEA 2M4MA 4M5JA 2QA4S 1XMOF 1YJTA 3BGFA 1X4DA 2NZ4A 2OEKA 1SL1A 2MZJA 4ZCMA 5DZ6A 2D41A 4PG6A 2FHJA 2IM0A 5KFMA 1IJFB 5E7OB 1JQGA 3I56S 2XY6A 2B4PA 3NCQA 3ENQA 3C6TA 2R7UA 1Y10A 3BO3A 5CZXA 1ZTWA 1B75A 1NEEA 4NXNF 2H9ZA 2K1RB 4KB7A 6FDRA 4F4WA 4XTTA 4EGLA 3DC2A 3PX0A 3HVTB 2EBGA 1VQ9S 1ZM9A 2UUBJ 3OHBA 3AT1B 3M2UA 2QEXS 3H90A 3MMAA 1NSKL 2XI3A 2BJEA 1NDLA 1CG2A 2IA0A 1TMMA 2YWWA 3MPUB 1Y9OA 1U09A 2OKQA 3JS9A 3MR7A 3DI6B 1VQ7S 4F7VA 4KIAA 3T41A 1HBMB 4CYUB 4DR1J 2ZM6F 3BSAA 5L1LA 2MHEA 2R7RA 4RKUC 5C2GA 3EVMA 2EC0A 3A3NB 1M1KT 3P6YC 1IKXB 3AOCA 4DQIA 3AJDA 2GVZB 1XNQJ 2J5AA 2DKOB 3QIDA 3KFWX 1FDBA 4FPRA 4WFAS 3CC2S 4TU9A 4WFYA 3HO1A 3L09A 5LMUJ 2HHPA 3W66A 1E6YB 1VFJA 1RLDA 3CD0A 4J91A 3DYAB 1HMVB 4OV6A 5KG3A 4NCGA 2X51A 2LDYA 2HHWA 1VQLS 1GTSA 3SSSA 3BV8A 2HAFA 3E51A 5D8HB 2YQ0A 1RT6B 2ZH6A 2DNGA 2KDOA 4ES1A 2VDIA 3RTVA 4KYZA 2UUBF 2HQFA 2LXUA 1R8HA 2KKHA 3DHWC 2G1HA 2HFNA 2RJZA 4C3LA 4DSIA 3PIPQ 4EU0A 1CC7A 3F0NA 2CJXB 1VC6A 4X4SA 3W2WB 3K89A 4DN9A 4KAIA 5KTQA 3T1YF 3T9ZA 3T5LA 1HWLA 1UJ5A 1NHKL 2R7QA 4JUZA 5JMNA 5J1PA 2ROGA 2KJVA 1ZH5A 3MMCB 5ETOA 4IRKA 2YNGB 1YX2A 5J2MB 4K4WA 2F8HA 3GIKA 1FEHA 2MXYA 1BD6A 2MZSA 5M2PA 4RZRA 4JYAF 3R3TA 4OZ0A 4PWDA 4JI1J 1BMQB 2M70A 2H4YB 2KU7A 3C8YA 1Q53A 1SQEA 2LECA 3I9ZA 3R97A 4QU7A 2ATLA 3LW5C 2F8EX 4D3GA 1ZM2A 2KVQE 1DZ5A 2PI5A 2ZWOA 4RW4B 2EK1A 3G86A 3EVOA 1O0CA 2GJIA 3N01A 4CO0A 1S1VA 4WF9S 2QA1A 4ZHRA 2LA6A 3RU0A 3MEGA 1AROP 3ISNC 2CNKB 3A4TA 4WXWA 1KHWA 1YZ7A 1H7XA 3CCES 1GMWA 1RISA 2RKIA 1W2IA 3W62A 2L48A 1WHWA 2XB2D 4C0HA 3UN5A 2H51B 4ZN1A 2XMKA 3BM7A 1RT1B 1FJEB 4W92B 3CVKA 1Q8KA 3M8QA 5F8LA 4IO9S 4WYLA 4U67Q 2WCXA 1Z2ZA 5KFVA 2I2YA 1Y5NB 3L9ZA 4TLRA 3FBFA 4PR6A 1IKVA 1GQEA 2GO8A 1KVIA 5K14A 1QVGR 2GHPA 2AZ1A 3PX4A 4ID5B 2KYXA 1FWKA 2BANB 3EXCX 1VQPS 2VICA 5KFRA 4ZPWR 1RTIB 5K8NA 3EUNA 2RDJA 3DRYA 2PA8D 4LIWA 3ET6B 4CLTA 4J90A 1S6OA 3PW4A 3BB5A 3MM7B 4JI1F 1F3FA 4KV8A 2FLLA 3JSMB 2AQ4A 3S01A 2KVIA 5F0UA 2OEMA 4K0KJ 1NKBA 1S6UA 3LOUA 2ZH2A 2JFDA 4I0WA 4PG5A 3WZ0A 1HIYA 3V6DB 1ICEB 2FZGB 2DGTA 3PYFA 1RCXB 4WU3A 4J3CA 2P9EA 1HARA 3BO2A 4RNNA 1S97A 1VRUA 5K8PA 2LMIA 1FFSB 5LMNF 3KHLA 3OFGA 1S7IA 1I3OB 4L72B 1FE0A 4G6VB 3DRXA 3O6QA 4L76A 2VQFF 3VAKA 5HROB 2C3YA 5LXYA 1XR6A 1RHQB 3C3LA 2MYFA 4ZDNA 4OX6A 1ZPVA 4U7UD 4GVBB 3WC0A 4ZLJA 3M6WA 4RX6A 3IFEA 2QYGA 2DR5A 2JLFA 2GVDB 2H5JB 3BR9A 2QLBB 3W1YC 1RWOB 2IYIA 4M5DB 1ZJWA 2ZUGA 1Q1KA 1KEKA 2R2UA 3ZZPA 5B0CA 3PRDA 2D3OR 4K4UA 1RLCL 3T9NA 1FEUA 4DPTA 2NXNA 3ONQA 2BEFA 1C1CA 3TO8A 2DK2A 4DPWA 3FMBA 3HSZA 3QMQA 2HWHA 4C0OC 1NU4A 5I3UB 1IBKJ 2LU1A 1NDPA 4OX9J 4Q5VA 4ETZA 2LU2A 4V19X 4K0KF 3DLLS 2ZKUA 2OPRB 4ER8A 2W8KA 4KE5A 3KDNA 4DR2J 2QLJB 4GRSA 3W64A 4YB1P 3B82A 4H4OA 2AGQA 4Y34A 1UWAA 3CC4S 2CPYA 5G4DA 3D6HB 5JVHQ 1AZSA 1FNOA 1RAFB 4RW7B 3V81B 5D15A 4D3HA 2I5JA 5JUMA 2V2VA 3H25A 3NGUA 7FD1A 4Q2LA 1B7YB 5D3GA 5I42A 5LJ5Y 3HFKA 2E1CA 5BXIA 4ED0A 4ENOA 1FWLA 5KFTA 1RBOB 2BDPA 5A2QU 2DGUA 4DU8A 2E5LJ 3LAMA 7AT1B 1N54B 4M8LA 2J6SA 4FXWA 2FVPA 2EVZA 2ZC4A 2U2FA 3G8QA 1Q5YA 3IAS9 1VQMS 1UA0A 2VBXA 4Q8EA 1TUVA 3AXKA 1FXLA 3M4XA 3CO0P 3W2VB 4I2PB 4MAKA 1M1GA 2V50A 5HJXA 5EDWA 2HK3A 4FXVA 1N33J 3LGHA 1WC3A 2OPSB 5IT4A 1H72C 2BV3A 3D68A 3DOMA 2XMVA 3CJ2A 1X4FA 1MU2B 2IC3B 5KFUA 2MZRA 1TKXB 2Z4PA 3WIVA 4JI0J 4OX9F 4Z2XA 2J7UA 3IWLA 4RW8B 3NCPA 2QE5A 2BE7D 5D0GA 3BQ2A 4JI8J 1OY9A 3SZ2A 5B0EA 4DR2F 4YR2A 1JLQA 2GQ2A 5IZNA 1FXDA 5GAGI 1N48A 1OSDA 5KG0A 5C7PA 3OBIA 2AZ3A 4LR8A 3DLEA 2NR0A 4PQUA 5CD4A 2HMIA 5T7LB 2VU5A 4IFYB 1D3WA 1Q8IA 3BSCA 2OTJS 2WBRA 2FJXA 2HHVA 4QR0A 2PDAA 2GQCA 5CA5A 1JLCA 2V68A 4LQ3A 4P73A 5I4MA 2ZH7A 1TAQA 1S1WA 2C28A 5F8HA 3BN7A 3D3CJ 3M8YA 3G6ES 2Z30B 2N3LA 1U4BA 4XDDA 4CNYA 3CDEA 1WELA 4YDDB 3NAIA 1V3SA 2LQJA 1CULB 4DL2A 3VR1A 2VBYA 1APSA 3AB2B 3IWNC 1A0OB 4PPZA 2O5DA 1HFEL 3H2LA 2M0GB 1UZDA 1RT4A 5GADW 2KT5A 4DCJB 1S1TA 1SBRA 4EO6A 3TUZC 2R8IA 3NWRA 2DISA 1V3RA 1FO1A 1Q16B 3FDSA 3KNGA 1VQNS 4RU2A 4JI0F 4DV6F 4ANCA 2HS0A 1O0PA 3GLJA 3K0JA 3OVSA 4RBTA 4EYIB 2Z8QA 2YQ3A 1ITPA 2XYHB 1CQNA 1FDDA 4IDKA 4NLWA 2DRBA 4YS2A 4NE9C 4EEYA 2GC8A 2DHGA 2D69A 2I1RA 1NSQA 3I87A 3OFEA 3PW0A 3PYEA 1HBUB 2CQ0A 1OQ3A 4LT6A 5D0EA 5DG8A 3IM9A 5F8IA 2KM8B 2V8PA 3KK2A 4IOBA 4XIUA 1KFDA 4RUHA 4A8FA 3PJ9A 3EM1A 3VTIA 2YBVA 1KFSA 1H6KX 1S76D 1U1PA 3KWMA 3GFHA 3AJ2A 4YY3F 2HS3A 1M5HA 4DV5J 4JV0A 4PG4A 2EBEA 4Z37A 3AODA 2AV5A 2CPHA 2WVDA 2XMTA 3BZQA 2AF6A 3UWTA 3F56A 2B8PA 1ZA2B 2RUGA 4OYOA 1X4BA 1UVJA 5HP1A 3AAWB 1NB2A 1NUEA 3TI0A 3BGUA 3ENWA 5HVGA 1WF0A 4DS4A 3ZZ0A 5GAEI 4WTYA 2N7YA 2HVZA 3OJUA 1SXLA 2XM3A 2ALYB 2QL9B 3G87A 2YKQA 3QFHA 1LK5A 3JB9k 4PUOA 1R43A 3EGVA 1PJ7A 4LFBJ 1IM4A 2PSZA 3EGNA 2C2MB 4X84A 2YKOA 3V6KA 4LR9A 4DHVA 4CP5A 2IAJA 4OJGA 2LQ8A 3DXSX 4M5KA 2WVBA 1TP7A 2PA3A 3OUYA 3DRPA 1U1MA 2A6MA 4BC9A 4A47A 4DMZA 1BQMA 2VV5A 3HHLD 2BKNA 4NLQA 1VBZA 5IT9U 1UL3A 3O3LA 4OZJA 3IMQJ 2JVRA 2C42A 3K57A 1HNWF 3G9CA 1IBMF 2KHCA 2DTJA 4ECTA 2HG4A 4ZMMA 2J9DE 4WPAA 4WCEQ 1UA1A 5BYRA 3QRRA 1SCJB 1WG1A 2OGUA 4NLRA 3IO1A 2W2MP 1X9MA 3W61A 4MIAA 1UCNA 4I2QA 3MUVP 3G8TA 4Q0BB 1U25A 4DV5F 1OYDA 3FEXB 4OYBA 2C2OB 2HFSA 1V3ZA 4O44A 3V4IB 3FJ2A 3GYGA 1P27B 1RZMA 1WI6A 2B3TB 1F9HA 2J8AA 3KKFA 4H4KC 4U95A 3HVRA 1DTQA 1WOSA 4N76A 4KO0B 4DR3J 3GFZA 2EKYA 1AA1B 5HANA 2DCLA 2PMWA 2LQBA 4H54A 2B6AB 5B09A 5L1KA 5GAHU 2IFXA 2Q1LA 3P5TL 4JI5J 1S1XB 1N0VC 2KRBA 3O1LA 1RYRA 4WFNQ 1N6QA 4LREA 3R7SB 4LFBF 3RW7A 2SXLA 3J7ZV 1VGYA 3OVBA 3VAFA 4HHJA 4K4VA 4LVNP 5ETLA 2RVJA 3WQPA 1RHRB 3FK4A 1BQNB 1R8CA 3KLFB 2K3IA 1HPZA 4NYOA 3IRXA 2MLYA 2KO1A 2XYPB 2OELA 2W2PP 4UY8T 1SJ4P 4Q43A 1LNQA 4QPXA 4LF4J 2HIYA 2ZITA 3G6XA 2BVZA 3M8RA 5IS2A 3KLHB 5CAAA 4P2FA 2NUUG 3CTRA 1X9SA 4N8OA 3U27A 4KGVB 3ADAC 2V63A 1XJWB 5LXRA 1B70B 1RWWB 1WDDA 5BYSA 3K5PA 1RABB 1VQ6S 4CTAB 4X2BA 2YNFA 2E5HA 4YB7A 1VRTB 1WSRA 4TU7A 5L1JA 2HFOA 1T05A 2V4JB 2XNRA 4EBDA 2X1AA 1MMNA 3H2VE 1T0TV 2KRRA 3VGTA 4C8ZA 1S6QB 4C3MA 3RBEA 1JLAB 2QLFB 3TARA 4J37A 2E1MC 1I94J 2KB2A 5C24B 2OMLA 4KHPF 4RR5A 4M95A 3S1TA 2M7SA 1YRTA 1B0VA 1KTVA 5HVHA 2FLOA 5EX0A 1KTQA 2VOPA 3I55S 2PFFB 1IN0A 1YJRA 1TL4A 2ZJRS 2F1FA 2NREA 1RHMB 3C19A 3TJAA 4X66J 1GNKA 2B9XA 5CYMB 3DGPB 2QLXA 4OZ5A 1KQSR 5CABA 4A46A 4ANEA 1PC4A 1C0TA 4NLGA 4DPYA 5E3RA 2A2CA 2LLZA 4J9VA 4CWBA 3K5OA 3BQ1A 3CJ4A 1SI9A 2PEBA 3M8SA 4LF4F 2EI5A 5AT1B 2A10A 4YR3A 2F40A 3RBZA 3KLEB 3RJMB 4MYUA 1EKSA 4DFJA 3GJRB 3OL9A 3HX9A 1SQFA 3EDQB 3CW2C 3ZZYA 2J6TA 3POTB 1N8RT 4LRBA 4LF2A 2PEHA 3PACA 3QATA 4R5PA 2KG0A 1TKTA 1IBCB 3VVUA 3CDWA 4U6PA 4OHZA 2YX4A 1R8BA 1SH0A 3UD4P 1PSDA 2Y1LB 4QWAA 1FX4A 1WOPA 2G2OA 1JLBA 1K8AT 3K5MA 2B4VA 5EWFA 1ZTTA 1N5VA 1RSCA 2IYGA 3J7ZT 2DNLA 2IDLA 1SJ1A 3A3PB 3HHDA 3OXGA 3D6TB 1RAIB 2CJKA 3K7RA 2CPZA 2ZJPQ 1SJRA 4ELVA 1SKSA 2RS2A 4WE1A 3CJ3A 3MR6A 2W2NP 4DUYJ 3NEKA 4OHYA 2XSJB 1KN6A 1FNMA 2J7WA 3PFOA 5C5JA 2ALZA 2H3EB 4E0DA 4C9DA 2Y1RI 3TX8A 4JYZA 1KVKA 1FCAA 2M52A 5IM0A 4QWDA 2BQUA 2RHSB 1U8WA 3IXQA 4F3MA 2RQMA 3DI6A 4DFMA 3ISZA 3H5UA 5KFWA 4CYUA 1P9QC 5KG5A 4B3MF 3CJQA 2J0SD 4ECSA 5FDLB 5KT2A 3GG1A 2C3OA 5H9FK 3RG6A 3LAKA 4ICLB 2VG7B 3PVXA 2K3KA 5CYQA 3PHEA 3DLKA 2YVSA 1NCLA 2IPOB 1T3NA 5J2NA 1NLKL 3T1HF 4PXEA 5C25B 1SV5B 4C8NA 4F2RA 1B0TA 4B3OA 3S7RA 1RWUA 3A8IA 3DLJA 2C3MA 3CJ5A 2Z57B 3B4DA 3W63A 3ZO7A 4FYVB 3BREA 1RA6A 4PEOA 2ZEJA 2YH0A 3LP0B 1JWWA 2P2CB 2VDHA 5J2QB 1FFGB 2GAGC 2ZBIA 1BXNA 3R5JB 2DNOA 3MPVA 4KH1B 2DGXA 3DRRA 3MCSA 3DMJA 8ATCB 1SPBP 1KKHA 2V9KA 2FDNA 1V6HA 1EQ0A 2MJUA 1PIEA 5D4PA 3KXDA 5CXTA 2XGQA 4DUYF 1BE4A 3R2CJ 1G2EA 1TKDA 4ED4A 1UJ6A 2J0QD 3QLHB 2VC1A 4HACA 5BR8J 1J2VA 3E8OA 3GCXP 5KG6A 4WKYA 4KPYA 3MM6A 3PIPS 1I1GA 4K4SA 3K59A 2E9ZA 3I0RA 2I8EA 3MXHP 3CCWA 4OHWA 4EO8A 2C2DA 3FGVA 3K8WA 3M2VB 2R2RA 4HT5A 1GT8A 3EJMA 2X3DA 1DJ0A 5JXSA 1NK7A 1WC4A 4Y2MA 2MQQA 2CQCA 3C14B 2A1BA 1NKCA 2Z0YA 1FKOA 3G82B 2D3O1 2DD8S 4NXMF 1F1BB 3MAAA 1VJWA 1WHVA 3WX8A 4P2BA 4DV4F 2WONB 4FZVA 2MGZB 2VZ9A 2C22A 1F9FA 2QN6B 2GX8A 4H3SA 1RUSA 3ILJA 2K8GA 4B9VA 4MKAA 1LWCA 4RNFA 2FJDB 3H98A 3KHRA 3UN3A 3OFFA 3MCMA 3M05A 3VZHA 1HYSA 4RNMA 1PYSB 2UVVA 3MM8B 1VCTA 1WD6A 2CWKA 1H7WA 3M9OB 4IUFA 1NHUA 1RWPB 4FNHA 2CQIA 3PR5B 4IRCA 2MSSA 4G1QA 5KFYA 5D78A 3D7SB 1GTRA 1HWJA 1OSCA 1AUSL 4OV1A 4ZP7A 3JSBA 4DG1B 3N6LA 3LGNA 1T3OA 1UMJA 4P72A 1HBNB 2AJQA 2L9WA 4USKA 1EP4B 3C15A 1FXRA 4C8LA 1NH8A 3CCVS 4WP8A 5E2QA 5IV3A 2UVRA 2KFZA 4K4ZA 2F5GA 1KR4A 4NEYA 4Y6IA 2WTFA 4ERDA 2ERRA 1VLYA 5E3AA 4CLKA 2ASDA 4IFVB 3T1AA 3IA0A 4NLPA 3KLGB 4LBPA 1QE1B 2ZBCA 1LW2A 1RWVB 3BKUA 1ROFA 4FKYA 1DTTA 1H0HB 4J9PA 2IMWP 3M1VB 4Q2MA 4HHHA 3DM2A 3LP2B 1FJCA 4R25A 2DGVA 4ID5A 1LW0A 5KFGA 2HWTA 4RBVA 4AUKA 3DOKA 1UFLA 2HRUA 4C6AA 4OZNA 2YNIA 4DUZJ 1VK8A 4QJVA 3MR3A 2DEIA 1D8YA 4RW9A 1N5YA 4XK8C 3BYRA 5GAEW 1F2GA 4DR6J 2FUG9 5DM6Q 1M0SA 3A13A 2B9YA 1YJWS 2M3DA 4IH7A 2XGPA 4UQTA 1T94A 2CQ2A 1U2CA 3PJWA 4W98A 3I82A 4JI4J 2D9OA 2ZDPA 1RJJA 1VMBA 3ZNJ1 3SFUA 1NK6A 2CDQA 1KLMA 3NNCA 2M8DB 3KLIA 2OI2A 1O0BA 3MM5A 5D0HA 1U8SA 3KDOA 2D74B 1LXJA 5HMXA 1LK7A 2W01A 1SH3A 2WOMA 2OEJA 2ATCB 4GVBA 4OHXA 2HPUA 3RRHA 3EDRB 4O0NA 4GKJJ 1RDRA 3TW0A 2GMLA 2XEXA 4O4GA 1FK9B 1RE1B 5IQQA 3AIIA 1T7PA 3KMQA 2ZH4A 3SIPB 3I5CA 1RQ0A 4M5DA 5M2RA 4F4XA 3H8YA 2D9PA 3D1QA 2DNYA 3SCJE 1RWMB 3UFCX 4EMDA 1KQFB 6FD1A 3ULHA 1TV6B 3C16A 4ZVGA 2HVDA 2RAQA 2YX1A 4DUZF 5AE2A 2CPEA 4G3IA 2IIHA 4USVA 1PBUA 5HBMA 5F8MA 5I3UA 3HHLA 3BDPA 4NPOA 3CJ0A 2FGCA 3QGIA 1HW8A 2DNZA 1H3DA 2A18A 2DR8A 4DR6F 3J7AN 3HLUA 1D9DA 5A8WB 3PKYA 2W9CA 3D2WA 1CJVA 3IG1B 5F8JA 4USJC 5GMEA 1T11A 4G1IA 3O8WA 2JOQA 4F0MA 2X1GA 5GMKa 2E1RA 3SQGB 1TVRB 1HNIB 3JXOA 5IWAF 5G0RB 3F44A 3CGIA 5FLXU 2BJDA 5DETA 3V81A 3TYTA 2VQEJ 4TY8B 3NBPA 4DV7J 1UEVA 4KQZA 1DQAA 1FEEA 3DGVA 4EBCA 2DNMA 2BE9B 2ZBPA 3MD1A 4F25A 1RTDB 2DB1A 3MMJA 4J5OA 1RWKB 4GKJF 4XDCA 2VG6B 3PCOB 1EX8A 3GWCA 3V6JA 2EW9A 2VG5A 1H2TZ 2E1PA 2CPIA 1YKWA 4YN3B 1K1QA 1NHVA 5HMZA 1Q8BA 3ILIA 2EFOA 2JEJA 3I32A 1E6VB 4B9MA 2NS1B 2YX7A 1QDUB 2EK6A 4DV2F 3AHPA 3VAGA 4IYQA 4I2PA 4QU6A 4FPIA 4A8QA 1HQ2A 1B4SA 4QYZK 3M30A 2OPSA 2FPHX 3EPIA 1UW9A 2I9SA 1R6VA 4LIRA 1F5BA 3QJLA 2UV8G 3GONA 3K5NA 1TKZA 2DHXA 3W5XA 3R5GA 2LQ5A 3GTYX 4LF7J 3MURP 3UD3P 2RQCA 2V4RA 2WSFC 1IKYA 1VDHA 1C1BA 4DCPB 2KI2A 5HL7Q 2RQ4A 1EIYB 1AT1B 2V8GA 1SIWB 1Y7PA 2V8DA 1UEUA 3Q8QB 1QJHA 4WP9A 2DY1A 3I96A 4DFPA 1B3TA 2UVUA 4FBUA 2VQEF 3FBEA 4DI6A 3MEEB 4KPCA 5K8MA 3SMZA 1KVJA 1K47A 2GV1A 1EARA 3I0SA 3H20A 1X7VA 2CQPA 5D0RA 4EZ9A 4B3TF 2OMOA 3RR8A 2PICA 3QGGA 4P7VA 4JI2F 3DU6A 2OD6A 3PJXA 3ITHB 3SQOP 2CZ4A 5KFAA 1TTHB 4JOUA 1TL7A 2MQPA 2VJUA 3A1YG 5HQMA 5A2QY 1D8ZA 2J9EA 1QRUA 1H74A 5LJ3Y 2BABA 4NA1A 3GJSB 1N36F 2YPZA 1FTRA 2KT2A 3GCWP 2EWHA 3TRGA 4CM0A 2CPXA 3DDIA 2WW8A 2XLIA 2YWFA 2XLJA 2HNYA 2NUHA 1RWNB 2W1BA 3QYYA 4F4AA 2WSEC 2R8HA 2J0WA 1GMVA 1HQUA 1HNVB 4EFAC 4DN0A 1X60A 2WZ1A 2F4VJ 4UOFA 1S1UB 3PX6A 4LF7F 3OTOJ 4FYDA 3L4BC 3SDEB 4FYYB 1WNEA 3CD5A 2AHOB 3KUHA 1NJYA 4OL8A 4O4RA 5AXMA 1G4CA 1C0UB 2QTWA 4CO4A 3GV5B 1IJEB 3RAXA 1RT7B 1D6KA 3M6XA 2QG9B 1FJGJ 1FDNA 4AD6A 1MROB 4RUAA 3MMBA 1ZAXA 1Y5IB 2XZDB 1V6ZA 4WFXA 1C2PA 2MPUA 1RTHA 5HMWA 1KONA 1U0HB 1JK9B 5KFSA 1TUGB 4IQXA 2NPFA 1LWEA 3UNGC 1ZZFA 3NCRA 1R0AA 4O0IA 4HDHA 3TVYA 3HJFA 3AD9C 5F0WA 1QAYA 1VHKA 3R6GB 1HR0F 2FB0A 1UJ4A 1REVB 4PXBA 2ZZNA 3CCZA 4XPEA 4C7QA 3IS9B 5ETPA 1XC9A 1RT2A 5AXNA 5ETVA 1K0TA 5CCMA 2APOA 4ZVEA 1Q79A 4UY85 5E5NA 1TL3B 1BGXT 3J80U 1QTNB 3CDAA 4TNOA 4NLYA 1RAJA 3PTWA 5DDQC 3THVA 2XMMA 3ZTSA 3PM9A 3DCAA 1H2UX 2L41A 4MKVA 3B78A 4F50A 1KBRA 1FVQA 1CJKA 1U45A 2DNHA 3BGRA 2BRLA 2BX6A 4NMXA 4LF6J 2HQ3A 1U02A 4BBYA 3CD7A 4CO2A 3MTKA 4CI0B 2CDRB 2F4VF 3GMGA 3MCNA 5A8RA 2MZTA 3Q2SC 3UVJA 1XWLA 5KT7A 4NRUA 3TJ8A 4OYAA 2CRLA 2A0FB 5K5MA 1ACMB 2YNHB 3HF5A 1RHJB 3KJVA 3W8PA 1QSSA 1T02A 3CJRA 4DX6A 3D0IE 4M5LA 2ZH9A 2DGQA 2Z2MA 5FD1A 2NXEA 1FJGF 1R8PA 2MSTA 2VPXB 1VR6A 4UOCA 1B64A 1FKAF 1NB7A 4OI4A 1JLEB 3VVTA 2GFFA 5GVQA 3KHGA 1J5EF 2LXFA 2KHDA 2ZH1A 3TAMA 4ILMA 3IR7B 2FLNA 5HJYA 3J7YI 4HVZA 1OPIA 4DR4F 2MEWA 4CO3A 4CLSA 4LSNB 5J2PB 4S0MA 1FKPB 1UWBB 2NXJA 1HBOB 4LSLA 1HHSA 2ZDOA 1RAOA 5L39A 1UKUA 2BJ7A 5D77A 2B0GA 3NGKA 2VB6A 4CRJA 2HNZB 3IBFB 2UXDJ 1CJTB 1XQIA 2WB4A 2PMHA 1JKHA 1BWEA 1S72S 4PCQA 2IDEA 4IQMA 3CNQP 1Y0HA 4LF6F 4ZP9A 4Y3CA 3LP1A 1LWFB 4O3QA 1EHWA 2Y1JA 3C6TB 2AGPA 1O6XA 3CXCR 2L9NA 5I3QA 2PN6A 2OFHX 4FS1A 4URQU 3KUGA 1TFWA 1PYTA 3ZTRA 3D4JA 5KFOA 2YKMA 3D6FB 4NLUA 4Q44A 1GAOA 2DNNA 2G9OA 2OPPB 2B43A 4UW2A 3SCKE 2ACMA 2QMUB 1P9YA 1IR2A 2O1PA 2WB1D 4USUA 2HBZB 4ALZA 1S9GA 3WBZA 4AXIA 4GKKJ 3QIPA 3B6BA 1JLFA 4OHVA 3X3UA 1SL0A 2BBEA 2RF2A 4MFBA 2NYIA 2RDDA 2ASLA 4O23A 1DAXA 2RQKA 2E5GA 2CIMA 1S6QA 3PIOS 4OQJA 3F73A 3GIRA 3G6YA 3ZZUA 4CLYA 3K8VA 1R89A 1XMOJ 5B08A 4WFAQ 2V67A 3UCGA 2UXDF 3AJ1A 1QUPA 4QIWD 1HWIA 3MD3A 3AA9A 2FJAB 2J6UA 2AEFA 2FVRA 3BQ0A 4KFBA 5DM7Q 4MYTA 1Q5VA 3DRSA 3DNCA 4NCGB 4NXNJ 3DGPA 2NPIA 3M9NB 2DNQA 2ZH3A 1NXZA 1FWPA 2PD1A 3NS6A 2RRBA 2OSRA 1KNZA 2AE0X 3NNHA 1EB0A 2MKCA 4YQWA 2CJYB 1SUQA 3FKBA 3N79A 2PO4A 4BLGA 4LF9J 4DX7A 3CDUA 5DS7A 3I31A 4OYXA 2HRTA 4N47A 4M94A 4DL0C 5AJ3J 4IR9A 4P9SA 1UW4A 1YGYA 2HQDA 3T19A 4GKKF 1YQHA 2H5IB 3V6HA 3CF5S 2WAQD 5EUHA 3G71S 4PWWA 3NS5A 1X5OA 3M8WA 1L3TA 5F41A 4TU8A 4F2SA 4CLUA 2BKPA 3HSGA 1KQKA 5KFIA 3NMAA 3R5DA 4X65F 3DKDA 4GC7A 4DSEA 3OR2A 3J81U 4WXOA 3TVZA 3K17A 1U1QA 2C2NA 2KT3A 3ZZOA 1SIZA 1YK9A 3D54A 1L3SA 1S0VA 2QRRA 5GADI 3LPYA 2Z2ZA 3OTEA 2JEGA 3IC1A 2HHQA 3VAHA 3FFIA 1HNZJ 4F04B 5LSRA 1S7HA 5J1EA 4AT1B 4LF5F 5M2UA 2LQ9A 4A48A 2HW3A 2YKAA 2DNPA 2RB7A 2VA3A 2GAHC 2HSEB 4I7FA 1N34F 2GQQA 1UAWA 3EE3A 4ZVSB 1X4AA 3HHNB 1S1VB 3ENAA 3MEGB 4OI2A 3FVYA 4WYWA 2RKIB 3OQ2A 4NYZA 3R27A 4CCHA 3C6UA 2XO6A 1BUXA 3O5TB 4P2MA 4K7QA 4LF9F 5LOQA 5C25A 4OJ1A 4OYIA 3M8QB 4ED6A 4CLZA 3RR7A 5AJ3F 4IO9Q 3GU0A 3T1YJ 1FJ7A 5BJRA 2ASJA 5A6WA 4ZVRB 1F60B 1IKVB 3HM9A 2BXJA 5K14B 3HHLC 1XIQA 3QZ7A 4U7CA 1WC0A 2DR9A 3THPA 2DIVA 5KFCA 2WRMA 5ITHA 3WHIA 4OJ3A 2Y9HA 5K20B 4JYAJ 2X3GA 3LALA 2UVWA 2DY9A 2CVIA 4JV2A 2DXEA 2CADA 1S12A 2OTLS 1VRQC 4AXJA 2AD9A 3OPKA 1MWZA 4KV8B 1YVFA 1SJ3P 2MZ1A 4H4KA 2QZ8A 1OMSA 1U48A 4Q7AA 1HQEB 2NCKL 3QRQA 2CZVC 1HNZF 2MQLA 8RUCA 5JVGS 2QL7B 5KAKA 3MUMP 3P96A 5L46A 3PV8A 2JL9A 4EZ6A 2OAUA 2ZJQS 3M2VA 2AW0A 1VRUB 3ILOA 4ZCKA 1TR0A 1UFWA 2NWAA 2B51A 3ILLA 1RT3A 3CPWR 1K73T 1WWHA 4ED3A 3JTPA 1S5ZA 3R5BA 4OIXA 4FYWB 5GAHW 2R8JA 2G6GA 2ZH5A 4KY3A 1IKWA 2W9AA 3H42A 1CS4A 1S6PA 3VAMA 1W26A 2YH1A 2YWEA 4PXCA 4DBQA 2QFJA 2XO7A 1U2FA 4C8OA 2C3PA 3TOQA 3T5HA 1U49A 2DH7A 2OPQB 4ZVHA 1R31A 2V8HA 5B0GA 3M32A 4X64J 4OYWA 4URGA 3QWUA 5KT4A 2VBZA 1VS3A 4EWTA 1BHNA 1NJXA 5AXKA 1C1CB 4TN2A 4KHMA 1NDCA 4DSFA 4C3KA 4V194 3QT8A 4ECRA 4QIGA 1RACB 1A6LA 3I4HX 2FZCB 4L69A 3RB3A 3DLLQ 4RLEA 3ELHA 1I5OB 2E5JA 4WKRA 4X4RA 4K5SA 2XZWA 1MLAA 1W25A 3TAQA 4HYKA 1RXOB 4WK3A 3OTCA 1M1HA 2DNRA 2RNEA 5LMNJ 5LM7E 4C8MA 4LF8J 5IZHA 1AW0A 4HTJA 4BDPA 3ETMA 4PXDA 4HT7A 4H4OB 4NLVA 2MB0B 2VQFJ 1F6TA 2UZAA 4LBHA 3H0PA 1AZSB 1T03A 1X4HA 2UXCF 3QSIA 2MDAA 3KUEA 1TL1A 3LWMA 4WZMA 1Q0NA 4LFCJ 2YKNA 3CCQS 5D3GB 2FY1A 3QO9B 3SBMA 2ZOGA 5I42B 1HWUA 2F3JA 2IMOA 3MM9A 4TQSA 1GK8A 2KFNA 3N6NA 1WF1A 2ZWPA 1JXVA 3FRZA 5MLCV 2AKWB 2QYCA 3EICA 4C2MA 4RJVA 2GGPA 3QSYB 1NAQA 3PRVA 4QWEA 1NYLA 3GYXB 3ZTPA 3KK3A 2Y1IA 2A6OA 4X64F 2JLEA 4QYZJ 1R0BG 2IBKA 2BE2B 2VONA 3UD5A 4V1Ak 2Y8YA 4TVAB 4F0HA 2FJWA 1P6TA 5CQGA 3CDBA 2CXEA 1S9EA 3DOMB 1MG7A 3GG0A 2ZOFA 3CULA 4X4TA 2A3JA 3RB4A 2E29A 1QRTA 4HDGA 4P74A 3CZBA 4ZN3A 3THTA 1HWKA 3JQKA 5DG9A 1FE4A 2ZKTA 1X4EA 4LF8F 2E7WA 3NOCA 1Y3KA 2LYVA 1JLQB 2YQ1A 2WK4A 1U6BA 4UF4A 4DPXA 4PG7A 2MKHA 4PQUB 2HMIB 2CQ1A 3NAHA 3KHHA 2W24A 3R5AA 4MIBA 2AGOA 1S79A 4LFCF 2QIFA 1JLCB 4AQYF 2DEJA 1D1UA 3WC2A 1U0SA 2ACYA 4IKAA 5H9EJ 3HSJA 2V69A 2BM1A 3MEDA 1YJ7A 5KFLA 4FNIA 1YBAA 1HKAA 2N82B 1N32F 4H4MA 2GIQA 1TK5A 1OWXA 5KG7A 2KTQA 2C1EB 1X0PA 2BJ9A 1S99A 2RH3A 3CD6S 1X8DA 1S0OA 3H5YA 2R2TA 4BWJA 1UVNA 2XWXA 3OL6A 1RBLA 2HYIB 3L3CA 3B4MA 4TY9A 2HZVA 1KD1T 4MK7A 2LVWA 4YHHF 4OMFG 3CEDA 1S1TB 5A76A 1OYEA 4J9UE 1D9FA 2W9BA 4IH5A 4KTQA 3PYGA 2RD2A 1LFPA 4DZDA 3CT9A 4ZJQA 2IM3A 2Z2YB 1CVJA 5KFFA 1SL2A 4IDKB 5DRKA 1KQGB 1XNRF 1CEZA 2AX0A 3CJ8A 1JJHA 2VG6A 1UVIA 2F8MA 5KFHA 1KC8T 4RBUA 2IJNA 2HZCA 2JC0A 1RYSA 2Y0SD 3KK2B 4Q8FA 1NPPA 5KFXA 1PG5B 1E6VA 1VQ5S 4NZ7A 1UDXA 2PT0A 3PO5A 2CZ9A 5KT3A 1GX5A 4DX5A 3LA0A 2UUWA 4ZVOB 5RUBA 2FHKA 1FRJA 4OJHA 2LFVA 2JZ5A 4USIA 3CCLS 4CNZA 4MK9A 1JLGA 3O2IA 3W60A 2ZE2A 3TA2A 3D3BJ 3EVWA 3KK1A 2JH3A 4EUVA 3K2YA 5HI7A 4PUOB 1AYEA 2HQGA 3KTQA 2IY5B 4DV6J 1S0MA 4QIVA 2G2ZA 3VCDA 3ICLA 5KFPA 4DLGA 4FYXB 5F9LA 2HFVA 1VQYA 3MEEA 3D66A 1FX2A 4IOAS 2IAJB 2BQ3A 2MQMA 4LMZA 2HHTA 3OUYB 3DRPB 3E01A 5I3PA 3N5BA 3W9HA 5FLXY 1BQMB 3M2RA 1H98A 2ADBA 2CQHA 4NLOA 2DYAA 2ZD1A 4K4YA 3IBWA 2MQOA 3BGOP 4KRWA 5HN0A 3M8ZA 4O3OA 4ZP8A 5IT0A 3PW7A 4IG3A 4Y2IA 4YY3J 4M1KA 5KFZA 4WWSA 4B9TA 2W4PA 1B0PA 4L3NA 4I2QB 2PI4A 3SCLE 3PYDA 2HGMA 1HW9A 2ZFHA 3C46A 4MMOA 4DV3J 3OD2A 1UZHA 2DH8A 3TZXA 2UU9F 1QAIA 4O44B 2JLGA 5GAGU 4PG8A 5IC4B 3D1OA 1D9AA 2W7OA 4DWIA 3R1LA 1HNXF 4Y2AA 3A8EA 4P2XA 3TX0A 1URNA 1DTQB 1CJUB 4L6V3 3AQPA 1NSPA 2EGWA 1ZETA 3J7A1 2BRKA 3TA1A 3WIUA 3ZXWA 4F36A 1C0UA 3N0VA 3DDNA 2CAJA 1RADB 4F4KA 1N6QB 2XULA 1RT7A 3VF0B 1F0XA 2RDIA 2QX0A 4WK1A 2HNDA 4U8VA 3BF4A 2FIUA 1TMJA 2P5VA 4QR2A 4QQBA 1SKUB 4I56A 2E66A 1YZ6A 2AU0A 2MKIA 1HNWJ 3IN5A 4HL9A 3H4DA 2O67A 2BUNA 1HPZB 1FFWB 3Q23A 1IBMJ 3JTOA 3IRXB 2LDIA 2ZZMA 1FF2A 2QC3A 4DX8H 2MLXA 1YJVA 3R6LB 1A9NB 2PNWA 4DQSA 3IS9A 5HLFA 4CZCA 1D0EA 1IQTA 1FRIA 2HHXA 2MHNA 1TL3A 1VISA 4ZIVA 3VQTA 2YNFB 1LQ9A 4DV3F 2AYGA 4ZVQB 4N77A 3T3FA 3QBCA 1T05B 1N5TA 4ETXA 2MKKA 4LSZB 4DS5A 2M8HA 3BKFA 3MAHA 1SC4B 2QO3A 5L9XA 3QT6A 2H1YA 1OJ4A 2HGLA 2DRDA 1GEHA 3EXYA 3EGZA 4FKXA 3D0HE 4CH7A 4I6WA 2YWKA 3CC7S 2NXUA 2NXCA 4M5HA 3MDFA 2UV8A 4ZLNA 1FDAA 2GA7A 4UOGA 2N3OA 3AH6A 2Q6CA 1G3OA 2AMCB 2DH9A 2ZJRQ 2BJ1A 3CCSS 2FC8A 4OZ1A 4KGZB 4DZ6A 2WHOA 4M5NA 1YTYA 2OSQA 2PC6A 3CCMS 4C8KA 4RU9A 3A8JA 1C0TB 4B3SJ 2I0XA 3P49B 2IM2A 2D7SA 4ED1A 2HKEA 4C4WA 1MN9A 2KYZA 1VQ4S 3GQCA 3C66A 3BBFA 2VODA 3GPAA 2W2QP 5J2PA 3OW2R 1UWBA 2N4CA 1SB6A 4IOCS 3BGLA 1ZM3A 2HFUA 1TKTB 2G4BA 2DO4A 2FVCA 3GIJA 1VYAA 1WKLA 2HQCA 1GXLA 4JI6F 3M8PA 4KJIA 1TELA 1JLBB 4OLPA 3J80Y 4A8MP 4PPDA 3FRYA 5DGBA 1RT5B 1X5SA 2X1BA 4CLWA 4CT8A 3MECA 4KHPJ 2YWGA 2VKZG 1LWFA 1VC0A 4LF1A 1VBXA 4QIEA 1WORA 1FRXA 3LO3A 4WE1B 4B9UA 1FT8A 2XG8A 1QD1A 2GHWA 2C2KB 1RTJA 1EAYC 5A0YA 2VD3A 2C2RA 2O66A 1IVZA 3DDKA 2OPPA 4DOZA 5HATA 4C48A 3RUBL 4CLLA 5IM0B 2WVEA 1H38A 3TNVA 3HPOA 2V94A 5F8GA 2W25A 1P8GA 3M6UA 4LQ9A 5D6GA 4K5RA 2IVYA 2B7CB 3MPWA 1WF2A 3OR1A 4FF1A 1CPZA 1QTMA 3MI7X 4M63A 1SKWA 4B3SF 5K8OA 4IG0A 2DVIA 4RNHA 2B9WA 1NO8A 5DQHA 2AJFE 1AXQA 3VHQA 3DLHA 3FUYA 3WX4A 1EETA 2JC1A 5HVFA 3HZEA 2CJAA 5CYQB 3DLKB 1GTEA 5J2NB 4ZA1A 1YHQS 4ECZA 1ZZNA 1JJCB 4B3OB 2CUYA 4R8UA 4NI2B 2HHSA 4MIWA 2HK2A 4KKOA 5F3ZA 4YMEA 4F3QA 3IGNA 4HR2A 3SSRA 2I38A 1MNEA 3B8HA 3EZ5A 5C42B 3TUPA 3QPIA 1I6JA 3JYTA 2ILYA 2HZAA 1P1TA 3LANA 1T9TA 5DM7S 2XS7A 1WKKA 2UXBJ 3QQCD 1FD8A 1J5OA 3DRRB 1GXTA 3DMJB 4WFBS 1MW7A 2GZOA 3D9BA 4NL5A 1FD2A 1H2VZ 3TEGA 3TVKA 4X4QA 4MH8A 1PAEX 4HKQA 2BKOA 2VKRA 2KL8A 2LEAA 3H4BA 4KT0C 4C97A 3FEYB 2NSBA 2RILA 4HACB 2M2BA 1XN9A 4ZITA 2KJWA 1IUJA 1SC6A 2FC9A 3SXLA 2AWZA 3HSDA 5HAOA 1WTBA 3MM6B 1SVDA 4J9NA 3PDNA 2F9DA 2W8LA 3I0RB 4ZLLA 4NRTA 3QT7A 4B3MJ 1PCAA 3S6EA 4PYAA 2XHCA 3TUJC 4DR1F 2MKJA 1FKOB 3MR2A 1S0NA 2LEBA 1Q8LA 5ADZA 3W9IA 3T1HJ 4LFAJ 3OTBA 3MAAB 2B5JA 4ZP6A 2I6WA 5DDOC 3SCIE 1ZA1B 1XNQF 1MMLA 4TQRA 1WHXA 1LWCB 1IWGA 2ASYA 2K2PA 2V6AA 1YSJA 4L74A 4X4NA 1OY8A 1X4GA 1HYSB 3BKTA 3RAQA 5LMUF 5BYQA 2XTJP 4FS2A 3PKMA 2Q6BA 1Y5LB 1BLUA 2UXBF 1Y11A 4G1QB 3K58A 2K1RA 3QJJA 5D4LA 4NZ0A 4DU7A 2UUAJ 1VHYA 3HVTA 2AYBA 1QM9A 2CKWA 2L9DA 2NLWA 2GJFA 3C15B 1WC5A 3PY8A 4R0JA 1FERA 4E2FB 4B08A 4J9KA 7FDRA 4MTPA 1NZAA 2DGWA 2E7XA 3FCHA 2RSQA 1YJ9S 3BEGB 2G0JA 4HH0A 4UZCA 3EX7B 2R7WA 5KOWA 3PEHA 4K2XA 1HBMA 4DPUA 3ZZZA 1LW2B 1DHMA 2Z0GA 1JXEA 1DTTB 1M5OC 4NXMJ 3DM2B 4DV4J 2HVIA 1IKXA 3CSKA 2UP1A 2H5EA 2GVZA 1W2BR 1D09B 4LFAF 2R3VA 1LW0B 4WIIA 2VC0A 3AB4B 3UDLA 1JNRB 4EBEA 1Y00A 4DF4A 1FA0A 2XBPA 4J7CA 3DOKB 1WEXA 4IO1A 3R8YA 2YNIB 2BR0A 1IBLJ 4DL4A 2XMUA 1DBDA 2VA2A 4QPTA 1E6YA 4RW9B 3OHAA 1N5YB 4DXLA 1B7FA 2BOPA 3J81Y 1HQEA 4ZOSA 5B0AA 3DYAA 1HMVA 2KZZA 3GFXA 4NASA 2P9CA 4M5GA 2U1AA 3MPYA 3R7BB 1X31C 3FEZA 4PRFA 2JHEA 4B02A 2R7TA 1DFDA 4FDFA 1T95A 2Q79A 2UUAF 1RT6A 4YB6A 3R1HA 3JSRA 4DL5A 3IP0A 1KLMB 4FP9A 3NL0A 3KLIB 4ELUA 3MM5B 4K50A 2AP6A 4NA3A 2RT3A 5KFJA 2LXIA 2ROPA 3NS7B 1ZS6A 3C2PA 2PI8A 3HJVA 1Q86T 3QGPA 2WOMB 4LRCA 1L3KA 1LEOA 1FRKA 4EK2A 3UNYA 4USMA 3W5ZA 1MWYA 3H5XA 1A7GE 2OJ3A 3W2WA 4O4GB 3P8BB 2HRYA 2NZCA 4A8OA 4AYBD 2RRAA 2O01C 5DDRC 4DFKA 2QT7A 1SJFA 2J9CA 1TQLA 3RZAA 2OPQA 4ATNA 3MMCA 2OIHA 2D3UA 2YNGA 5J2MA 4W4MA 2RHQB 2R42A 1XBWA 4RW6B 4GVLA 3UR0A 5AE1A 2VL1A 5A8KB 2J0XA 3C16B 4EI2A 1G1XA 1Q7LB 4ZVFA 4PWUA 1J27A 4LUBA 3VAIA 3UN2A 2CYYA 4ED8A 1IBLF 2PJJA 3IGVA 1TFYA 1QRSA 4DCOB 3NGSA 5HBMB 3HHLB 2ZOMA 3G96A 3SV3A 4CIOA 5LL6d 3UDEA 2VHGA 2ZNYA 4RW4A 5AXLA 4A4JA 5L38A 3VAJA 1Y3JA 1N5QA 3Q8SB 3B54A 4KR0B 4QW8A 2W9CB 3LUYA 1CJVB 3LQVA 1JB0C 3ZFVA 1WI8A 5EWGA 4J9SA 2WVCA 3D6MB 2GS8A 4YFUA 2WSCC 4HI2A 4LBIA 4DR7J 3R2DJ 1FVSA 3LWLA 3NGRA 1RT1A 4OI3A 3HK2A 5ETQA 1S4EA 3NBPB 3VGSA 1S9FA 2GW8A 2HAIA 3U1NA 2OFGX 3QO9A 4DLEA 1K44A 4U67S 1IWAA 2HEKA 2EFNA 3KMSA 1UVKA 4FVCA 4QOTA 1NK4A 4TKTA 1WEZA 3AOAA 2CWXA 3EGWB 4I67A 3DFEA 3HT3A 2JSXA 1T9UA 2UUTA 2ZHAA 2JWNA 2VG5B 5CCLA 1XEZA 2PE8A 2M88A 3UR3C 2GIFA 1KRPA 1MMDA 3HT0A 2FGOA 2BANA 5CH7B 1RCOB 2D3ZA 5ETMA 2GCFA 3JAMU 4HH1A 1RTIA 3M9MB 1JMTA 2BE2A 2HFZA 4QR1A 1EQMA 5KFEA 2J7KA 3ET6A 3MM7A 1RI7A 4F02A 1CC8A 1SKRA 1JXLA 1UTAA 4NA2A 3JSMA 3Q0AA 3M30B 4OYZA 3OJSA 2ZH8A 4UQGA 1IR0A 3RYLA 2YPYA 3Q83A 1TKZB 2AIRB 3UDCA 2FYXA 1IBKF 2POKA 3V6DA 3KLVA 4F0KA 3GR1A 4I69A 1GFWB 4DL6A 1WDTA 1Q7YT 2Z58B 4F4ZA 3LGMA 1SQGA 4O3PA 1TU0B 3CUNA 2XI2A 3HD2A 2CPDA 3R5CA 2CQDA 4M5MA 1IKYB 4MJKA 1C1BB 3PRBA 5IWAJ 2CNLB 3UCZP 1SC3B 3TP2A 3W3SA 1RB0A 4DR7F 4ZVUB 5HROA 3I5AA 1KOOA 2GHVC 4ES3A 2AJ4A 1ZOTA 2DHHA 1WKJA 3NRBA 1F9EB 3EZUA 1NK0A 4ZIWA 2QMXA 3I0SB 2EKNA 2GVDA 2RU9A 3MZIA 1GX6A 4BHQA 4ZJLA 5DLFA 3J81j 2RU3A 4I64A 2VOOA 2JNJA 3LF0A 2E5LF 2BOAA 4WP3A 5B0BA 1YJUA 3UO0A 2MZQA 3BYPA 2XS2A 2ZHBA 4OX8A 3TWZA 1DURA 1WJ9A 1VHFA 1HD1A 1MN7A 1JNZB 1S4FA 1TL7B 4RUCA 1S59A 4ITSA 4DV2J 1O8BA 4O3RA 2B9EA 4TYAA 4ELTA 2E44A 4OZ2A 3D0GE 2IHR1 2XQCA 4F67A 2F7VA 2DHSA 4L3KA 5LT5A 5L9NA 4KGXB 5ETRA 3D1HA 3ZTOA 2CPJA 2HNYB 4BC7A 1N33F 3OXLA 3MCOA 2OPRA 2W7AA 2FQQB 1HQUB 3LPEA 1G7CB 1QAXA 3UQSA 3NWGA 1V9OA 4KH0B 4UT4A 3TQ1A 5HQ8A 4I1TA 4P10A 4JI8F 4Y0FA 2QA4G 3EMTA 5JVHS 2FJBB 4JV5J 1GH8A 4NLDA 4RW7A 2AX1A 1DLOB 3I6PA 5DJBA 3IRWP 2XHWA 4KBIA 4PZVA 3JQMA 2HHHJ 4LVOP 4UOHA 3VWSA 3NLCA 4OLOA 3MMBB 5L8RC 2W2OP 4B3TJ 1QY7A 1RTHB 2C2EA 2MQNA 3HHEA 1LWEB 2FTRA 4WFZA 4JI2J 1R0AB 3MPDA 2EC2A 3QRPA 4ECXA 4OYPA 2AT1B 4IH6A 2Z2LA 5THWA 4HI1A 4OFZA 2FVSA 2RE1A 2CG4A 2K06A 1R0CB 5KT6A 3CWJA 1N36J 1S77D 1RT2B 2VFTA 1V5VA 2EFQA 3W2VA 2B8QA 2LKZA 3MTJA 4AFFA 1N88A 4FF3A 5E3QA 3FMWA 1YDLA 1RA7A 1HLWA 4P2SA 1ZPWX 1RAEB 2FY8A 1MU2A 2IC3A 1DQ8A 1TKXA 3EPGA 1Q4RA 4X4UA 1IXKA 1KS2A 5F8NA 4RW8A 1CJKB 3BGRB 3R7NB 2JVOA 2HWIA 4Z7CA 1O51A 2HS4A 1Y4ZB 1MWQA 4K4XA 5A8RB 3UVJB 3TUIC 4GO5X 5EX3A 3SEOA 3EWGA 1OY6A 3IR6B 1Q78A 3BH6B 4QCLA 1BC6A 2EFVA 5T7LA 4IFYA 2QLWA 4JV5F 1M5SA 3KJVB 4IRDA 3MFHA 2YWHA 2AEJA 1K0VA 1RU1A 1EJ7L 4J9MA 2BM0A 1ZM4A 2FD2A 4BS2A 4HHUA 3CJKB 3TJ9A 2HHHF 4U9RA 5JJBA 4ZCLA 1RHUB 4WJBA 3VGVA 4PKDB 5GAHI 2V2KA 5HSPA 3ZZTA 5IQ6A 4YOEA 3TAMB 2PGCA 3ZZRA 1RU2A 5H9EK 1HR0J 1VHIA 2XWYA 3RBXA 5KFBA 4KGMA 5SUHA 1RK8A 4OI6A 4ECUA 5IXUA 1WG5A 2AEMA 1CULA 4Y2KA 2WBMA 2PMZD 3CIMA 2YXLA 3FBBA 1NMEB 3Q8VA 1CJUA 4LSLB 2JFKA 2XC9A 3UE2A 1XR7A 2ADCA 2E7VA 5HQLA 2HIQA 4F4YA 2XCPA 1JKHB 2KFYA 3TZZA 4AL6A 3A8KA 3HKWA 3TQEA 1L3UA 4K8RA 4B3RJ 4ED7A 4C11B 1R27B 1SJQA 2DIUA 3LP1B 4X4PA 3BN4A 2A2DA 3Q8UA 1HBUA 2H54B 1VQOS 3I5BA 2V2ZA 4DL7A 2CPFA 3P4UB 4RWXA 3DHXA 3RGIA 2YY3A 2YKMB 4CO5A 2P8IA 1F5AA 2DBBA 3CJTA 1NK8A 4ID8A 3H59A 1J5EJ 1JJ4A 1NRKA 2HVHA 2EXUA 1XMBA 1S9GB 3L7UA 4ZVTB 9ATCB 1GMUA 4UTGA 4O3NA 4RL1A 3QIPB 2C2ZB 4DR4J 4QWBA 1FESA 1JLFB 2HQIA 2CVEA 2RF2B 4W90B 3D28A 3P45B 1ULRA 3AA8A 4MFBB 1EUQA 1WOOA 1LOUA 3BPSP 3ISND 3U7JA 4E8BA 3QT5A 2L08A 1VBKA 2BYCA 2JEIA 3PIOQ 4WU2A 5IC6B 4DR3F 3MGJA 4QIFA 4ILLA 1OS5A 3V5RA 2XY7A 5DG7A 2HBRB 3W7BA 4ECWA 3DLGB 1HI1A 2CQBA 1UEKA 1R7IA 3OXFA 1ZAWA 3UCUP 4JI5F 4M5IA 3U1MA 5B0FA 5EHHA 1I51B 1EUYA 3KG1A 1AFJA 1NBEB 2FJVA 5E3CA 2Z56B 1NJWA 3L7PA 3HMJG 4KFBB 4JI3J 1IM6A 1REGX 4B3RF 3DRSB 2VF3A 3DOLB 2ZBQA 5J1NA 4A8SA 2RE8A 5DQIA 4CLPA 3T6JA 3FNNA 2K7JA 2OLWA 3HVWA 4J9LA 2DR6A 1EXDA 2ZNZA 4N41A 3SYZA 4FXDA 4WCES 3CCUS 1SUQB 3ZTQA 2CFXA 1U7LA 4WTOB 4KSEB 4QBUA 2G5DA 3W5YA 4XPCA 1UP1A 2Q43A 3QAUA 4ED2A 4Q0BA 3Q22A 4ZLPA 3P3DA 1WUUA 3V4IA 2VFUA 3GSIA 2XY5A 1NZ8A 4MKYA 5CYJA 2OD4A 4ZCIA 3CO9A 3UPFA 2VFSA 1WTFA 3CF5Q 1LV5A 1Z2LA 3PW5A 4KO0A 3FQLA 4NZ6A 3NGDA 1RT5A 2KN4A 3T6BA 4DJBA 3RRKA 1NK5A 2B6AA 3OLAA 4DSLA 3OR2B 1GXUA 4YP3A 1YBTA 1I94F 1S1XA 4ES2A 4I6AA 1HD0A 4HTIA 2DGSA 4WFNS 3CIZA 3PR4A 2V8VA 2MLZA 5H1SV 2OO4A 4QZVB 2J8SA 3J7YU 1S10A 3FFIB 2W7PA 3AY0A 5J1EB 1TL5A 4JI3F 2DT9A 1BQNA 1UVMA 3KLFA 3HVAA 3PHTA 4NOHA 4X66F 1Q95G 2D1CA 4I7FB 2QL5B 3OL8A 4Z7YA 4JI7J 2EEYA 2EPIA 1BQXA 2H65B 2COLA 1HHQA 3J7Z5 2V9WA 3PO4A 3HXMA 5KFKA 2KZMA 2MJNA 1DFUP 4X4OA 3KLHA 4J9QA 3GV7B 3M2UB 1X5PA 5IT9Y 3MMAB 3QNWB 5CHCB 2X1FA 3C6UB 3E2EA 4ZPCA 4FN5A 1AB8A 4Y00A 3NY0A 4E98A 4CTAA 4URSA 1SH2A 5BNZA 1FHTA 1VRTA 3PNIA 3GIMA 2DCUB 4NI2A 2ZUAA 3A12A 4U8YA 1FI4A 2H48B 4B9LA 2V4JA 2MKYA 3PXGa 5C42A 3MF5A 1UPMB 4X65J 3DU5A 1JLAA 1UVLA 4NCBA 1H73A 5C24A 3BR8A 4UZBA 1P1LA 3GB0A 2XMWA 3N9UC 2JEFA 1ZBTA 2XLKA 1F2HA 3Q8YA 1GTHA 4PQAA 1VBYA 5KG1A 1C4AA 2HURA 5E3PA 4R0EA 1X4CA 5C2CA 3CMES 2V0NA 4LF5J 1L5UA 1U2RA 2XMAA 4AE5A 2BJ8A 4UUWA 4DQPA 2GO9A 1DRZA 5FJ4A 5CYMA 1WSVA 3PG9A 5JVGQ 1N34J 5GAGW 4DR5J 3AFGA 2R7SA 4ZK7M 4HLBA 3W8GA 1NPKA 2ZJQQ 4Y65A 1OIAA 1KSPA 4JI7F 2CJQA 2OH2A 4K2JA 1RT3B 3IM8A 3KLEA 2F65A 1VQSA 2EG2A 2OP5A 1TK8A 4DF8A 2K7KA 3CJSA 3POTA 1CQMA 3U02A 3MHYA 2CJBA 1IKWB 5DLGA 5ETTA 3UW1A 1CS4B 1NXIA 1S6PB 2DJWA 3UDVA 1YI2S 1C4CA 3ZC4A 2HBYB 5CZVA 2V34A 4PAAA 3TANA 2HZ7A 1U26A 1DARA 1PBAA 2N4DA 3TA0A 2CNNB 1RGVA 3MOZA 2R8KA 4OZLA 2C3UA 2XCAA 1N56A 1X9WA 3HP6A 4DSKA 2XZTB 2DXFA 3OTDA 4ZJOA 4NWBA 3M32B 3OV7A 1OO0B 1VLOA 2ZJPS 4MT1A 4ZVPB 2JRSA 4BWMA 3NOGA 5KG4A 1EKRA 1WG4A 1F5CA 2XSFA 1V5IB 3QAEA 3KJQB 4WIQA 4PWDB 1RBAA 1T9YA 3FZ2A 3CCRS 3ZNUA 3VZIA 2XSJA 3TZYA 1VJQA 4N7TA 4XAKA 3HI9A 4P7TA 4PABA 3KW2A 2V5HG 5GMDA 3DN9A 1PYOB 1RKJA 3DLBA 1RKIA 3RBDA 3RB6A 5IFMA 3K5LA 5BR8F 2IRYA 4DV1J 4DR5F 2CG8A 5EN1A 2F4FA 1LFWA 2Y8WA 4ZHRB 4WF9Q 3KYLA 1PO6A 3M7VA 1F3VA 4EYHB 2XNQA 5FDLA 2H4WB 5GADU 4ICLA 3BBCA 1R6YA 2VG7A 1XERA 1T03B 2DNKA 1TL1B 1Z85A 2MY7A 1SV5A 1X5TA 2YKNB 3H40A 2BMBA 4GMKA 3GJTB 4ZPVR 3MM9B 4DPOA 1CSJA 2B56A 3IBCB 2Q3PA 3MAQA 1DQ9A 2AYMA 3BSOA 1R8AA 3LP0A 1AUDA 1U24A 3E3XA 5K9FA 2R9LA 3SSQA 5J2QA 4ZPBA 2GGPB 3V2UC 2QGFB 3QJPA 1UETA 1T9VA 3KJFB 3HFZB 3IWXA 3KK3B 2DRAA 2QMWA 1X0FA 4CO1A 3RRGA 1NK9A 1YG0A 3PEJA 4J9RA 3A3OB 3SI8A 4A8YA 4LRAA 1TZ0A 2ILZA 4NX9A 3QLHA 5MAOA 4ZS6A 3L95X 4Y28C 1S9EB 1S49A 2GIRA 3FSYA 1U1RA 2NSCA 2G0IA 3JTNA 1U6ZA 3P5BP 4USWA 2VIHA 4DV1F 4DQQA 1CBKA 3M6VA 2FHJD 2AJ0A 3C14A 3OL7A 1PGZA 3HCXA 1U47A 2UXCJ 4JV1A 1LKZA 3G82A 4LR7A 4YDXA 1VQ8S 4N56A 2WW4A 1K9MT 1WHYA 4ECYA 2YKPA 4JXXA 3T5JA 2WONA 3HD1A 3RAMA 2MGZA 4A8XA 3D67A 3FSIA 3N6MA 4CT9A 4RW6A 1JJ2R 3D5MA 5A8KA 1M5PC 4CH1A 5L1IA 4NMLA 3MEDB 4DDFA 4I4BA 1NDKA 4L75A 1U1NA 4H4MB 3I4PA 1NJZA 3MM8A 6AT1B 2L3MA 3CE8A 1QLNA 5T41A 3FBCA 2G13A 2EFGA 1VC5A 4U7UK 3H2UB 2JDJA 4DUTA 4DG1A 2QSFA 4RO0A 2B4OA 1XR5A 1HBNA 4JI4F 2ZVSA 5KFQA 3N28A 3KG4A 4NLTA 1EP4A 1HL6A 5HO4A 4OYMA 3TEHB 1YBUA 3F41A 2J76E 2O3DA 4RNOA 3GFYA 3MEKA 1LXNA 3Q89A 5D4OA 2W9BB 5B7WA 1UFKA 4RPFA 2Y0BB 5CD4H 3PZPA 1N52B 3H7HB 3HZGA 2CNOB 4IFVA 3KOAA 2QSWA 2W4CA 4YB5A 4RWWA 2F9JA 3DXBA 3KLGA 1QUVA 1QE1A 2BW2A 4K4TA 2NQPA 3G8SA
chains in the Genus database with same CATH topology
2KG1A 3KK2A 5E33A 2B43A 2ROEA 4HH0A 4IOBA 4XIUA 3EX7B 2R7WA 1KFDA 5KOWA 1FTCA 4RUHA 4UW2A 4YEAA 3MWBA 3SCKE 4A8FA 3PEHA 4N8NA 4K2XA 1M90T 3M1VA 1HBMA 3VTIA 1Z4UA 3ZZZA 5U47A 3LP2A 2WB1D 1LW2B 2O1PA 3QZ8A 1KFSA 1H6KX 1S76D 2I5JB 4ALZA 1S9GA 3Q24A 3WBZA 1DHMA 1U1PA 1YRXA 4AXIA 1NKEA 2FLPA 3KWMA 4QYRA 2HLTA 2Z0GA 1JXEA 3GFHA 1DTTB 3AJ2A 3QIPA 4YY3F 1JLFA 1M5OC 4OHVA 2HS3A 1M5HA 3DM2B 3X3UA 4JV0A 2HVIA 1SL0A 3OFHA 2BBEA 2LEPA 4PG4A 1IKXA 2RF2A 3IR5B 2EBEA 3CSKA 4Z37A 2UP1A 1K1SA 2AV5A 2PIIA 2CPHA 2H5EA 2FHOB 2VUGA 4MFBA 2XMTA 2NYIA 2R7XA 4C98A 2ASLA 3BZQA 1W2BR 2AF6A 3UWTA 4O23A 4LFAF 1DAXA 1LW0B 3S8SA 4WIIA 3F56A 2VC0A 3AB4B 3UDLA 2RQKA 1JNRB 4EBEA 2RUGA 2R7OA 1HI8A 1Y00A 4DF4A 1FA0A 2E5GA 1X4BA 2XBPA 1UVJA 2CIMA 5HP1A 4HEA9 5EGYA 3AAWB 3TAPA 1S6QA 3DOKB 3PIOS 4OQJA 1WEXA 3F73A 2CQ3A 4IO1A 3G6YA 3ZZUA 2YNIB 2BR0A 3K8VA 3TI0A 2LA4A 3BGUA 1R89A 3AQOA 3OSNA 3ENWA 4DL4A 2XMUA 5DM6S 1WF0A 4A8KA 1DBDA 2VA2A 4QPTA 1E6YA 4RW9B 3GR0A 5B08A 3OHAA 3ZZ0A 5GAEI 4WFAQ 4DS4A 1N5YB 4WTYA 2N7YA 2HVZA 1JLGB 1B7FA 3OJUA 1SXLA 5HMYA 1ELOA 3UCGA 2BOPA 2UXDF 3AJ1A 3J81Y 1HQEA 2JX2A 4ZOSA 3DYAA 5B0AA 1HMVA 1QUPA 1ZYQA 2KZZA 3GFXA 2YKQA 4QIWD 1HWIA 2ZE2B 3MD3A 1LK5A 3AA9A 3JB9k 4PUOA 2FJAB 2GMHA 2P9CA 1R43A 3KK1B 2J6UA 2U1AA 3MPYA 4A8WA 2FVRA 3FEZA 4PRFA 3BQ0A 4KFBA 1IM4A 5DM7Q 2PSZA 3OSPA 3EGNA 2RIJA 4MYTA 4F3OA 2JHEA 4B02A 3DRSA 2R7TA 1DFDA 1T95A 3DNCA 4X84A 2Q79A 1U1KA 4NCGB 2UUAF 2YKOA 3V6KA 1RT6A 4DHVA 4YB6A 3DGPA 2NPIA 4X4VA 3M9NB 2DNQA 3R1HA 2KM8C 4ECVA 2ZH3A 2IAJA 4OJGA 3DXSX 4FF4A 2E1AA 3JSRA 2PD1A 4DL5A 3NS6A 2RRBA 1TP7A 2PA3A 1KLMB 3OUYA 4FP9A 2MY8A 3DRPA 1U1MA 4BC9A 3OLBA 3NL0A 3KLIB 4A47A 4ELUA 4DMZA 2OSRA 3MM5B 1BQMA 2AP6A 2VV5A 4NA3A 1KNZA 4K50A 3HHLD 1YJNS 3NNHA 1VBZA 4NLQA 4DV7F 2BA9A 1UL3A 2MKCA 3O3LA 4OZJA 2RT3A 4YQWA 5KFJA 2LXIA 4IOAQ 2JVRA 2C42A 3K57A 2ROPA 1HNWF 1SUQA 2R7VA 2IM1A 3C2PA 1Q86T 3BJYA 3G9CA 4CQ1A 3N79A 3E01B 4Y2CA 2B4UA 1IBMF 3QGPA 2PO4A 4WZQA 1FK9A 2WOMB 4QWCA 2KHCA 3M2RB 2DTJA 1L3KA 4ECTA 2XS5A 1AFIA 1FRKA 2HG4A 4ZMMA 1S48A 3CDUA 5DS7A 2J9DE 3I31A 2YTCA 4WCEQ 1UA1A 4F8RA 1MWYA 3DLEB 2VH7A 4MKBA 3H5XA 3O44A 4B17A 2RRNA 1A7GE 5BYRA 4N47A 3T5KA 2OJ3A 4M94A 3W2WA 4O4GB 1WG1A 2HRYA 2RMLA 4DL0C 4NLRA 3IO1A 4A8OA 4AYBD 2RRAA 4B9SA 4IR9A 2O01C 2ZD1B 3GSDA 1X9MA 1UW4A 2CQGA 1YGYA 4MIAA 5DDRC 4DFKA 3G6VA 4I2QA 2QT7A 2AJ1A 3MUVP 1SJFA 3T19A 4LJMA 2J9CA 1TQLA 4GKKF 3G8TA 4IG3B 4Q0BB 1YQHA 1U25A 1TV6A 3RZAA 2VPZB 2OPQA 4DV5F 3FEXB 4ATNA 3V6HA 3CF5S 2WAQD 5EUHA 3G71S 3NS5A 3MMCA 2OIHA 1X5OA 1V3ZA 1R3NA 1L3TA 2D3UA 2YNGA 4O44A 5F41A 3V4IB 4TU8A 5J2MA 4F2SA 3FJ2A 1S1WB 1Z1ZA 1P27B 1XBWA 1OPZA 4RW6B 3N4WA 3UR0A 5AE1A 2VL1A 5A8KB 1WI6A 1KQKA 2J0XA 2FJEB 1M5KC 4AL5A 5KFIA 2VPWB 1G1XA 2B3TB 1Q7LB 3NMAA 4ZVFA 2RS8A 4PWUA 3R5DA 3JAMY 4X65F 4LUBA 4P6QA 5D4NA 3EYZA 2J8AA 3KKFA 1NH7A 3VAIA 4H4KC 4GC7A 4DSEA 2CYYA 3MOJB 3OR2A 3HVRA 3BO4A 1DTQA 4I68A 4WXOA 4ED8A 4KO0B 3TVZA 1IBLF 3GFZA 3HHKA 4N76A 1U1QA 2EKYA 3IGVA 1TFYA 2DCLA 1QRSA 2KT3A 4O3SA 3ZZOA 2LQBA 1SIZA 1FRLA 4V19J 5LSOA 3D54A 1L3SA 1S0VA 5HBMB 1NNDA 2B7BB 3HHLB 5A8WA 2ABYA 4H54A 4NCAA 2B6AB 2ZOMA 5B09A 3G96A 3SV3A 2QRRA 5GADI 5L1KA 3LPYA 4CIOA 5LL6d 5GAHU 3OTEA 2IFXA 2Q1LA 2ZC3A 3IG1A 2JEGA 2ZNYA 3IC1A 1URRA 2LCWA 2HHQA 1RT4B 3P5TL 4TXSA 1S1XB 4RW4A 1N0VC 3VAHA 5AXLA 2KRBA 3FFIA 4A4JA 3SFGA 3O1LA 5L38A 5LSRA 1RYRA 3VAJA 1S7HA 1Y3JA 1N5QA 4WFNQ 3Q8SB 1N6QA 5J1EA 4KR0B 4QW8A 4LF5F 3HKZD 2W9CB 1QSLA 4GC6A 3LUYA 5M2UA 2LQ9A 3GIIA 4LFBF 3SQGA 1TVRA 4A48A 1HNIA 2YKAA 3LQVA 1JB0C 3X1LB 2SXLA 3RW7A 3ZFVA 5FIIA 2HW3A 1WI8A 5G0RA 2DNPA 2RB7A 3J7ZV 1VGYA 5EWGA 3OVBA 2P6TA 2VA3A 3Q8RB 3VAFA 3V4MA 4J9SA 4I7FA 1DLOA 1N34F 4YFUA 2WSCC 4HI2A 2GQQA 3CCTA 4HHJA 4TY8A 4K4VA 1UAWA 4LVNP 2RVJA 4DSJA 4E8UA 1X4AA 1FRHA 1BQNB 2HNDB 1R8CA 3HHNB 3KLFB 1S1VB 2K3IA 1HPZA 4NLSA 3MEGB 1FVSA 4NYOA 3LWLA 3IRXA 4OI2A 1RT1A 4OI3A 3HK2A 2KO1A 3FVYA 1RTDA 4UY8T 1SJ4P 4WYWA 1VK3A 3NBPB 2GMJA 2RKIB 4B9NA 3OQ2A 1TK0A 1VQKS 4NYZA 1S9FA 4Q43A 3R27A 2GW8A 4QPXA 2HAIA 2ZITA 5KOXA 3U1NA 2OFGX 3QO9A 2HLUA 3G6XA 4DLEA 4CCHA 4CH0S 2BVZA 3C6UA 2HHUA 4ILRA 2G1DA 4U67S 3M8RA 3O5TB 5AE3A 2J9DA 2EFNA 3L7OA 5IS2A 3KMSA 3KLHB 1UVKA 4LF9F 4FVCA 4QOTA 1NK4A 4C8YA 5C25A 4OJ1A 4TKTA 1WEZA 2NUUG 3CTRA 3ETOA 1X9SA 3M8QB 4ED6A 2QA2A 3CMAS 3EGWB 3RR7A 3KG0A 4N8OA 3U27A 4I67A 3DFEA 3HT3A 5AJ3F 2JSXA 4IO9Q 5LXRA 2UUTA 4JBCA 2ZHAA 2JWNA 2VG5B 4FBTA 5CCLA 1XEZA 2PE8A 5BYSA 1O5JA 2M88A 3NNAA 4UY88 1FJ7A 3RW6A 3K5PA 5BJRA 3GE9A 5HLFB 3UR3C 4CTAB 2ASJA 1VQ6S 1YWXA 5A6WA 4X2BA 1KRPA 1MMDA 2E5HA 2YNFA 1M5VC 2P6SA 4YB7A 1VRTB 1F60B 1IKVB 5F3TA 2FGOA 3HM9A 2BANA 5CH7B 2D3ZA 2BXJA 2GCFA 2IVMA 4TU7A 5K14B 5L1JA 3HHLC 2UUCF 3QZ7A 4JXZA 4HH1A 1RTIA 1T8EA 2Q66A 2HFOA 1T05A 2JJ4D 4U7CA 3M9MB 2DR9A 3THPA 2DIVA 1JMTA 2BE2A 5KFCA 2V4JB 2XNRA 2HFZA 2WRMA 4QR1A 2X1AA 4EBDA 5KFEA 1MMNA 3H2VE 5ITHA 2J7KA 2KRRA 4OJ3A 2X3GA 3MM7A 1Q82T 1RI7A 4F02A 3LALA 1CC8A 1SKRA 4C8ZA 5HP1B 3NP5A 1JXLA 2BACA 2UVWA 4NA2A 1S6QB 4C3MA 2EFPA 3JSMA 2CVIA 3Q0AA 3RBEA 1JLAB 4JV2A 3M30B 3OJSA 2ZH8A 3WDOA 4KGKA 4UQGA 2MMYA 2OTLS 5A6PA 1IR0A 4J37A 3TARA 2E1MC 3RYLA 4AXJA 4FF2A 2KB2A 2CJ9A 2AD9A 5C24B 2IBOA 3OPKA 1MWZA 1TKZB 2OMLA 3UDCA 2KXNB 4KHPF 1IBKF 2POKA 3V6DA 4KV8B 1YVFA 3S1TA 1SJ3P 4M95A 2M7SA 2MZ1A 1QAJA 3KLVA 2QZ8A 4H4KA 1YRTA 1B0VA 5KG2A 3GR1A 1KTVA 4I69A 4NYPA 4DL6A 5HL7S 1U48A 4Q7AA 1HQEB 1Q81T 2FLOA 5DO2A 5EX0A 4XO0A 2CZVC 3NG8A 3OTOF 1KTQA 2XMJA 3I55S 4F4ZA 2MQLA 2BQRA 1HNZF 2VOPA 3LGMA 2PFFB 3IAM9 1IN0A 4O3PA 1YJRA 5JVGS 2IVFB 3CUNA 2XI2A 5KAKA 2CPDA 2GNKA 5SZTA 4QW9A 3R5CA 1TL4A 2ZJRS 2CQDA 2F1FA 3MUMP 1IKYB 2NREA 4MJKA 1C1BB 1HA1A 3PRBA 3P96A 3PV8A 3VALA 1GNKA 2JL9A 3CB4A 2B9XA 5DQGA 3UCZP 4EZ6A 2OAUA 3TR5A 2ZJQS 3M2VA 5CYMB 3TP2A 2QLXA 2AW0A 2IRXA 3W3SA 1VRUB 4DR7F 4OZ5A 1KQSR 3OVAA 4ZCKA 1TR0A 1UFWA 4OI1A 3CJKA 5HROA 3I5AA 2KH9A 1KOOA 1PILA 2GHVC 2B51A 2MKSA 4ES3A 2AJ4A 1ZOTA 4A46A 3Q8PB 1RT3A 1PC4A 1C0TA 4NLGA 3PW2A 3CPWR 1QVFR 3NRBA 1BY9A 5E3RA 1K73T 1WWHA 4ED3A 2A2CA 3JTPA 2ZHOA 3KNAA 2LLZA 3EZUA 3R5BA 5E0OA 1ZAVA 2IJFA 1NK0A 2DHAA 4OIXA 3JSYA 1G6BA 3K5OA 3BQ1A 3CJ4A 1SI9A 3M8SA 2QMXA 5GAHW 2R8JA 3FZBA 4LF4F 2EI5A 3I0SB 2ZH5A 2A10A 2RU9A 4YR3A 1U6FA 2F40A 1FRMA 3MZIA 1GX6A 3KLEB 1IKWA 4MYUA 4BHQA 2W9AA 4DFJA 5DLFA 3ITHA 1S6PA 2RU3A 3G4SS 3OL9A 3HX9A 2FHMA 4I64A 3VAMA 2VASA 5T14A 2VOOA 2YH1A 1QTQA 2YWEA 4PXCA 4DL3A 4DBQA 3ZZYA 2QFJA 3POTB 1N8RT 2J6TA 3Q2TC 3LF0A 2E5LF 2VPYB 5B0BA 2XO7A 1U2FA 1YJUA 4C8OA 2MZQA 2PEHA 5KT5A 2XS2A 2ZHBA 4OX8A 1HI0P 3PACA 4R5PA 2DPJA 2KG0A 1DURA 1TKTA 1VHFA 3MFIA 1S4FA 1JNZB 1HD1A 4RUCA 4AL7A 2C3PA 3TOQA 3T5HA 4ITSA 3CDWA 4U6PA 1O8BA 4O3RA 4OHZA 2YX4A 4TYAA 1U49A 2DH7A 1R8BA 5KFNA 4ELTA 1SH0A 2VFRA 3UD4P 4BCAA 2E44A 1PSDA 2GJ2A 2AYEA 4IOCQ 2OPQB 4ZVHA 3D0GE 4QWAA 1R31A 2IHR1 2V8HA 5B0GA 3N5FA 4TLQA 4F67A 3M32A 4ZKAA 2F7VA 2DHSA 4OI0A 1JLBA 4DEZA 5L9NA 5LT5A 2N7CA 2V4QA 4URGA 5EWEA 3QWUA 1XTZA 4GO7X 3BSNA 3GV8B 5KT4A 1K8AT 3D1HA 3K5MA 3HDSA 2B4VA 1IQZA 5EWFA 1ZTTA 2VBZA 1N5VA 1HNVA 1VS3A 2IYGA 4EWTA 3J7ZT 2DNLA 3M8PB 1SJ1A 2CPJA 3HHDA 3OXGA 2HNYB 2CJKA 4BC7A 1NJXA 3K7RA 1N33F 2VFVA 5AXKA 2CPZA 2ZJPQ 1C1CB 1SJRA 4TN2A 1VIOA 4ELVA 1S1UA 2VBWA 3OXLA 4KHMA 4MK8A 2M9KA 2OPRA 4DSFA 2W7AA 4C11A 2RS2A 1HQUB 1SKSA 4WE1A 4C3KA 4F26A 3CJ3A 3MR6A 3SDEA 4V194 3GYNA 4ECRA 1G7CB 1QAXA 4QIGA 3MECB 3UQSA 3NWGA 1A6LA 4OHYA 2XSJB 1V9OA 1KN6A 3PO4A 3I4HX 1FNMA 2J7WA 3PFOA 5C5JA 3CCJS 2ALZA 1WEYA 3U1LA 2IRUA 3RB3A 3TQ1A 3DLLQ 4RLEA 1XMQF 4E0DA 4C9DA 2Y1RI 5HQ8A 2E5JA 4WKRA 3TX8A 4JYZA 1U1LA 2P9GA 4X4RA 1FCAA 2E9TA 4K5SA 2XZWA 2M52A 3MR5A 1W25A 1VOMA 3TAQA 4I1TA 4HYKA 5IM0A 4WK3A 1KLNA 2DO0A 3OTCA 4JI8F 4Y0FA 2DNRA 2RNEA 4QWDA 2KXHA 2BQUA 1XK8A 1RTJB 4C8MA 2QA4G 5DDPC 5A0YB 5IZHA 5JVHS 1MROA 4YUDA 2FJBB 3LH2S 4K59A 1AW0A 3IXQA 4NLDA 4HTJA 4F3MA 1GH8A 4BDPA 2R4FA 4RW7A 1HHTP 2RQMA 4PXDA 4HT7A 3DI6A 4DFMA 3ISZA 5KFDA 2AX1A 1DLOB 2QV6A 4H4OB 4I6YA 3H5UA 5KFWA 3I6PA 4NLVA 5DJBA 2MB0B 2UZAA 3IRWP 2XHWA 4KBIA 4LVOP 1KHVA 2BZ2A 3VWSA 3NLCA 1T03A 1P9QC 4OLOA 5KG5A 1X4HA 2UXCF 3MMBB 5L8RC 4B3MF 2DGOA 2R8GA 2MDAA 2J0SD 1TL1A 3LWMA