3W2VB

Crystal structure of the cmr2dhd-cmr3 subcomplex bound to 3'-amp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
322
structure length
281
Chain Sequence
b'MIEVTFTPYDIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRITVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cmr subunit Cmr2
publication title Crystal Structure of the Cmr2-Cmr3 Subcomplex in the CRISPR-Cas RNA Silencing Effector Complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Immune system
total genus 61
structure length 281
sequence length 322
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3w2vB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3w2vB03
3X1LB 4H4KA 3W2WB 3W2VB
chains in the Genus database with same CATH superfamily
2XYHB 3GFXA 4N5SA 2KU7A 2HS4A 1EZZB 5HN0A 5RUBA 3GIJA 3I96A 2F8HA 2DNHA 2OD4A 5I42B 2N3OA 4EEYA 1HW8A 4DL5A 1VHYA 5DZ7A 3NAIA 3DN9A 3AA9A 2V4JB 2YWFA 2M2BA 4NLGA 3MEEA 4HEA9 2ADCA 4NI2B 4DV5J 1HBUA 4JB8B 1IXKA 4OZLA 2C2NA 2ZKUA 3MM5B 4OZ3A 1S1WB 2UXCF 3EPIA 4KGKA 3CJQA 3EGVA 1RTJB 4I6AA 1WI8A 1GK8A 4ATNA 3UFCX 3G96A 3I87A 5L8RC 4OQJA 1PBAA 3BKFA 4E98A 1FCAA 2JEGA 1QAIA 4FYXB 3PJWA 3HSJA 1WSRA 2U2FA 2W2OP 1RT4A 1RT3B 2Y8WA 2FYXA 1VQ5S 3L4BC 1WACA 3OL7A 2GS8A 3UPFA 5KFDA 4G3IA 1CJTB 5L1KA 1T9YA 2R7SA 4TYBA 2RVJA 4ZPTR 3L7PA 3ISNC 1NEEA 2GA7A 5HQMA 3NNHA 2HVDA 1IR0A 5ETRA 3V4MA 4X84A 4C8NA 2XMMA 2EFQA 2GW8A 1YRTA 4DX8H 3IS9A 1X0PA 4ZITA 1JLAA 1NHVA 3HD1A 4OL8A 3DRSB 4TY8A 2R3VA 3QBCA 3LWLA 3V81B 1RBLA 1S9EB 2BJ3A 4ZHRB 1NYLA 2D69A 4KHRA 2L9NA 2XB2D 4IFVB 2WONB 4LF8J 5KFHA 1ZS6A 4DV1J 3HVRA 2M3DA 1ZAWA 1ZM4A 2GMLA 4ER8A 3MM9A 2W4DA 3W1YC 2CQ3A 2H9ZA 5L1LA 3SCIE 5E3PA 3GWCA 3AQOA 2L08A 3TUJC 2YQ1A 1GXUA 1RGVA 2X1GA 2BQUA 2GMHA 2IC3B 5DM7S 3HVWA 3ENWA 1LOUA 2Q79A 4ZIVA 4TQRA 1SL0A 3FFIB 1UWAA 3GV8B 4OX6A 5AE3A 1DURA 4DS5A 2RJZA 2D3OR 3OFGA 2MZ1A 1V3SA 4DR7F 2JJ4D 1L3KA 2QLJB 4YR0A 3L3CA 3CCMS 4IYQA 2W7AA 2JVRA 1UPPA 1EKSA 4K4ZA 1S1UB 4ZDNA 4B9UA 3W9JA 2MQMA 2Q6BA 4KRWA 2FDNA 1RTDB 3H5XA 4RZRA 1S1TB 4B9VA 3EDQB 1X5SA 4F04B 1WG5A 5E7OB 4CRJA 2NWAA 1KD1T 2RMLA 2AZ3A 3WZ0A 3NGRA 5LT5A 5IT9Y 4RNMA 2M5YA 5KFOA 1P9QC 5T14A 3U27A 4L69A 4NLVA 4EU0A 4KKOA 2AIRB 1B3TA 1AUSL 2ZFHA 2DJWA 2UV8G 2Z58B 2ASJA 4JI4J 2V94A 1R7IA 3SCKE 2QTWA 2VFSA 1XMQF 2KYXA 2YQ0A 4H4OB 4Y2KA 2F5GA 4X62F 4ED0A 3RGIA 3KLFB 1UVNA 2BRLA 3BF4A 3P8BB 2V34A 4HACB 4RW7A 1HD0A 3TYTA 5DGBA 2NPFA 2RRAA 4Q5VA 1QRUA 3IR7B 1DQAA 2HZ7A 2KFZA 3KXDA 2I9SA 2FIUA 3PKYA 1BWVA 2BE2A 3MM8B 4LFAJ 3FK4A 1U49A 4WU2A 2PMWA 2IM2A 3TZWA 2EK6A 5K20B 4DL6A 4U67S 2RUSA 2OFHX 1TUWA 1FO1A 4X4SA 2CPJA 4LF1A 2HVIA 4YQWA 2MSTA 4TU9A 3SCLE 4V19X 2YNHB 3OL8A 2OPSB 3ULHA 1VRQC 1X5PA 4DV2F 1K1SA 1H7XA 3DLHA 3RW7A 2W4PA 4G1QA 4OLPA 3W2VA 5D0HA 2K7KA 1WC3A 2BZ2A 1N36F 4URGA 4IFYA 1HHTP 3SCJE 3CCQS 1LEOA 3NRBA 3KK1B 4UOGA 3H20A 3GFHA 4Y2IA 3F56A 4YOEA 2UUAJ 3T6BA 4XDCA 2E44A 4WFBQ 2RKIB 2NCKL 1KHVA 1JKHB 3IP0A 2ZH1A 3W2WA 2AQ4A 1IKYA 1KOOA 2FHJD 3EGWB 4F4AA 2E1MC 3C66A 2QV6A 1D3WA 3UR0A 3D2WA 4WP8A 3ETMA 4NLXA 3C2PA 2NUUG 1NDLA 3U7JA 1NZAA 4ZVSB 4IRCA 3AA8A 2LP4A 4C11B 4RUCA 1U1QA 4DUZJ 3I5AA 2B9WA 1LWCA 3M8QB 1GMWA 2Y9HA 2G13A 4N47A 4KTQA 1M5SA 2EFVA 5D0EA 4K4VA 4NLDA 2VFVA 1S5ZA 1VFJA 4LREA 2JHEA 4P2BA 3JQJA 1T11A 3ILIA 4IOCQ 3QT6A 4M5HA 2FY8A 2VFTA 1UWBB 3L7OA 5JVGS 4ECZA 4XAKA 3AHPA 3D66A 4FKYA 2WRMA 1RTIA 3TAPA 3IS9B 1FWLA 1KFDA 1EUQA 2IJRA 3IR6B 1FESA 4IG3A 4DQQA 2RE1A 2JLGA 3H5SA 3GYXB 1RAHB 4LQ3A 2FGCA 2KHCA 3M6WA 1T9UA 4DQSA 2AWZA 4R5PB 2FZCB 1KONA 4CM0A 4DV4J 1RWMB 3ITHA 5GAGU 1B4SA 5FDLB 4DL0C 3UVJA 5A2QU 2JSXA 2W9BA 2GVZB 1BE4A 2BANB 3T5LA 1Z85A 5THWA 1LWXA 2DHHA 1HQUA 1ZM9A 4BC9A 3DRYA 3G6VA 2H4YB 3D1OA 1WSVA 4DV7J 3EUNA 4L3KA 3O44A 4J37A 2ZDOA 3JQMA 3RAXA 2UUCF 4FDFA 1FX4A 2MDAA 3FVYA 4RW8A 1WNEA 2HHSA 1K47A 2RB7A 4KFBA 2YNGA 2H54B 2OMOA 2BR0A 3VAKA 4CLFA 1IQTA 3QIPA 2UP1A 1QUPA 2ZVSA 2FUG9 2HHHF 1HI1A 2JOQA 3BB5A 5B7WA 1JWWA 1CPZA 3I4HX 4ZN1A 3NL0A 3KJVA 3MPYA 3CB4A 1Y3KA 2Z8QA 3TJ9A 4USUA 1W25A 4F0KA 1HL6A 4OHXA 2GAEA 1IKWA 4LVNP 2HFUA 1TKXA 3P4UB 3PYEA 3ZTSA 4NXMF 3MCMA 2CPXA 3OFHA 3M30A 4RNOA 1TV6B 3TR5A 3OBIA 5CYQA 2V6AA 5HROB 5BXIA 2CFXA 1SJFA 5EGYA 2QEXS 2Z30B 2G0IA 2JWNA 5KFEA 3AAWB 2FB0A 3WDOA 1SI9A 3R5BA 5C25A 5E3CA 1H6KX 3PX6A 1TR0A 1FKOA 2ZC4A 1XR7A 2OPPA 3EXCX 4IR1A 1TL4A 1HLWA 5DQIA 2HNYA 2ROEA 2HIQA 3K2YA 2YH0A 4JI0J 3CJRA 4ANCA 5I4MA 2Y3YA 1YJVA 5A76A 4ED5A 4DF8A 2DH8A 5IC4B 1HWIA 2UXBF 5LMNF 4LF4F 4DR6J 1X4FA 3HP6A 4LF6J 1YIJS 4I6YA 2VC1A 2MTLA 3HDSA 2R9LA 2DNMA 4U95A 2EXUA 3QJLA 2VPWB 3I0SB 4DCPB 3CMAS 3B8HA 2CNKB 1HR0J 1SXLA 2QRRA 4CP5A 1K0VA 4Z7CA 3DOMB 2XY6A 3EICA 2CG8A 4O3RA 2HBYB 2DGXA 1N54B 5HQLA 3PX4A 4ECSA 3DM2A 3ET6A 3HKZD 3OFEA 3NXZA 2HYIB 5ETNA 4IG0A 2VIHA 1C0UA 3BDEA 2B6AB 4QYRA 3K5LA 5DJBA 3LGHA 1H3DA 1M0SA 4KGVB 5CYMA 2IIHA 4DR2J 2DNNA 4IFYB 5C7PA 2DBBA 1LXJA 1SIZA 2FJEB 3J81U 2FVCA 5EWFA 3A1YG 4NZ6A 5HP1A 1C4CA 3T9NA 2EFOA 4MTPA 5KG1A 1S97A 3SSQA 2B8PA 4CZCA 3TUZC 2D1CA 1IKYB 3HK2A 4P2SA 1SKWA 1G2EA 3NMRA 1BXNA 1Q4RA 2XLJA 4IOBA 3ENQA 4WK1A 4WK3A 3G6ES 3PYDA 5B0AA 4GVBA 3KOAA 2FLNA 4YB1P 5HK4A 1IKVB 1IM6A 2QO3A 5GADI 3B54A 1S1VA 4HT5A 5HVGA 2HHUA 2YKOA 1T03B 5KFZA 1PYTA 4DCOB 1NK0A 1T05A 1SV5B 4KHMA 2ZJQS 1NZ8A 3W60A 4JI1J 4CT8A 2O66A 1Z2ZA 3AXMA 5DM7Q 5KFLA 3RBXA 1VQSA 5A8KA 3Q8QB 3DLGA 2HHWA 5L9XA 2R8JA 4UW2A 5J2NA 4KB7A 2JH3A 2B9YA 2IRXA 4A47A 2R7RA 4RNNA 4LSNA 4O4RA 3DHXA 1RBAA 4USVA 2DR8A 1TFWA 1TKDA 3JTNA 4ZLPA 4IG3B 4Y28C 4Q45A 2HVHA 1B7YB 4TU7A 1C1CA 4USWA 3HM9A 5DDQC 5KT4A 4OIXA 2V4QA 4MYTA 1UZHA 4O4GB 3MCOA 4WKRA 1X4EA 3V4IB 5KFAA 3ZTQA 3H25A 2L3MA 1HARA 3W63A 3PR4A 3GMGA 2VBYA 1HNZF 3M2VA 2D3ZA 3EJMA 2E9ZA 1CSJA 2MKYA 5KT7A 3GYGA 4DV0F 5DM6Q 2V4RA 4PPZA 4D3GA 3CJKA 1KVJA 1U0SA 3J7A1 4J9NA 2EFGA 2VBZA 4PYDA 3IM8A 3L9ZA 4RW8B 1F9EB 2XMWA 2K8GA 4KFBB 1C0TA 1CC7A 4O3SA 2YNGB 5ETSA 1FE0A 4OZ5A 2HVZA 3FZ2A 3PW5A 4OYAA 3BYPA 4JYZA 1V3RA 5J1EA 2PT0A 1DTQA 3O6QA 2DO4A 4C8OA 3KJVB 1KHWA 4PABA 1O8BA 1GXTA 2DGWA 2P8IA 1TKXB 2VQFJ 4WFYA 1NH8A 4C48A 3M30B 4DXLA 3FQKA 3F41A 1NK4A 1RT7B 2QL5B 4ZCMA 1KC8T 2XBPA 4U67Q 3NKYA 3SDEA 2ZVIA 1JLCA 4XIUA 4H4KC 4X2BA 4NCBA 2G1HA 1NKEA 4ETZA 1ZZFA 4HTIA 3MZIA 1N5QA 2A0FB 4DZ6A 2VONA 2B9EA 1APSA 5IV3A 2RQCA 3UCUP 4ZVOB 1YJRA 2BMBA 1UPMB 2W2MP 3PW7A 1OIAA 3JYTB 4R25A 5DETA 1TFYA 2DNLA 4DU8A 1L3SA 5DS7A 3I0RA 3D1QA 2XYPB 5IXUA 3GE9A 2R42A 2VFUA 4DV5F 5AT1B 4ZVQB 3Q8RB 1VIXA 1OWXA 1D6KA 3FSIA 2VB6A 3HHLD 5FD1A 3TO8A 2YX1A 1RT6A 1S9FA 2MKIA 2V8GA 3KK3A 5CZXA 3L7UA 1QTQA 3GSIA 3VAHA 2JC1A 2YTCA 4NZ7A 3CDBA 2NSBA 2AGQA 1XMBA 4I2PA 4CQ1A 1IM4A 4F3MA 1N5YA 2IM0A 4CO1A 1UEKA 2ZITA 4PG6A 1JXVA 2AP6A 5IT9U 3CCTA 3THTA 4ID8A 3R6LB 2LDIA 5HP1B 1FXRA 3MD1A 3CT9A 5F0WA 5K14B 3DLEA 4H54A 3LGMA 3QGIA 4LFBJ 2FJBB 3IGNA 3TX0A 2IAJA 3DOLA 5JVGQ 3NS5A 1JB0C 1NH7A 3CC7S 2IM3A 4JXZA 1RT1B 2EC2A 3OTOJ 1Q8KA 4AFFA 2UU9J 2CZVC 2DCLA 1RDRA 1U1PA 3TZXA 2OPQA 3POTA 1RCXB 2FLLA 1J5OB 4D3HA 3M4XA 2LXFA 4MIWA 4TQSA 2QZ8A 1NSAA 4LF8F 2Z2ZA 5MLCV 3N5BA 4FKXA 4DV1F 1YJNS 4L72B 4MKYA 3D0HE 3VZIA 2XYGB 3BGLA 4Y00A 2R2TA 2HK3A 2ZZNA 4P10A 2BW2A 2IA6A 3DLGB 4WBFA 2ZWPA 3ZNJ1 5ETLA 3C6UB 1JK9B 1FEUA 4L75A 3QAEA 4IH6A 3ENAA 1S0MA 2ZNYA 2X1AA 3MR6A 3EPGA 2AF6A 3NGTA 4ZVUB 2XO6A 2HPUA 5HATA 2E1PA 2Y0BB 4IO9S 4FXDA 1MSWD 1PJ7A 3N6NA 1URNA 5MAOA 4MFBB 2HKEA 2CPIA 1V6HA 1ZOTA 1V6ZA 2P9EA 3BSAA 1RUSA 4FS1A 3BGFA 2KZZA 3DXBA 1NJWA 1WD6A 5HL7S 1MWZA 2OKQA 2GQ2A 3O1LA 4DU7A 3QT5A 3KJFB 5KFUA 3W5XA 3EZ5A 3IM9A 4F3QA 3CJKB 3MUVP 4MH8A 2VG6A 2OELA 3AOCA 2KT5A 1WDTA 2HHXA 1FTRA 4LBHA 3DC2A 1REVA 4DR5F 3D1HA 1HQ2A 4GC6A 4K4WA 1NNDA 4WE1A 2EFPA 1Q78A 4M5KA 4QOTA 1IUJA 4O0NA 1T8EA 4ZJLA 3PO5A 2B8QA 2LECA 1D8ZA 4GKKJ 1LW2A 2PICA 1JLFB 4ES1A 4OFZA 2XULA 1VLOA 1UZDA 4F7VA 1H2UX 2LCWA 1Q0NA 3P5TL 3GIKA 1RWWB 4FYWB 4WWSA 4LFAF 2PC6A 2I5JA 1YITS 1BQMB 1F6TA 1SBRA 3AIIA 3VCDA 5J2PB 2V9WA 5HJYA 1JLGA 4DF4A 1YKWA 1HFEL 4K5RA 2X3GA 3LP2A 2V9KA 2LQ9A 1UDXA 2QMUB 4FPIA 2MKHA 4CLUA 4I0WA 1WORA 4ZJOA 4V194 4LSLA 3S7RA 2E7WA 3UE2A 3HKWA 5CABA 1WHVA 1JJCB 1Y4ZB 1RWOB 4WYLA 1ZZNA 2DGQA 1KQFB 3PIPS 4AUKA 1VQPS 1JIHA 3Q0AA 2J9EA 1WTBA 4HHJA 3JB9k 3KUGA 4CI0B 2VU5A 3QATA 2UUAF 1M5HA 2HMIB 3I31A 4MKAA 4ES2A 1RT6B 1KQSR 2VZ9A 2MYFA 4QWBA 4K8RA 1H2TZ 1ZYQA 1BQNB 2MZJA 2EVZA 1RYRA 3OHAA 1FRLA 2N82B 4I2PB 3FC9A 4NYZA 3D67A 2G0CA 3JSRA 4K50A 1HMVA 2BXJA 2WSFC 4DUZF 1HA1A 3MMCB 2CZ9A 1GX6A 5EHHA 2CJBA 2OPRA 1B70B 3N79A 1CJKA 2VC0A 4DV6J 3MWBA 1K0TA 1XWLA 1HW9A 2W9CA 5F8NA 4KV8B 3DOLB 1PIEA 1Z2LA 1X9MA 2CQHA 1N33J 1QTNB 3J81j 2KG0A 4DUTA 4HL9A 4QPTA 4C0OC 2J0WA 5CD4H 2F40A 3WX4A 5GADU 1S10A 1NSQA 3WIUA 2AHOB 3KDNA 1XEZA 4NCGB 1NK8A 4ETXA 3R3TA 5JUMA 1IJEB 3R9LA 1KLMB 2CIMA 4DV4F 2PIIA 3H59A 1ROFA 3FNNA 2CKWA 1Q5YA 5LXYA 2ZM6J 1X5OA 1PO6A 5ETQA 5KG6A 4CTAA 4O44A 4ZPWR 3SQGB 3DMJB 3PKMA 4FXVA 4JI5J 4L6V3 1NJZA 2MHNA 4DV7F 2QMXA 1WEZA 4ILRA 1I51B 4PXEA 1ZAXA 3G82A 4NLWA 3W7BA 1LXNA 1G1XA 1TELA 2XO7A 5JVHQ 1Y9OA 3Q2SC 1UJ4A 5DRKA 4ZP7A 3MMBA 3HFZB 3M2RB 3QJPA 2M4MA 2ERRA 1CLFA 1N4LA 4E0DA 3FCHA 3KHGA 4FN5A 1SQGA 2GCFA 4DSIA 5I3UA 4ED2A 4KHPJ 2HLTA 2AKWB 3MM6A 2G2OA 3DRXA 4DPOA 4ZP8A 4XTTA 1VISA 4TKTA 4J9KA 1VC5A 3VGSA 2OGUA 2KM8C 5KG3A 3PTWA 3R7SB 2VG6B 4CLSA 3CCRS 2H65B 1FXDA 3FZBA 2X51A 1GMUA 4WFAS 2ZH2A 3CPWR 4M5JA 3UO0A 4OI1A 4M5MA 2IVMA 2QLBB 1REVB 3G9CA 4HR2A 2BDPA 1N6QB 2Y1RI 2W01A 4LF5J 2HBRB 1IR2A 2CPHA 4CO5A 4P6QA 1FNXH 4F4KA 3RZAA 4JI0F 4DSKA 1UFLA 1KVIA 3F44A 5HMYA 4OI3A 4TLQA 2FJAB 1S1XA 1TL7A 1ZTWA 1UVIA 4FVMA 4LRAA 5E0OA 3M6VA 4KGXB 5A8RA 3MF5A 4LF6F 1YZ6A 5CD4A 3JTOA 2ATCB 2GC8A 4TU8A 2IDEA 2ZBIA 5AE1A 1HR0F 2VBXA 5KG5A 1VGYA 2DHGA 2UUWA 4K4YA 1X9WA 4YEAA 5M2UA 2NLWA 1JLGB 2BJ1A 3VWSA 2COLA 2LEPA 1J27A 3C19A 1AFIA 4USJC 4I4BA 3HSGA 5DDPC 2XWYA 3PHTA 4NYOA 3Q8UA 2FHOB 1P27B 5IZNA 3AD7C 3OW2R 4HHUA 2RRBA 1JLBB 3CEDA 4DR2F 3UD4P 5C24B 6FDRA 1DHMA 1E6YA 1S72S 3OL6A 4DQIA 4J9LA 5BYSA 3DU6A 3BR8A 7FDRA 1TK5A 1KFSA 3OR2B 2FVQA 4BCAA 3NCPA 4WP9A 1RJJA 2MKJA 2RH3A 2FC9A 4V19J 4OHVA 3M9OB 1CQMA 3QSIA 2ZBCA 4GKJJ 3KLIA 2B4UA 1TVRB 1CJVA 4P9SA 3M6XA 2Z2MA 2RD5C 4DX6A 3PDNA 3P45B 3KLEA 4J9PA 1F9FA 2YKQA 3UDEA 3A8IA 3WC0A 3MHYA 1YI2S 1XR6A 2YNFA 4LR9A 2XLIA 1QAJA 5K5MA 2G5DA 1CJKB 2M0GB 1K44A 2HK2A 3BH6B 2P9CA 3MECA 1SKUB 3KNGA 6FD1A 4DL7A 1RHJB 4JI1F 1X4AA 4ED6A 3CMES 5CCMA 3MI7X 4YDDB 1NK7A 2AMCB 1SJ4P 5CXTA 2RHSB 7FD1A 1DRZA 4B3RJ 1HNIA 1LWFA 4CYUB 4FF3A 1Q1KA 4IO9Q 4J91A 2ZH3A 3BSNA 2UZAA 1CVJA 2HNZB 4OZ0A 3OR1A 1IBLJ 4MK8A 4ELUA 1YG0A 3DRRA 4OI4A 1QE1A 1X4GA 5J2QB 4Q2LA 4DQRA 4IQXA 3LO3A 1NAQA 1ZPWX 5HL7Q 2R7OA 3D68A 3LANA 2BQ3A 8RUCA 5EX0A 3OTCA 1LQ9A 4PXBA 3N4WA 4CTAB 4A8OA 2ZUGA 3SSSA 2QN6B 4DJBA 2E29A 2B51A 1I1GA 1RXOB 1VRUA 2BKNA 1PGZA 1J5EF 2YKNB 4ECWA 1FRHA 1HPZA 5LXRA 4JYAJ 3DRPA 3HHDA 2WB4A 1D9DA 4KO0A 4HHHA 1KSPA 4C98A 2KTQA 3MMBB 1SCJB 3BZQA 3BS9A 3TZYA 4WJBA 5DLFA 4JV0A 3TQ1A 5I3UB 1D8YA 2DB1A 2KKHA 2QJ3A 1M5OC 4DV2J 3Q2TC 2J0QD 4F26A 2NYHA 2XMUA 1YX2A 1HNWJ 2OP5A 1DAXA 3E3XA 3DLKB 2DNOA 1HBNB 4ZVFA 1LW0A 5M2PA 3T1HJ 4URQU 3K8WA 1V3ZA 4G65A 3M9MB 4H3SA 4EBDA 1I3OB 1AW0A 4KBIA 2B5JA 3K5OA 2EKNA 1WDDA 3HJVA 1R0BG 3IBWA 1S6PA 2FGOA 3NWGA 4I2QB 3V2UC 2B3TB 1AFJA 4FNHA 4N41A 3ISZA 3PIPQ 4M5GA 2VV5A 1FK9A 3GFZA 1S1XB 1U1OA 3MFHA 1SJQA 3C16A 4QYZJ 3HXMA 3HSZA 3EGNA 4PG5A 2XSJB 1HBMA 2J6TA 1WOOA 4ECQA 5DGAA 1U48A 1GTSA 1TKZA 1YLXA 3OPKA 2R7VA 4OI2A 2PEHA 1NXIA 2VOOA 1AB8A 4FP9A 3KK2B 2E1AA 4V1Ak 1HI0P 1IBMJ 4BLGA 2KJVA 4QYZK 1NHKL 1RB0A 3JSYA 5IM0B 4ZJQA 4LRDA 1BC6A 3UD5A 3VGUA 1MROA 1N5VA 2OUGA 1QRTA 1S9GA 3WBZA 3BN7A 3VGVA 3D7SB 1D9AA 2B7BB 2HSEB 1ZM2A 2XEXA 1B99A 1X8DA 1T0TV 4LIWA 2VL1A 3KTQA 1EJ7L 3K57A 5DG8A 4K7QA 4ZIWA 1R43A 3IG1A 1FRMA 1U8WA 3RUBL 5CQGA 1WHWA 1FVSA 1Q8LA 4LFBF 1IN0A 2BJEA 2AU0A 4DLGA 5HMWA 3MPWA 1N32J 1NB2A 4OYBA 3OTOF 2BQRA 3MFIA 4B3OB 3SFUA 2UU9F 1JX4A 3JSMA 1RAEB 3IWXA 1XIQA 1NRKA 3CJ3A 4PXDA 3KLEB 1FA0A 3EX7B 4QJVA 3VAJA 3WHIA 3DDIA 1GMWD 4AYBD 5E5NA 4WU3A 3MOJB 4UZCA 1WHYA 3CWJA 1QSSA 3H2VE 2YNFB 4OZ1A 2KRRA 3UDVA 1W2BR 3SBMA 4NA1A 2FVPA 4HLBA 5HLFB 3MECB 3LW5C 4WZMA 3QMQA 4X66J 3IMQJ 3D0GE 4DL3A 1RKIA 2DEJA 1VRTB 1OQ3A 4RBVA 3LH2S 1D1UA 3HZGA 2XMJA 4K0KJ 1SB6A 1P6TA 1DBDA 2FQQB 3HSDA 2EGWA 1LWFB 1HQEA 3OFFA 3FDSA 4DL2A 2ASDA 2Q3PA 1Z4UA 4LMZA 4Y34A 4P52A 2J0SD 5IQ6A 2ILYA 1AYEA 1R8PA 4Y3CA 2QFJA 1RA6A 3MPVA 1R27B 5CHCB 4Y2CA 2ZZMA 1EXDA 2WOMA 2QMWA 2RF2A 4K4UA 1XBWA 3KDOA 2UV8A 2HHVA 4KGZB 4JI3F 2EG2A 1PJ6A 4NWBA 4FBTA 1YGYA 1QAXA 1RTZA 3VZHA 4EWTA 4ECUA 2D9PA 2YPZA 2UXBJ 4NEZA 4NXNJ 3SZ2A 3MXHP 4CO2A 5HSPA 3H98A 1VJWA 1WWHA 1FRXA 4OZ2A 4N7TA 1FD2A 1HWJA 3RRKA 2BJ8A 4DLEA 1RT2A 4PG7A 1E6VA 2HRYA 1S0OA 2XMKA 3A13A 3TP2A 1WC4A 2E5GA 5A2QY 3OD2A 3HF5A 1K73T 1VBKA 3BV8A 3HHLB 4GKKF 2CQBA 2KO1A 3CC4S 2G2YA 4LRCA 3RBDA 3K58A 4XDDA 2R7XA 4IR9A 4ICLA 5T7LA 3FSXA 3QZ8A 1WG4A 3SMZA 1XTZA 3GR1A 4PXCA 3TW0A 5IV4A 4NLUA 2KT2A 1NB7A 4S0MA 1Q7YT 2FVSA 2BM1A 3PFEA 1YBUA 1Y5NB 3UCGA 3GR0A 3MEGA 2DY9A 4X4TA 4IOAS 1RTHB 3BSCA 1S6PB 4EK2A 5DLGA 4RW4A 1UEVA 2CPEA 1DTTA 4IO1A 1N8RT 2ZJRS 1FK9B 2PA8D 2M9KA 4NLYA 2ZZTA 2P2CB 4E8UA 4DWIA 1IJFB 1HBMB 2C2DA 4W98A 4PZVA 1X9SA 1C4AA 1ZETA 2CJAA 3NBPA 2CNOB 1HI8A 1PJ5A 5GAEW 1TKZB 4ECRA 1XERA 3D54A 1VQ8S 3G8TA 2AW0A 1TK0A 1ICEB 3E01B 1UA1A 3BPSP 1U1MA 3IBCB 1KRPA 4M5DA 1N56A 5L9NA 3IR5B 5GAHW 1O0BA 4QIEA 3HULA 3DLLQ 3GCXP 2ILZA 4IRDA 2MY8A 2MB0B 4C6AA 3EM1A 3U1MA 1H74A 3TI0A 1S9GB 3H2LA 1KTVA 1UL3A 2ZC3A 4UZBA 1RAAB 1CBKA 2GGPA 4KPCA 2WB1D 3ZTRA 2YWEA 4IDKA 3GB0A 4YFUA 3AODA 3IG1B 4DV6F 2MPUA 2BEFA 5C2CA 4R0JA 3JTPA 3G4SS 1HNZJ 1VQLS 4ALZA 2MGZB 1R31A 1B7FA 1I6JA 1YWXA 2F4FA 4B9MA 5K8OA 3K5MA 1N34J 2GVDB 4ECXA 2WVDA 4F4YA 3TWZA 3JSMB 2MHEA 5B0FA 2GJ2A 2DXDA 1FWPA 1RT5A 2J5AA 2CVIA 4IH5A 3Q22A 4W4MA 4HDHA 3MR3A 3UN3A 4N8NA 2OFGX 3I5CA 1S12A 2ZE2A 2EGVA 4Q2MA 4ZPBA 1NDCA 3FCWA 1ZBTA 3TOQA 2ZM6F 4K4SA 1N88A 4CCHA 2PN6A 2PEBA 1FTCA 2WSCC 4RUBA 4JI5F 2AEMA 4J9UE 2KL8A 3J7Z5 3SSRA 4CH0S 4RLEA 1WF1A 2KT3A 3GJTB 2CQ2A 3GQCA 1H7WA 5DQGA 3M2UA 4B3SF 1PG5B 3UQSA 2RD2A 3PACA 3KG4A 4K5SA 3W66A 2KDOA 1WEXA 2GMJA 1SQFA 3H4DA 3BN4A 4KHPF 1VC6A 3KWMA 4QW8A 4Q8FA 2RILA 2PO4A 5KT6A 4XK8C 4GVLA 2MKCA 1CULA 1QDUB 2P9GA 5HBMA 4A8WA 1HNVB 1KQGB 2UUBJ 3CF5S 4DFPA 4LR7A 2H1YA 5A0YA 1MMLA 2YWKA 4OJ1A 1KDNA 3OSNA 1F2GA 1F2HA 4Q0BB 5KFFA 1F9HA 3KYLA 1FKPB 3V6KA 2F8EX 1F5AA 2HS3A 2CQ0A 5GMDA 3T5JA 1RT2B 1E6VB 4LF5F 3NAHA 1SC4B 4AL6A 2DCUB 3HT3A 2DGSA 4FNIA 2HHQA 3M32B 1I5OB 5C42B 4UQGA 4A8SA 1SKSA 5T41A 3PEJA 3IRWP 2C3OA 1U1LA 4ZP9A 1U6ZA 3H90A 4KPYA 2ZNZA 4C8ZA 1I94J 3D6MB 3IBFB 1P1TA 1RZMA 3T3FA 1LFPA 2GJFA 1S6QA 1GTHA 1RAOA 2ZOMA 4NMLA 1JLQA 2K1RB 1C1BB 3CCVS 2ZBQA 1DQ8A 1TU0B 2V2QA 4QR2A 4ZVHA 4X4PA 2I6WA 3RB6A 1HHQA 3FMWA 2WAQD 4N76A 3VVUA 2C2OB 3DYAA 1NSPA 2VODA 3IRXB 2Y8YA 3LP0A 1DTTB 1UP1A 4FS2A 1EARA 1IWAA 3QGHA 4NOHA 3GTYX 2I2YA 4F25A 1DQ9A 2AJFE 4C3LA 1S99A 4CNYA 2FJVA 4U8VA 3I32A 2M8DB 2O5DA 5E3AA 3PR5B 1O0CA 3QIDA 3PEHA 1V5VA 2WZ1A 4O3NA 2OO4A 3U1LA 1W26A 1MU2B 5KFNA 2DT9A 1P1LA 2NYIA 2H48B 1FRJA 3T1AA 1YTYA 5KOXA 4EI2A 3V6HA 2RNEA 1LWEA 4H4MA 5BR8J 4GKJF 4M5DB 3P3DA 3PIOS 3T5HA 5KAKA 1KWMA 4J9SA 1R0AB 1TL1A 2RS8A 3LF0A 1SH2A 4K4TA 1IKXA 5G4DA 1RAFB 1EKRA 2XS5A 1ACMB 3QO9A 1WC5A 3TRGA 3J7ZV 4A46A 2HLUA 1ELOA 4R0EA 2CJ9A 4AXJA 4QR0A 2BRKA 3BPDA 1BY9A 2R7WA 2XHCA 2WSEC 4WKYA 3ILOA 3M9NB 2V8HA 4R8UB 1HBOB 4B3RF 4DX7A 3J80Y 3GCWP 3C3LA 3DI6A 1U02A 3CD0A 2DRBA 1FJCA 1L3VA 1V9OA 1R8CA 4UOHA 1VK3A 4DR5J 4PWUA 1IBLF 1YBAA 4KSEB 5G0RB 4YS2A 5EUHA 4MK7A 3CCLS 4F0HA 3M1VA 3GJRB 4F3OA 1EP4A 1Y5LB 2KXFA 4DN9A 4LFCJ 2E5IA 1HYSB 4YY3J 3C46A 3L09A 3UN2A 1RU1A 5KFRA 1WI6A 3KLHB 5D0GA 3V6DA 1CS4A 3A12A 4N8OA 3DDNA 3OUYB 3OJSA 2QL7B 2J6UA 1YJ7A 4OYXA 1PSDA 2IPOB 2B9XA 4ZPVR 3VAMA 5D15A 3E51A 4FYDA 2FJDB 3UD3P 3Q8PB 4JYAF 1LFWA 2YX4A 3GPAA 4WFXA 3TZZA 4HTJA 2YBVA 2HRTA 3KNAA 2MLXA 2CJKA 4ZPCA 3R7NB 1VI7A 2G0JA 2DRAA 1FNOA 1WOPA 3DKDA 1GFWB 2RQMA 2A2DA 4GO7X 2VKRA 3D9BA 4FPRA 5M2RA 2AD9A 3CNQP 3CMQA 3MAQA 3BBCA 2YQ3A 1HNWF 4LRFA 1XNQJ 2I38A 3D4JA 3MEEB 2BE7D 1RKJA 1OSCA 2BJ7A 1HBUB 3T1HF 2EKYA 3PW4A 1FERA 2WVBA 4IOAQ 3O3LA 1EETA 2FZGB 2GAGC 2Z0GA 5JJBA 2LU2A 4PG8A 4A8KA 2HIYA 5AJ3J 2X1BA 3G86A 3NOCA 3GJQB 2ZBRA 1NO8A 1H0HB 4ZLLA 4I7FA 4Z7YA 2QA4S 5GAEU 4LIRA 3THVA 1S6QB 2DYAA 1RT4B 5H9EJ 5ETVA 4IKAA 5AXKA 2ROGA 5KFVA 2W2QP 1RADB 2MQOA 3OTDA 4M63A 4C0BA 1R8HA 1SL1A 4U96A 4LR8A 1EAYC 3ZC4A 1IBMF 4C8MA 2DNPA 3PCOB 3RB3A 2EBGA 1UETA 4KAIA 2OI2A 2CWKA 5H9EK 2J8SA 3CDUA 4TYAA 1H38A 1N5TA 2HZVA 1W2IA 5F9NA 3OJUA 5D3GA 1S49A 2XMVA 4DMZA 3T41A 3QT8A 4EFAC 3FCVA 2ZBPA 2HFNA 5LSLA 2VA3A 2PSZA 3KLGA 5BNZA 4XPEA 2E7VA 4LSZB 4ZMMA 1JLAB 2YKAA 3BM7A 5K9FA 5ETMA 2YWWA 4TY8B 3TEHB 2OJ3A 1VCTA 3D3CJ 3FEXB 3FKBA 4DN0A 3MM7A 5KG2A 5B0GA 4LF7J 4KGMA 2RAQA 3PV8A 4ZVRB 2J9DA 3CZBA 4OMFG 5AXMA 3WC2A 4H4KA 3MM9B 4WFNS 1WF2A 2GIRA 5KFXA 1G3OA 1N32F 3TA0A 2B4VA 1LWEB 1T95A 3PYGA 4DL4A 1GQEA 2U1AA 2KJWA 1TL1B 3BR9A 3ICLA 4F4WA 1RP5A 2HQGA 1RCOB 3FRZA 3ILJA 5J2MA 3CULA 2WK4A 4DQPA 3QO9B 3W61A 2V67A 4CO4A 2V5HG 4ID5A 4KE5A 1R6VA 5ETKA 5D4LA 4CLWA 5F3TA 3PXGa 4PG4A 5IS2A 5B0BA 5A6WA 1R0CB 1JNZB 2C3YA 3AXKA 2LQJA 4X66F 2YWGA 1S7HA 5LSOA 4I64A 3CD6S 2CQ4A 4B9LA 3H4BA 4K0KF 2CPFA 3GIIA 2IYIA 2MMYA 2CXEA 2GFFA 2LVWA 4OJGA 3MR2A 2Z56B 1A0OB 1FJGJ 3IAM9 2PD1A 1X31C 2L41A 4WP3A 2P6TA 4KKOB 4FYVB 1KLNA 2EG1A 2HNDA 3M1VB 3X3UA 4X65J 5KFQA 1QTMA 1VBXA 3AJ1A 3FSYA 1F60B 2LA4A 1CS4B 4URSA 4QBUA 5BJRA 1HNXF 5ETPA 4RW7B 4NXNF 2MQLA 1CG2A 4NA3A 4BC7A 2PGCA 3MDFA 1PC5A 4NLSA 2BE2B 1TL5A 1RAGB 1UJ6A 2Y0SD 2JNJA 4WFZA 2DEIA 3H0PA 2G4BA 4KIAA 2V68A 2J76E 3PRVA 2KHDA 4BS2A 4O23A 2MQNA 3ENVA 2QFIA 1O6XA 3EE3A 1NM2A 1NUEA 2R8HA 4Y2MA 1T3NA 5F9LA 1YJ9S 3VHQA 3AOBA 2LQBA 3Q8SB 1H72C 5KFGA 4G1QB 1S76D 3W2VB 2N7YA 2LXIA 2CVEA 2LEBA 5K8PA 1JJHA 1U09A 2QG9B 4G1IA 5IT4A 1OY9A 4RW6A 2OSQA 3HD2A 2RE8A 2V50A 2VPYB 2DVIA 2IJFA 2PMZD 2UXDF 1RT3A 2B43A 4NL5A 3AD8C 3AY0A 1WKJA 4QIGA 3OXLA 2G1DA 4ZVTB 3PFOA 1CJTA 2ZD1A 3W2WB 5B08A 5HQ8A 1DARA 4OV6A 1Y3JA 3VQTA 2X3DA 3OXGA 3DCAA 4M5NA 2X1FA 3PHEA 1UFWA 1RWVB 4PAAA 1TKTA 2ZH5A 5DO2A 2AJQA 4MJKA 4JI8J 2EK1A 3ZO7A 5J1PA 1Q95G 2F9JA 1DJ0A 1X7VA 1SPBP 2XCAA 1LWCB 3DRSA 1T7PA 2JX2A 3EXYA 3W65A 2BOPA 3V81A 1XK8A 4ZHRA 4WTYA 3K5PA 1AA1B 4DFMA 1RISA 4IFVA 2MQ8A 4FYYB 3ZFVA 4X4QA 2C3MA 2OTJS 4G1PA 5GMKa 3HHLC 3R2DJ 2HEKA 1WC6A 3OXFA 3CDEA 1HWKA 4RU9A 3NS7B 1MNEA 3DHWC 5D3GB 1RTIB 1S77D 5KG0A 2IBKA 2RT3A 3M7VA 4BWMA 2F1FA 2BKPA 4F50A 2FZKB 2IC3A 2NXUA 1WKLA 5KT5A 3MM7B 2NZCA 4JI6F 2K3IA 2V8DA 4O3QA 1QAYA 4DPTA 1A9NB 3ITHB 4WXOA 3FFIA 3UVJB 5LJ5Y 3LPEA 2XGQA 3BREA 2W9BB 3FBCA 2A2CA 3EVOA 1OY8A 1FJEB 2IVYA 2P6SA 1N34F 1HQUB 1OJ4A 3OSPA 1RA7A 1RI7A 2KVIA 1WEYA 2HFOA 4A8YA 2D7SA 2JVOA 2VA2A 3P96A 5J2MB 1S1UA 2NREA 5GAGW 1J5EJ 2XM3A 3IGVA 2QIFA 3VALA 1RTDA 2D3UA 4E8BA 2L9DA 1S1TA 2DR9A 4WZQA 3QIPB 3W9IA 4PR6A 3TA1A 1NPRA 1TMMA 3T1YJ 2HFVA 3NWRA 2RIJA 4ZKAA 2CADA 2MY7A 5JMNA 1PAUB 2KN4A 2CDRB 2VBWA 4P7TA 3Q24A 1IKWB 2RDIA 1F0XA 2Z2LA 2AYMA 4JV5F 2N4CA 1B0TA 3CD5A 1FRIA 1U26A 4ECYA 3TQEA 3J7YU 2JZ5A 2V2KA 5CYQB 2POKA 2HZAA 3ADAC 2J0XA 3KMSA 3NMAA 2DNKA 1UEUA 3TNVA 4HACA 3GV7B 4TN2A 1FT8A 2NPIA 5DZ6A 5C25B 1JMTA 4ZPAA 4TNOA 1ZPVA 2OH2A 1Y10A 1UKUA 3MM8A 1FKOB 1JJ4A 4B08A 4QZVB 1WC0A 2OPPB 3P49B 3VQSA 1VS3A 2HNDB 2DNQA 4KH1B 1MW7A 2HNYB 3WX8A 2W8LA 3R5DA 4DR3J 2EW9A 1WHXA 5L38A 1XNRJ 4NLQA 3R2CJ 2GIQA 2UVWA 2UUBF 1GEHA 2F3JA 4RJVA 2YNHA 2NXEA 5D4PA 3SFGA 2OPSA 1CEZA 4X64J 4OX9J 2MEWA 4QIVA 3BDPA 3NS6A 2CQIA 2HRUA 3OVSA 2DTJA 3LAKA 4YB7A 4A8MP 1FFGB 4RL1A 2FHKA 2LQ5A 2E5LJ 1NKCA 3ZTOA 3BSOA 4ZPDA 3KK1A 1NJXA 2E5JA 1EUYA 2C2MB 3OL9A 1NPKA 1Q16B 3GLJA 4OYOA 5LSRA 4RO0A 5FIIA 3DM2B 3ET6B 2OEKA 2RKIA 2K3KA 4IG0B 1UTAA 1C0UB 1JKHA 1QJHA 3TVYA 3J80U 4NEYA 1I94F 1DLOA 3E2EA 5KFTA 1RWPB 2ZHOA 4L74A 5CYMB 2IHR1 1ZH5A 2CQ1A 2IYGA 4W90B 1KR4A 1S79A 2MLZA 2DHXA 3OHBA 5CZVA 5BYQA 5EWEA 1UA0A 4RW6B 4C11A 1NHUA 2GV1A 2DIVA 3NG8A 4PPDA 1FF2A 2QA4G 4QWDA 3M8QA 3L95X 2ZD1B 1CQNA 2B7CB 2B4PA 4B02A 2GHWA 5CAAA 2WBRA 4GC7A 4G6VB 5EX3A 2CNLB 1OPZA 2I1RA 3I5BA 2W7PA 2AGOA 1VQ4S 1FVQA 1UWBA 3BKTA 3VAGA 1TKTB 4GVBB 2R7TA 4USKA 3K89A 2H5EA 3CDAA 2CNNB 1OYDA 4I6WA 4WFNQ 1S1VB 1VQOS 1UAWA 2AGPA 2X7IA 4OI6A 4JI7F 4QWEA 4ITSA 4XO0A 5E2QA 2ZWOA 2UVRA 2BA9A 1T05B 1G4CA 1K1QA 1SC1B 4NASA 4R5PA 1NPPA 1B64A 5BR8F 3H40A 3H42A 1WKKA 5FDLA 5C2GA 5A8KB 1K8AT 3R97A 3LGNA 2ZH4A 1ZTTA 4ED8A 2GVZA 2BANA 5J2NB 3OVAA 2YX7A 1BQXA 4C8KA 2AJ4A 4LSNB 4HDGA 4NRTA 5KFIA 4O0IA 2XS2A 1H73A 3GZ7A 3Q23A 3IA0A 3EGZA 2V63A 3J7ZT 1C1CB 3IAS9 2HURA 1IR1A 4YP3A 4L76A 2UUTA 1NMEB 3DU5A 3TUPA 4PKDB 3QLHA 3MUMP 2B56A 3M2VB 2PFFB 4NLOA 4QWCA 4U8YA 1KEKA 5D0RA 4DPUA 4JI3J 1RHKB 3S8SA 1M1KT 3W8GA 1QUVA 1NK9A 2ZUAA 2GHVC 2DISA 2KG1A 3GIRA 4HT7A 4QWAA 3AB4B 4JI2J 1MN9A 4BWJA 2DPIA 1C0TB 2G9OA 1TV6A 5GVQA 2NSCA 1SIWB 4U7UD 5HROA 5DM6S 4EO6A 4Q8EA 5J1EB 4DDFA 4CLYA 3Q89A 1FHTA 1NSKL 1DTQB 3MUTP 1AUDA 1U0HA 4LFCF 4YY3F 1SKRA 1RQ0A 3QRRA 2OIHA 2PI8A 3HPOA 3MAHA 3MCNA 1X4CA 3S1TA 1AXQA 4P74A 2NXJA 1JNRB 3SDEB 1JLCB 2RHQB 3BBFA 3NEKA 4Q43A 1YK9A 2YVSA 3BQ0A 1V5IB 5KFWA 3I0SA 2HHTA 4DR4J 3ISND 2J7UA 3FUYA 2QX0A 3GJSB 3EWGA 3UWTA 1FDDA 1YZ7A 2AT1B 3DOMA 5E3QA 2H5IB 3KG1A 4PWDA 3IO1A 3US5A 2R2RA 2Q6CA 2DD8S 1Y7PA 1QSLA 1OY6A 1XMOJ 2KFNA 3KHLA 4PRFA 4DBQA 2HW3A 3I0RB 2FTRA 1XNQF 3DFEA 2B6AA 5D8HB 2YY3A 1XN9A 2O01C 5KFKA 4QQBA 2ZJPS 2B4OA 1RHQB 3Q83A 3T19A 3M6UA 5KFBA 1WOSA 1JJ2R 5CH7B 3BKUA 3KJQB 2VDHA 1PILA 2VQEJ 1Q8IA 3D28A 5ETOA 3KK3B 1VQYA 3BBBA 1VK8A 4OJ3A 2LFVA 2QT7A 4Y2AA 5AJ3F 3HO1A 4JXXA 4CDIA 2VFRA 4C7QA 5FLXU 1N0VC 4DSFA 3CCUS 1DLOB 1N5YB 3KJNB 5F8HA 2NXCA 1F5CA 3HFVA 4GRSA 4EUVA 3GG0A 2ZJQQ 4QPXA 3NP5A 2R7QA 3KHHA 1X4DA 1IKVA 3DLEB 4YR3A 4K2JA 2IAJB 1UVLA 5H1SV 3FBFA 3JSBA 1UJ5A 1T03A 2JEIA 3VR1A 3IN5A 2ROPA 1SV5A 2HVEA 2DRDA 2NR0A 3AFGA 4ANDA 3R1HA 2DXEA 3Q8YA 1XJWB 1FNMA 2ASYA 2W4CA 1KBRA 2AYBA 4OHYA 3QT7A 5HMXA 2HHPA 2OPQB 2MQPA 3POTB 4PYAA 1UVMA 4OI0A 2GJIA 2QL9B 4QIFA 2KM8B 4LF7F 3BO4A 3JAMY 2ZH7A 2FVRA 3RB0A 4OJHA 2FJXA 4O4GA 1MN7A 3CSKA 3V4IA 3R5JB 2Z4PA 2H3EB 4C8YA 4RWWA 3QAUA 2JLFA 4RW9A 3QWPA 1L3TA 1KOHA 3J7AN 5IWAJ 1F1BB 4Q7AA 1H98A 3HT0A 1QLNA 1RHUB 3BGRA 4CM2A 3C6TA 2D9OA 2WVEA 1LV5A 3N5FA 4B3SJ 2IRYA 3O8WA 2PE8A 3QZ7A 1TZ0A 2PNWA 3I56S 4J3CA 5KFJA 2R7UA 1Y11A 3PW0A 1SVDA 1N5SA 1TUGB 2WW4A 3QYYA 1ZA2B 3QLHB 3R27A 4ILLA 1RAIB 3FBBA 3OT9A 1OPIA 1FJ7A 4QW9A 3V6JA 2LEAA 4EYHB 3UN5A 5HJXA 2Q43A 1RBOB 4YB6A 4J7CA 3CJSA 1GXLA 2VOPA 1X0FA 4WF9S 2MJUA 4F36A 1URRA 1FJGF 1VJQA 1S6UA 3JXOA 2ZEJA 3ZZOA 4C2MA 3H5UA 3CDWA 1RT7A 2QYGA 4WE1B 3K59A 2YH1A 1T9TA 1YJWS 4X65F 1NU4A 4Q44A 3WIVA 4U9RA 1WELA 3HI9A 3A8JA 1LW2B 3EYZA 1U0HB 4RPFA 5KFYA 3F73A 1KP6A 5IFMA 2QSWA 3KLVA 1RAJA 4L73A 3JYTA 4ELVA 2AX0A 2I5JB 4PQUA 3CCJS 2VICA 3UR3C 2A1BA 2A10A 2LQ8A 3LP2B 2FD2A 4X4NA 3ZZZA 5CA5A 2C28A 3ZXWA 3UDLA 3CCES 4PWDB 4ECTA 4LSLB 2MZRA 3FEYB 3FBEA 1MWQA 4FF2A 3DOKA 1U1KA 1NK5A 3HMJG 4DV3J 2PFDA 2YXLA 2J7WA 3CTRA 4NX9A 2VPZB 2PI4A 1P9YA 2E1CA 2RDJA 2ADBA 2WTFA 5IQQA 4AQYF 1PKUA 1T9WA 2IDLA 4MT1A 1R89A 5DQHA 1LKZA 5FJ4A 4AL7A 5SUHA 3MR7A 5L1IA 1YDLA 4EMDA 5K14A 4CWBA 2BVZA 3G2XA 4LF2A 6AT1B 4CIOA 4F2RA 2C2RA 5U47A 2AE0X 1RT1A 3GU0A 2MQQA 3OTBA 2XTJP 2DKOB 1U45A 4ES3A 4DSJA 4CLTA 2VASA 4JI8F 2IBOA 1TUVA 2HAIA 3KFWX 2HAFA 1HMVB 1RLCL 1GAOA 1Q5VA 1YQHA 2OPRB 4BDPA 4W92B 1IBKF 4JV2A 1J5OA 2FLOA 3MR5A 2W9CB 1S4EA 2WHOA 4MAKA 2BKOA 2F8MA 4QIWD 2XSFA 3JQKA 2YKMA 3M8ZA 3MD3A 4OHWA 3M8SA 3DDKA 1U24A 4JBCA 3C6UA 4ED7A 2A6MA 4AT1B 1FX2A 3W3SA 5D4NA 1RLDA 3R7BB 2D74B 3M8WA 2Q66A 3G8QA 3MOZA 1NLKL 3BGUA 2QC3A 1WUUA 2APOA 5EN1A 4MFBA 3O2IA 4MIBA 2UVUA 2R8KA 3ZNUA 5GADW 4UQTA 4ELTA 3EZUA 2EC0A 2KFYA 3K17A 4O44B 4UT4A 4X4VA 4FF4A 4C9DA 4LF9J 3SXLA 4RW9B 4CT9A 1RSCA 2D3O1 5L39A 2LYVA 4MKBA 2I0XA 4M5LA 5K8MA 5HANA 3LUYA 3TAQA 3BGRB 3G82B 4RUAA 3C6TB 4DCJB 2ACYA 4DS4A 2EWHA 1S7IA 2GQQA 1G6BA 3M8YA 1SC3B 3IC1A 4OYIA 3T1YF 3RBZA 3MTJA 4J90A 2H51B 3NLCA 3QNWB 2ZKTA 2VG7A 3ONQA 5JVHS 3MM6B 5ITHA 4FVCA 4P2XA 2J9CA 2V8VA 2ALYB 3CW2C 5E33A 4A8XA 2BABA 4AD6A 2VD3A 1JLFA 2CPDA 2A6OA 4NLRA 1S0VA 2VH7A 2IFXA 3T6JA 3TUIC 2OEMA 3B82A 2EBEA 3E8OA 1Q79A 2Q1LA 4EZ9A 3SI8A 4JOUA 3K5NA 2F4VJ 1RWXB 5F8MA 2BE9B 4C97A 1UCNA 3IFEA 1BQMA 1BHNA 1UMJA 5B09A 1T94A 3PW2A 2FY1A 1M5KC 5J2PA 4P75A 3B6BA 4ZCKA 1G7CB 1M5VC 3HVTA 4CLPA 1A6LA 3QFHA 4DR3F 1U1NA 4WXWA 1XNRF 4EGLA 2PI5A 1TL7B 5F8IA 2ZJPQ 4RKUC 5J1NA 2YKPA 2ZH9A 3SV4A 1TL3A 3Q8VA 5A8RB 2QE5A 4X4OA 2L48A 2W25A 4X64F 4OX9F 4PEOA 1S57A 1SUQA 2DGVA 4I67A 3LALA 1YJUA 2GZOA 2E5LF 4PQUB 2FJWA 4X4UA 4KT0C 3A3PB 2EFNA 1M5PC 4ZOSA 3P5BP 3QJJA 4M95A 3NGSA 2AEFA 2KVQE 4ZA1A 2XMTA 1PC4A 4JUZA 2HMIA 4QU7A 1WF0A 2F9DA 2ZH6A 1JQGA 2E1RA 3THPA 1TMJA 3CE8A 1BQNA 3A3OB 3LPYA 2IY5B 4YHHJ 1UW9A 3DOKB 4ZK7M 4ZLJA 5B0CA 2QA1A 5F41A 3O5TB 3KKFA 4DOZA 3RYLA 1E6YB 1M90T 4I56A 1FEHA 3MEDA 4B3TJ 3LWMA 2VJVA 3D6HB 3OV7A 1VHIA 2PMHA 1B75A 3MMCA 3I82A 5IT0A 4ZLNA 4KQZA 1VOMA 1RABB 2VUGA 1J2VA 4DEZA 2CX8A 3SV3A 3LQVA 2GO8A 2BX6A 3KLIB 4KV8A 1CJVB 3BJYA 2QLWA 4USHA 4ZN3A 5AE2A 5F3ZA 3CJ4A 2N3LA 3LP1A 3NNCA 2HQDA 1U6FA 3U1NA 2FHMA 4DZDA 3D3BJ 3TVZA 2WCXA 1FFWB 4OX7A 4YUDA 3CCZA 4BBYA 1JXLA 3W5YA 2ATLA 1VQMS 2DNZA 4N77A 1NKBA 2WVCA 4B9NA 5KFCA 3SEOA 4NCGA 3TVKA 5DDOC 2RDDA 2OTLS 1KLMA 1L5UA 1P8GA 3H8YA 5BYRA 3N0VA 5LMUJ 1FXLA 2YKMB 5ADZA 2ZHBA 3UI3A 2OLWA 1YRUA 2PDAA 4B3MJ 1D0EA 3QWUA 1HNIB 3ELHA 3TANA 2JFKA 4RBTA 1W7WA 3SQGA 1B0PA 1BLUA 3DMJA 3R6GB 2VF3A 4OYWA 1AZSA 1VBYA 4CLLA 1T02A 3CGIA 4J5OA 4TY9A 3ZZ0A 3OR1B 4UY88 4RNHA 4RR5A 5AXNA 3DRRB 5KG7A 2YWHA 1TAQA 1QE1B 4UY85 2HBQB 1X60A 4KH0B 3M2RA 4DSLA 4ED3A 1HWLA 2ASLA 2R2SA 5KT3A 4WF9Q 3AH6A 2GQCA 3TEGA 2JEJA 5D4OA 1U1RA 5H9FJ 2FLPA 1VHFA 4WFAQ 1BMQB 1HNXJ 4DUYJ 3G8SA 2HFZA 2MLYA 2YPYA 2AYEA 1VRUB 3TJ8A 1U25A 1U2FA 3W64A 4JI2F 1FEEA 1VBZA 1HPZB 4LQ9A 4UOCA 2HWHA 3DRPB 3HHEA 2DR6A 4KO0B 3BO3A 5KFSA 3BYRA 3QGPA 3C14A 3FEZA 2W2NP 5H9FK 2KXNB 4C3MA 2DH7A 4QCLA 1NK6A 3CJ2A 4ANEA 1VDHA 2XNRA 4K59A 2AYGA 4DSEA 2W8KA 4OLOA 1RYSA 1N6QA 5KFPA 4DR1J 1Z1ZA 2C22A 1VYAA 2FPHX 3N28A 2HQIA 2VG7B 2SXLA 4JI4F 2C2EA 2MJNA 1JLEA 3QSYB 4N56A 2DY1A 2F65A 2W24A 1HHSA 3N9UC 4A4JA 3NNAA 4P2FA 3W5ZA 2YNIA 2FC8A 5GAEI 1NCLA 3FRYA 2FHJA 1LW0B 4OV1A 3JAMU 1FWKA 2UXDJ 1FKAF 5DG9A 2RU9A 2B5JB 4DR4F 2J8AA 1GX5A 1MMNA 5GAHI 1T9XA 2IJNA 1ZA1B 3GILA 2DHSA 3DXSX 5L46A 2O3DA 4TLRA 3KG0A 3HVTB 3FGVA 3FQLA 1PYSB 2BM0A 2DITA 8ATCB 2V8PA 2WW8A 1XMOF 2DNRA 4FZVA 3C16B 3TA2A 4IRKA 3RTVA 3DLBA 3IWNC 1TL3B 3M8PA 2XHWA 2XCPA 1N0UA 3SQOP 3CJTA 1JLBA 1SUQB 1AT1B 3CIZA 1ZJWA 5C24A 1EQMA 3ZZPA 2VQEF 5HAOA 3G87A 5DG7A 2DXFA 1SQEA 4B9TA 2BW7A 3T9ZA 3HHKA 3OR2A 3R5CA 3CC2S 2XMAA 2K7JA 3I9ZA 4O3PA 3QGGA 2WVFA 1EIYB 2J6SA 1QD1A 4U7CA 1Q81T 1DZ5A 1MROB 3A4TA 4F4ZA 1U4BA 1TVRA 3A8KA 1HD1A 3PJ9A 4JI6J 3NY0A 4QU6A 3MEDB 2DGTA 1KN6A 2HQ3A 4HH1A 3PNIA 2GHPA 4YR2A 3IXQA 2M52A 3P6YC 4KJIA 2LKZA 1U47A 3SIPB 3CJ8A 1VQ9S 1WJ9A 1AROP 2VPXB 1GTRA 4EBCA 3LP1B 4FBUA 2I8EA 2CRLA 1PCAA 3OTEA 1PYOB 2HG4A 3VAIA 4U6PA 4CNZA 2KI2A 2OSRA 4CYUA 3RAMA 1SJ1A 1VIOA 3BH7B 3K0JA 1WTFA 4Z37A 2IMWP 5IZHA 4MK9A 3M8RA 2HBZB 2HNZA 1FDAA 2KRBA 3ZTPA 2ZOGA 1FDNA 5DDRC 2W9AA 2Y1JA 1GH8A 5J2QA 4EO8A 1DFDA 4NMXA 4GO5X 2CQGA 1RWNB 2J7KA 2DK2A 4JV5J 8AT1B 5IWAF 4LUBA 1D09B 1F5BA 1GMVA 3VF0B 2E9TA 1HQEB 4CLZA 2DGUA 3DNCA 2Z0YA 4NE9C 4DG1A 3IWLA 7AT1B 2ZOFA 1AZSB 1VQ6S 2IMOA 4YN3B 2CG4A 4B9SA 2HWIA 2RS2A 4OZNA 2QSFA 2YKNA 4KC5A 4P7VA 1UVKA 1SH3A 1YJTA 2WOMB 4M94A 2RQKA 1S0NA 1IBCB 2V69A 2GO9A 2RF2B 4NPOA 2DO0A 2XC9A 4IUFA 3S01A 3PVXA 4HH0A 4F8RA 3EDRB 3VAFA 1R8BA 1KQKA 1H2VZ 4LBIA 2NZ4A 4ERDA 2QA2A 3RBEA 4DHVA 3A8EA 2XLKA 3GV5B 2C2KB 2CQCA 1SL2A 2JRSA 3X1LB 4WIQA 4PWWA 2DH9A 2LA6A 2CJQA 2XNQA 3DLKA 4HKQA 1HBNA 1Y5IB 2BOAA 3C14B 3ETOA 3RAQA 1QSYA 1ZAVA 2CZ4A 2HQCA 1FFSB 2JLEA 1WG1A 5KOWA 2VG5A 3GFYA 2XY5A 5KT2A 2EEYA 2UXCJ 5F8LA 5A8WA 4DPXA 3HX9A 3JS9A 2XG8A 3NGUA 2CQPA 3HHNB 4CH1A 4I2QA 4RNFA 1JLEB 2AX1A 4P72A 3VV2B 4J9MA 1L3UA 4ICLB 5T7LB 1HKAA 1NDPA 2M88A 2NQPA 2LU1A 1U8SA 3NGDA 2ZHAA 1Q53A 2YNIB 1QVFR 4RX6A 4J9RA 1LK5A 2GX8A 4F2SA 4DR6F 1FRKA 2BV3A 3D6FB 2DNGA 2XSJA 1EX8A 1XC9A 2ABYA 1UFKA 4UUXA 3EVWA 3KW2A 2CA9A 3MEGB 3PYFA 3FJ2A 1GTEA 5D6GA 3CJ0A 3KK2A 2M70A 3GIMA 3BQ2A 2RQ4A 3H2UB 4RW4B 1Q82T 1X5TA 1VMBA 1FI4A 5IM0A 1IQZA 1HWUA 1DFUP 1LK7A 2KH9A 2IM1A 4I1TA 3EVMA 3M8PB 5HI7A 4NLTA 4DV3F 3D5MA 3BO2A 3W8PA 4YDXA 2CPYA 3QPIA 3NBPB 5E3RA 2CPZA 4JI7J 4PUOA 1CC8A 1S6OA 1ITPA 2V2ZA 3AOAA 3K7RA 3LAMA 4A8FA 1OO0B 4OHZA 3PM9A 4QR1A 2MZTA 3VVTA 1TTHB 1N48A 1GNKA 3R5GA 3MAAA 5JXSA 5B0DA 1RACB 4E2FB 1M1HA 3C15A 1TK8A 4B3OA 2JC0A 2HS0A 4HVZA 2PA3A 4OZJA 3N6MA 4F0MA 4RU2A 2KYZA 2RSQA 2GGPB 1Y0HA 4J9VA 3VGTA 3SYZA 2QLXA 4IDKB 2MSSA 3DLLS 2KB2A 4K4XA 2UVVA 1QY7A 2HFSA 2AJ2A 5E41A 2E7XA 1PAEX 2RUGA 2GNKA 3R5AA 4UF4A 1O0PA 4IQMA 4FF1A 3W9HA 5B0EA 5D77A 2NS1B 5HLFA 4M5IA 4NZ0A 4DR7J 2N4DA 3R1LA 3HFKA 2CYYA 1LNQA 3NOGA 4Z2XA 4P71A 1VRTA 1BGXT 2AEJA 1RT5B 4HI2A 4B17A 3HLUA 3J7YI 4A8QA 1RK8A 3MPDA 3UDCA 3MEKA 3UW1A 5EWGA 3T5KA 1M1GA 4AXIA 3GSDA 4Y6IA 4ZVPB 1YVFA 3QRPA 4EZ6A 3MMAA 2EI5A 5LJ3Y 2ZE2B 3MTKA 4RWXA 2NXNA 1KKHA 4J9OA 3OLBA 1Y00A 2BUNA 2XGPA 1VLYA 1RE1B 2KXHA 4ENOA 4C0HA 2AJ1A 4ZCIA 5D78A 3BGOP 5HVFA 1SC6A 1O5JA 3F0NA 1CJUA 3KHRA 2R8GA 3HVAA 4LF9F 3V5RA 1XMQJ 1B0VA 2VDIA 4YB5A 9RUBA 4JV1A 4X62J 3DLJA 4Y65A 2DPJA 3G6XA 2XQCA 1FDBA 1OS5A 4DG1B 2OMLA 3M2UB 3H5YA 4X4RA 3GONA 3N6LA 3NGKA 2JDJA 3RRGA 4DFKA 1Q86T 2P5VA 2A3JA 1DY3A 2MKKA 2OAUA 5SZTA 4EYIB 2EPIA 4USTA 3D0IE 2XZTB 2JFDA 4WCES 3W62A 2QYCA 4NA2A 1R6YA 1CULB 3MURP 1VQKS 5HBMB 3HHLA 3KUEA 1KNZA 4WYWA 3QRQA 4YMEA 2W2PP 2RRNA 2HGNA 5A0YB 1REGX 2VQFF 2DIUA 1F3FA 2K06A 3GYNA 4OYZA 4RUHA 1N36J 2RU3A 3LA0A 2W7OA 1BUXA 5KTQA 4MKVA 2F4VF 3RJMB 1IVZA 1YSJA 2MXYA 3TARA 5HO4A 3LTOA 2VG5B 2ZJRQ 4HYKA 5A8WB 2L9WA 4Y0FA 4DX5A 2HZCA 3RR7A 4U7UK 2VKZG 1RTHA 2VJUA 1EHWA 2E5HA 2KZMA 2HGLA 4L3NA 2HGMA 2PJJA 4ED4A 1JLQB 1OSDA 1NJYA 3EMTA 4OYPA 1S48A 4DFJA 3A3NB 2O67A 5GAHU 3DGPA 2D41A 4ECVA 4F02A 1RWUA 4OX8A 4UOFA 1OMSA 1U2RA 4RBUA 2R8IA 3DYAB 2DNYA 5KG4A 5LM7E 2XI3A 3E01A 3WQPA 3UCZP 2HQFA 3B4MA 2MZQA 2XI2A 3HCXA 3LP0B 9ATCB 5EDWA 4M8LA 4YHHF 3KUHA 2CUYA 2LMIA 1OQ6A 4ZVEA 1A7GE 1QVGR 5I3QA 3ZZYA 4PCQA 2ALZA 4B3TF 5HVHA 3K8VA 2N7CA 2Z2YB 4PUOB 3I55S 3PZPA 3CCSS 1TAUA 4NLPA 2WBMA 4HI1A 2M7SA 2XZWA 1X4BA 1VQNS 4H4MB 3I9V9 2C3UA 2H4WB 2G6GA 4CO0A 2MGZA 1FD8A 1FE4A 3CIMA 3MAAB 1VC0A 1IKXB 4CO3A 3C8YA 3EZOA 4C4WA 3ZZRA 3C15B 1U6BA 2GVDA 4ZS6A 2F7VA 2DHAA 3CXCR 3G71S 5F0UA 3PG9A 3LOUA 1NJIT 4MYUA 1T9VA 1F3VA 2UUCJ 2W1BA 4LBPA 4PQAA 2C1EB 4UUWA 4KR0B 1EQ0A 4WPAA 1Q8BA 4ED1A 2HHHJ 4KYZA 3H7HB 3PJXA 5F8JA 2OD6A 4TXSA 5LMUF 3QFWA 3AQPA 1BD6A 3CVKA 1R3NA 1U7LA 3HJFA 4LVOP 4NYPA 4LT6A 3MPUB 4B3MF 4DPWA 5FLXY 3OLAA 5A6PA 3DI6B 1MG7A 3TAMA 4NXMJ 1XQIA 4NRUA 4MMOA 2Z57B 3RU0A 1QM9A 1TQLA 1SJRA 2GIFA 2DR5A 3VTIA 2XY7A 3MMAB 3R8YA 3AB2B 2CDQA 1SJ3P 3CJ5A 4JP8A 1EP4B 5IC6B 1VHKA 3CF5Q 4F4XA 3ILLA 3AD9C 2CWXA 2OHDA 4GMKA 4CLKA 3PO4A 5AXLA 3Q86A 1CJUB 5I42A 2R4FA 3B4DA 3V6DB 4DUYF 5K8NA 2IVFB 2V4JA 3AJ2A 3N01A 1HNVA 5LMNJ 4LF4J 3UNGC 2JEFA 5LOQA 4NI2A 4LRBA 3RB4A 1KS2A 3FMBA 4Q0BA 1T3OA 1FKPA 3MM5A 2CAJA 1S1WA 4J9QA 5ETTA 3S6EA 2Y1IA 1JXEA 4DR1F 1RHMB 1RTJA 5CYJA 3D6TB 4K2XA 3M32A 1U2CA 1QRSA 5C42A 4AE5A 3HZEA 2BJ9A 3AT1B 4WIIA 1ULRA 2C3PA 1OYEA 1RHRB 3ZZUA 3GP9A 3M05A 3I4PA 2C2ZB 2GAHC 1EB0A 2BBEA 4CH7A 3RW6A 3ZZTA 3BEGB 4USMA 4AQYJ 1RU2A 1TP7A 4BHQA 2XS7A 3CD7A 2K1RA 2ZDPA 2ZH8A 3RG6A 4WTOB 1EETB 1GT8A 1C1BA 5C5JA 5F8GA 4C8LA 4F67A 1N52B 3OVBA 2J9DE 4C3KA 4KY3A 2BJDA 4LJMA 4IH7A 4AL5A 3BQ1A 3MGJA 2K2PA 5I3PA 3UNYA 4I7FB 1XR5A 3CCWA 4WFBS 1UVJA 1C2PA 1S4FA 3IRXA 2M8HA 1MMDA 2H5JB 4P2MA 1RWKB 4I69A 1KVKA 4NCAA 5HMZA 3TJAA 4A48A 1IBKJ 3NCRA 1S9EA 3PIOQ 4XPCA 1HIYA 5LL6d 3DGPB 2Y1LB 1D9FA 2WONA 2QLFB 1MU2A 2B0GA 2R2UA 3B78A 2LXUA 5GAGI 4I68A 2O1PA 3KLGB 3GG1A 1R0AA 3PRBA 4MIAA 2MZSA 2V0NA 2AV5A 2BYCA 3PY8A 1S59A 4IOCS 2AZ1A 2JL9A 2BACA 3NCQA 4ILMA 4ZP6A 3CO0P 3U02A 3QQCD 5CCLA 1ZM3A 2VHGA 2XWXA 4O3OA 1Q7LB 1O51A 2NUHA 3DGVA 4UY8T 2AJ0A 2E9RX 1MLAA 2CQDA 1IWGA 2CJYB 4OYMA 4DPYA 3OQ2A 3RRHA 4P73A 4DV0J 3RR8A 1N33F 2MKSA 4R8UA 1VR6A 4M1KA 2F63A 2C42A 1HBOA 5IOLA 4ID5B 1YBTA 2DR7A 2LLZA 1PBUA 1KTQA 1BWEA 1UW4A 3I6PA 2QGFB 2XZDB 3MCSA 3J81Y 1WC1A 2A18A 1NBEB 4TVAB 5G0RA 1X4HA 4EBEA 3TX8A 2V2VA 1NDKA 1YRXA 2OEJA 2ACMA 3CUNA 4H4OA 3PX0A 3KMQA 1HYSA 5L1JA 5GMEA 1YHQS 2CJXB 1K9MT 3KLFA 3G6YA 1VQ7S 2G2ZA 3PRDA 3KLHA 3TAMB 3OUYA 2IA0A 4USIA 2IRUA 1R8AA 2HWTA 2LDYA 4FXWA 4UTGA 1MWYA 2DGOA 3AJDA 1NXZA 4DI6A 3MMJA 1SH0A 5KFMA 4ZVGA 3CO9A 2E66A 4WCEQ 4ZCLA
chains in the Genus database with same CATH topology
5LSLA 2E5LF 2VA3A 2PSZA 1X5OA 5BNZA 3GFXA 4XPEA 3KLGA 4PQUB 4N5SA 4ZMMA 1PO6A 1JLAB 2YKAA 5KG6A 2KU7A 3BM7A 2HS4A 2FJWA 5K9FA 4CTAA 4X4UA 4O44A 4ZPWR 4KT0C 3SQGB 3DMJB 5HN0A 2EFNA 3PKMA 4FXVA 4TY8B 1M5PC 3GIJA 3I96A 2F8HA 2OJ3A 2DNHA 4L6V3 3FEXB 4ZOSA 1NJZA 2MHNA 3MM7A 4DN0A 2OD4A 5KG2A 3QJJA 4M95A 4DV7F 2QMXA 5B0GA 5I42B 1WEZA 4ZA1A 2N3OA 4EEYA 2XMTA 1HW8A 4DL5A 4ILRA 4PXEA 1PC4A 4KGMA 1ZAXA 4JUZA 2HMIA 3NAIA 4QU7A 3PV8A 1WF0A 3DN9A 2F9DA 2J9DA 4NLWA 3W7BA 2ZH6A 1LXNA 1G1XA 4OMFG 5AXMA 3AA9A 3WC2A 2XO7A 4H4KA 2E1RA 2V4JB 3THPA 5JVHQ 3MM9B 1Y9OA 4WFNS 1WF2A 2GIRA 2YWFA 3CE8A 5KFXA 1BQNA 3LPYA 1G3OA 1UJ4A 3Q2SC 5DRKA 4ZP7A 1N32F 3MMBA 2M2BA 2B4VA 3TA0A 1LWEB 3DOKB 3M2RB 4ZK7M 5B0CA 1T95A 2QA1A 3QJPA 5F41A 1HR0F 2M4MA 4NLGA 3MEEA 4HEA9 4DL4A 3O5TB 2ERRA 2ADCA 3KKFA 1GQEA 4DOZA 1CLFA 3RYLA 1N4LA 4E0DA 2U1AA 1E6YB 2KJWA 1HBUA 3FCHA 1TL1B 1M90T 3KHGA 3BR9A 3ICLA 4FN5A 1IXKA 1RP5A 4F4WA 4OZLA 4I56A 2GCFA 2ZKUA 3FRZA 3MM5B 4DSIA 5J2MA 5I3UA 1FEHA 1S1WB 4ED2A 3CULA 3MEDA 2WK4A 2HLTA 2UXCF 3LWMA 3EPIA 4DQPA 4KGKA 3OV7A 3MM6A 3QO9B 3DRXA 1RTJB 4I6AA 2PMHA 4CO4A 4ZP8A 4DPOA 2V5HG 4ID5A 1B75A 4KE5A 3MMCA 1WI8A 4ATNA 3I82A 5D4LA 4TKTA 5IT0A 4J9KA 5F3TA 3PXGa 4PG4A 3UFCX 5IS2A 1VC5A 4KQZA 5B0BA 1VOMA 5A6WA 2KM8C 5KG3A 2VUGA 3G96A 1JNZB 2C3YA 1J2VA 2VG6B 4DEZA 3CCRS 3SV3A 3I87A 2GO8A 3LQVA 3KLIB 1FXDA 4KV8A 3FZBA 2X51A 5L8RC 3BJYA 2QLWA 4USHA 4WFAS 2ZH2A 5AE2A 2LQJA 5F3ZA 4OQJA 3CJ4A 2N3LA 3CPWR 3LP1A 4OI1A 4X66F 2IVMA 2YWGA 1S7HA 5LSOA 4E98A 1FCAA 1REVB 1QAIA 2JEGA 3NNCA 3G9CA 4I64A 3CD6S 2CQ4A 3PJWA 4B9LA 1U6FA 3U1NA 2U2FA 2FHMA 2BDPA 1RT4A 1RT3B 3H4BA 1N6QB 2Y1RI 4K0KF 3TVZA 2WCXA 2CPFA 3GIIA 2IYIA 2CPHA 1VQ5S 1WACA 3OL7A 4OX7A 2MMYA 4CO5A 3UPFA 4P6QA 1FNXH 4F4KA 5KFDA 4G3IA 4YUDA 3CCZA 5L1KA 2GFFA 2LVWA 3RZAA 4JI0F 4OJGA 4BBYA 1JXLA 3MR2A 4DSKA 2ATLA 1UFLA 1VQMS 2DNZA 4N77A 4TYBA 2R7SA 3F44A 1KVIA 2RVJA 1NKBA 5HMYA 4OI3A 4ZPTR 4TLQA 2FJAB 3L7PA 3IAM9 4B9NA 1S1XA 2PD1A 5KFCA 3ISNC 3SEOA 4NCGA 1NEEA 1ZTWA 2GA7A 1UVIA 2L41A 4FVMA 3NNHA 3TVKA 5E0OA 5DDOC 1IR0A 3M6VA 2OTLS 1KLMA 3MF5A 5A8RA 4LF6F 1L5UA 1P8GA 2P6TA 3H8YA 5BYRA 3JTOA 2GC8A 3N0VA 3V4MA 4X84A 4TU8A 1FXLA 4KKOB 2YKMB 4C8NA 5ADZA 1KLNA 2XMMA 2EFQA 2GW8A 3UI3A 2ZHBA 2OLWA 2EG1A 2ZBIA 5AE1A 1YRTA 2HNDA 4DX8H 2VBXA 3M1VB 3X3UA 1VGYA 2DHGA 2UUWA 3IS9A 5KG5A 1YRUA 2PDAA 4K4YA 1X0PA 5KFQA 1D0EA 3QWUA 1HNIB 1JLAA 1X9WA 1NHVA 4YEAA 3TANA 2JFKA 1QTMA 5M2UA 4OL8A 4RBTA 3DRSB 1VBXA 2NLWA 3SQGA 1B0PA 1BLUA 3DMJA 1JLGB 3VWSA 4TY8A 2COLA 3LWLA 2LEPA 3AJ1A 3RRGA 3V81B 1AFIA 4USJC 4I4BA 1S9EB 1VBYA 4ZHRB 1NYLA 1T02A 3CGIA 3FSYA 1F60B 4J5OA 5DDPC 2LA4A 4KHRA 4URSA 4QBUA 4TY9A 2XWYA 5BJRA 1HNXF 3ZZ0A 4NYOA 3OR1B 4RW7B 4UY88 2L9NA 4RNHA 4IFVB 2XB2D 4NXNF 2MQLA 2WONB 2FHOB 5KFHA 1P27B 1CG2A 5IZNA 5AXNA 2M3DA 4NA3A 3HVRA 3DRRB 4BC7A 5KG7A 1ZAWA 1ZM4A 2GMLA 1TAQA 2YWHA 1QE1B 2PGCA 3MM9A 3MDFA 1PC5A 2W4DA 2CQ3A 4UY85 4NLSA 2BE2B 3OW2R 2H9ZA 2RRBA 5L1LA 1TL5A 1JLBB 3SCIE 3CEDA 5E3PA 3M2RA 3GWCA 3AQOA 1UJ6A 2L08A 2Y0SD 4ED3A 4DSLA 4DR2F 1HWLA 3TUJC 3UD4P 1GXUA 2ASLA 2R2SA 4WFZA 1RGVA 2X1GA 5C24B 5KT3A 4WF9Q 6FDRA 3AH6A 1DHMA 2G4BA 1E6YA 2GQCA 4KIAA 2JEJA 5D4OA 1S72S 3OL6A 2BQUA 5H9FJ 1U1RA 2J76E 4DQIA 2FLPA 1VHFA 2GMHA 2IC3B 2KHDA 5DM7S 4O23A 4BS2A 4J9LA 4WFAQ 5BYSA 3DU6A 2MQNA 3HVWA 3G8SA 2HFZA 3ENWA 3ENVA 1LOUA 2Q79A 3BR8A 7FDRA 1TK5A 1KFSA 3OR2B 2FVQA 2AYEA 1VRUB 4BCAA 2R8HA 4Y2MA 1U25A 1T3NA 4TQRA 3NCPA 5F9LA 1U2FA 1YJ9S 1RJJA 4JI2F 2MKJA 2RH3A 1FEEA 1VBZA 2FC9A 1SL0A 4V19J 1HPZB 2LQBA 3FFIB 5KFGA 3Q8SB 3GV8B 4LQ9A 4G1QB 2HWHA 4OHVA 4UOCA 3M9OB 1S76D 4OX6A 3DRPB 3W2VB 2N7YA 1CQMA 2LXIA 3HHEA 5AE3A 1DURA 2ZBCA 4KO0B 2CVEA 5KFSA 3BO3A 4DS5A 2RJZA 3QGPA 2LEBA 3FEZA 2D3OR 3OFGA 3KLIA 2B4UA 1TVRB 2KXNB 2MZ1A 5K8PA 4C3MA 1JJHA 1U09A 1V3SA 4DR7F 3M6XA 2JJ4D 2Z2MA 2DH7A 1L3KA 4G1IA 2RD5C 4QCLA 1NK6A 3CJ2A 5IT4A 3PDNA 4YR0A 3L3CA 2XNRA 3KLEA 4K59A 4RW6A 2OSQA 1F9FA 2YKQA 4J9PA 4DSEA 2W8KA 2RE8A 4IYQA 2W7AA 4OLOA 3CCMS 2AYGA 2VPYB 2JVRA 2DVIA 2IJFA 2PMZD 3WC0A 2UXDF 4K4ZA 3MHYA 1RYSA 1RT3A 2B43A 1N6QA 4NL5A 5KFPA 1YI2S 1Z1ZA 2C22A 1S1UB 3AY0A 1XR6A 4ZDNA 4B9UA 2FPHX 3N28A 2HQIA 2VG7B 4QIGA 2SXLA 2YNFA 2MQMA 4JI4F 3OXLA 2G1DA 2C2EA 2Q6BA 2MJNA 4KRWA 1JLEA 2FDNA 4N56A 3PFOA 1RTDB 2XLIA 3H5XA 2ZD1A 4RZRA 3W2WB 1QAJA 1S1TB 2W24A 5B08A 5HQ8A 5K5MA 1HHSA 1DARA 3N9UC 4A4JA 4B9VA 3NNAA 1X5SA 1Y3JA 1WG5A 2M0GB 5E7OB 2P9CA 3MECA 3VQTA 1KD1T 2YNIA 2FC8A 2RMLA 5GAEI 3KNGA 6FD1A 3FRYA 3OXGA 3DCAA 3WZ0A 4DL7A 2FHJA 1LW0B 4JI1F 2X1FA 3PHEA 1UFWA 1X4AA 4OV1A 4ED6A 5LT5A 5IT9Y 4RNMA 3CMES 1TKTA 5CCMA 2ZH5A 5DO2A 1FKAF 2M5YA 5KFOA 1P9QC 3MI7X 5T14A 3U27A 2AJQA 4NLVA 2RU9A 4MJKA 5DG9A 4EU0A 4KKOA 2B5JB 4YDDB 1NK7A 2EK1A 2ZFHA 2DJWA 5J1PA 4DR4F 2UV8G 1SJ4P 5CXTA 2J8AA 2ASJA 1GX5A 1MMNA 7FD1A 2V94A 1DRZA 1R7IA 3SCKE 2F9JA 1DJ0A 5GAHI 1HNIA 2IJNA 1X7VA 2VFSA 2XCAA 3GILA 2DHSA 1LWFA 2KYXA 3DXSX 2O3DA 4TLRA 1XMQF 4FF3A 1LWCB 3DRSA 1Q1KA 3KG0A 4H4OB 1T7PA 2JX2A 4IO9Q 3HVTB 3EXYA 4Y2KA 3FGVA 3FQLA 4X62F 4ED0A 2BOPA 3V81A 2ZH3A 2BM0A 3BSNA 1XK8A 2UZAA 3KLFB 1UVNA 2DITA 4ZHRA 1CVJA 4WTYA 3K5PA 2BRLA 2HNZB 3BF4A 4OZ0A 2WW8A 3OR1A 4RW7A 4DFMA 1RISA 4IFVA 1HD0A 1XMOF 2DNRA 3TYTA 4MK8A 3ZFVA 5DGBA 2NPFA 2C3MA 4X4QA 4FZVA 2RRAA 2OTJS 4Q5VA 4ELUA 1QRUA 3TA2A 4IRKA 1YG0A 3IR7B 4G1PA 3RTVA 3DLBA 1DQAA 3IWNC 2HZ7A 2KFZA 1TL3B 5GMKa 3DRRA 3HHLC 4OI4A 3M8PA 2XHWA 2I9SA 2XCPA 1QE1A 1N0UA 1X4GA 5J2QB 2FIUA 3PKYA 3OXFA 4Q2LA 4DQRA 4IQXA 3LO3A 1NAQA 2BE2A 3CDEA 1HWKA 1ZPWX 3MM8B 5HL7Q 2R7OA 4RU9A 1MNEA 3DHWC 3LANA 1JLBA 5D3GB 2BQ3A 1U49A 5EX0A 4WU2A 1SUQB 2IM2A 1RTIB 3CIZA 1ZJWA 1S77D 3OTCA 2EK6A 5KG0A 4DL6A 1LQ9A 4PXBA 2IBKA 5C24A 2RT3A 4U67S 4BWMA 3ZZPA 2F1FA 2OFHX 4F50A 1FO1A 3N4WA 4CTAB 2VQEF 4A8OA 5DG7A 2IC3A 4X4SA 2ZUGA 3SSSA 2NXUA 2CPJA 5KT5A 1SQEA 4B9TA 3MM7B 4JI6F 4DJBA 2E29A 3T9ZA 2B51A 1I1GA 2K3IA 2V8DA 3HHKA 3OR2A 3R5CA 2HVIA 1VRUA 3CC2S 4YQWA 2MSTA 4O3QA 2K7JA 3I9ZA 4TU9A 4O3PA 1PGZA 1QAYA 3SCLE 3QGGA 2J6SA 4V19X 4U7CA 1J5EF 2YNHB 1Q81T 2YKNB 3OL8A 4ECWA 2OPSB 1A9NB 3ITHB 1X5PA 3ULHA 1FRHA 1K1SA 4WXOA 1H7XA 4DV2F 3DLHA 1HPZA 3FFIA 5LXRA 3RW7A 2W4PA 4G1QA 3DRPA 4OLPA 3W2VA 5LJ5Y 3HHDA 2WB4A 3BREA 2XGQA 1D9DA 4KO0A 2W9BB 1MROB 1DZ5A 1KSPA 2K7KA 4C98A 2BZ2A 1N36F 4F4ZA 2A2CA 2KTQA 3MMBB 1U4BA 4URGA 4IFYA 1TVRA 1FJEB 2IVYA 1HHTP 2P6SA 3SCJE 1N34F 1HQUB 3BZQA 3CCQS 1HD1A 3NRBA 3BS9A 3KK1B 3OSPA 4WJBA 1RA7A 1RI7A 2KVIA 1WEYA 2HFOA 5DLFA 4A8YA 4JV0A 3H20A 3GFHA 2D7SA 4Y2IA 2JVOA 2VA2A 3F56A 3P96A 5J2MB 4QU6A 3TQ1A 5I3UB 1D8YA 2DB1A 4YOEA 3MEDB 2DGTA 1S1UA 2NREA 5GAGW 1KN6A 3T6BA 2KKHA 4XDCA 2E44A 2HQ3A 4WFBQ 4HH1A 1M5OC 2RKIB 3IGVA 1KHVA 2QIFA 3PNIA 3VALA 3Q2TC 1JKHB 2GHPA 1RTDA 2D3UA 3IXQA 4YR2A 2ZH1A 2M52A 2J0QD 3W2WA 2L9DA 2AQ4A 2LKZA 3P6YC 1U47A 1S1TA 4KJIA 1IKYA 4F26A 2DR9A 1KOOA 3QIPB 4WZQA 2XMUA 2FHJD 4PR6A 3EGWB 2E1MC 3C66A 2QV6A 3TA1A 1D3WA 3UR0A 3D2WA 2OP5A 1VQ9S 1DAXA 3E3XA 3DLKB 2DNOA 1HBNB 4NLXA 3C2PA 1AROP 2NUUG 2VPXB 4ZVFA 1GTRA 3U7JA 4EBCA 1LW0A 5M2PA 1NZAA 3LP1B 3K8WA 4URQU 4FBUA 1V3ZA 2RIJA 3M9MB 4H3SA 4EBDA 2I8EA 4IRCA 2CRLA 4ZKAA 2MY7A 1AW0A 3AA8A 4KBIA 4C11B 2B5JA 3OTEA 2KN4A 4RUCA 2HG4A 2VBWA 3K5OA 4P7TA 3Q24A 3VAIA 4U6PA 1IKWB 4CNZA 2RDIA 1F0XA 2Z2LA 1U1QA 3I5AA 2AYMA 2B9WA 2KI2A 2OSRA 4JV5F 1LWCA 1SJ1A 3M8QB 1VIOA 3RAMA 3K0JA 2N4CA 1B0TA 3IBWA 1S6PA 1FRIA 1U26A 2FGOA 3CD5A 3NWGA 4I2QB 3J7YU 4ECYA 2JZ5A 1WTFA 3V2UC 2B3TB 2G13A 1AFJA 4Z37A 2IMWP 2V2KA 5CYQB 4FNHA 4N47A 2POKA 5IZHA 4N41A 3ISZA 4MK9A 2J0XA 3KMSA 3M8RA 3PIPQ 4KTQA 3NMAA 2HNZA 1FDAA 1M5SA 2DNKA 1UEUA 3TNVA 2VV5A 2KRBA 2EFVA 4K4VA 1FK9A 3GFZA 1S1XB 4NLDA 4TN2A 3GV7B 1FT8A 2NPIA 3MFHA 1U1OA 1SJQA 1VFJA 2VFVA 1FDNA 2JHEA 2ZOGA 4QYZJ 5DDRC 3HXMA 4P2BA 5C25B 1JMTA 4ZPAA 2W9AA 4TNOA 2Y1JA 1GH8A 4IOCQ 3EGNA 1ZPVA 2VFTA 2OH2A 1UWBB 5J2QA 4PG5A 1UKUA 2XSJB 1HBMA 3L7OA 4EO8A 5JVGS 2J6TA 1DFDA 3MM8A 4ECZA 4XAKA 1FKOB 1JJ4A 3AHPA 4B08A 4ECQA 4GO5X 5DGAA 4QZVB 1U48A 2WRMA 2OPPB 3P49B 1RTIA 2CQGA 3VQSA 2J7KA 3TAPA 1VS3A 2HNDB 1GTSA 2DK2A 3IS9B 2DNQA 1KFDA 1MW7A 1TKZA 3OPKA 2R7VA 2HNYB 1EUQA 4OI2A 5IWAF 2PEHA 3IR6B 1FESA 1F5BA 4LUBA