3W2VB

Crystal structure of the cmr2dhd-cmr3 subcomplex bound to 3'-amp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
322
structure length
281
Chain Sequence
MIEVTFTPYDIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRITVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cmr subunit Cmr2
publication title Crystal Structure of the Cmr2-Cmr3 Subcomplex in the CRISPR-Cas RNA Silencing Effector Complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Immune system
total genus 61
structure length 281
sequence length 322
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3w2vB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3w2vB03
3X1LB 4H4KA 3W2VB 3W2WB
chains in the Genus database with same CATH superfamily
4RX6A 4MIBA 3MXHP 1FE4A 1S0NA 1S79A 2NZCA 2J0XA 1QM9A 3NLCA 4R0EA 4CLSA 1T05B 4LF7J 3SQOP 4R5PA 2YKMB 1S0OA 3HCXA 1WI6A 1XMQF 3OTBA 1IWAA 4YMEA 3DMJA 4RKUC 1ZAVA 4C3LA 2B7BB 3R27A 4M5GA 1IKXA 4RPFA 4TY9A 4QYRA 4PABA 1H2VZ 3QJPA 1WC6A 2YWFA 2W01A 3DXSX 2UUAF 1HARA 2Z0GA 2E5GA 1NXIA 1ZS6A 3MPVA 3UD5A 1FDAA 4K50A 4X84A 3OLAA 3ILJA 3CCQS 5IZNA 3MFHA 4NCGA 1A0OB 3AXKA 1Y11A 2AJ0A 3THPA 2DO4A 1JLBA 1O0PA 3M30A 5MLCV 1YBTA 3FBEA 4IFYA 3W5YA 3QZ7A 4EUVA 2NQPA 4DFJA 4DR1F 3NRBA 3G71S 2DHGA 2IFXA 4JI8J 1SC6A 2OSRA 4MIAA 3BSOA 5F9NA 2EG1A 5HJYA 3KOAA 1AT1B 2DGOA 5IZHA 2CJAA 5CYJA 3KTQA 4X65F 1URRA 3ENQA 1H0HB 1FWPA 4C8NA 1XIQA 4K4VA 1KQGB 1R43A 4ILLA 5DDRC 1FX4A 3UW1A 3O3LA 1LFPA 1T03B 4QW9A 1CQNA 2BRLA 3DLKA 4E2FB 4A8WA 2V4QA 1KD1T 2ZH1A 2ALZA 1X4BA 1E6VA 1HNVA 4DUZJ 1YJWS 3GJTB 4DLEA 5HL7S 2XZTB 3OR1B 2WVCA 3K8WA 3IP0A 2J76E 4ZP8A 3UDCA 4CLYA 3H8YA 3D3BJ 2DR9A 1JLAB 1S1UA 2EBEA 2HVZA 5IWAF 8ATCB 2BJ1A 1CS4B 3J7AN 2XSJB 7AT1B 1S9EA 1SQFA 1YJNS 2HWHA 3KLVA 3EVMA 3QYYA 1BXNA 3MUTP 3OJSA 2CPEA 4AXJA 2QTWA 3H98A 4GKKJ 2ZITA 2CPXA 4JBCA 3U02A 2O01C 4HHHA 1VC5A 2MSSA 1BUXA 2GAEA 3OT9A 1T11A 2R8HA 3MM6A 3MD1A 1KOHA 2EFVA 4BCAA 2DGXA 1MMDA 1PJ7A 1IUJA 2XHWA 4ZPTR 4OLPA 4RNFA 4CH1A 3W61A 1PGZA 1RU1A 5HLFA 1TL3B 4OYIA 5F8JA 3CD7A 2C3UA 2BJ7A 4WFXA 1RWWB 4S0MA 2DXFA 2JLEA 2CYYA 3CUNA 1U1KA 2COLA 1SI9A 3M8WA 3K5MA 1QRUA 3SIPB 1S1VB 2JFDA 2VU5A 5ETPA 2ZUGA 2D41A 3ZZRA 3EUNA 2FQQB 4DEZA 2B5JA 2H5EA 2HMIA 2KHCA 3CE8A 2LU2A 2YWKA 5HMXA 4F0MA 1CJKA 5EDWA 2KL8A 3GJRB 2E5LF 4RU2A 4N56A 3HKWA 5LMUF 1U0HB 2YX7A 2F7VA 3TAPA 5E3CA 3T1AA 2DR8A 1EKSA 4CLWA 1P1TA 5FLXU 1YQHA 2HK3A 2B6AA 2CJBA 3RRHA 5B0CA 1Y00A 3D1HA 5J2NA 2OTLS 1WF2A 3QT6A 3OTOF 4WFBS 1NMEB 1IBLJ 1ZPWX 1CJVA 4H4OB 5B08A 3GU0A 4A8YA 3H0PA 2A2CA 3JAMU 3BO2A 3VAJA 1GAOA 2FTRA 2IM0A 1PC4A 4ECWA 1HIYA 3TVYA 4ANDA 3FMBA 3GTYX 5ETLA 3UR0A 1M90T 4LF7F 3PG9A 4BWJA 2GHPA 4NLQA 3V6DB 4JXZA 2KM8B 1QVFR 5EHHA 3PACA 4LVOP 4Y6IA 2W7OA 1ZOTA 3D6FB 3CCJS 3PZPA 2RSQA 2OP5A 3R7BB 2VBZA 4MFBB 4ECTA 2V68A 1ELOA 1HHTP 4ZPCA 3DGPB 4ECZA 2HEKA 3B78A 4DSLA 3VTIA 3BZQA 1RT1A 4PXBA 3IBFB 1TUGB 2J6SA 3K7RA 4OZ1A 1H38A 2GAGC 3KJNB 3AD8C 4QIVA 4WCES 3C2PA 2XI2A 2RD2A 3J81Y 3JYTA 1MU2A 1P6TA 3ELHA 2D3ZA 3B4MA 5M2PA 1TV6A 2QA2A 5F9LA 3TJAA 4B9MA 3F44A 2J0WA 2ALYB 2BRKA 2QFJA 3KWMA 4FNIA 4FN5A 3P5BP 3NEKA 4JI8F 4IRCA 2WW4A 4UY88 1U8SA 1FDDA 2GV1A 5H9FK 3J80Y 2AKWB 1IKXB 1LWCA 6FDRA 3B6BA 1DQ9A 5L46A 2RF2A 1UWBB 2DD8S 1VISA 1GQEA 4Q0BA 2CQ3A 2WHOA 2VQFJ 2WVFA 3QT7A 3KXDA 1MSWD 1AXQA 3BGOP 4L3NA 4QIEA 2U2FA 2JEIA 5LT5A 2VOPA 4TQSA 3W2VB 5K8MA 4EU0A 5HK4A 4F50A 1NKCA 4QWDA 2CPIA 2PMWA 1MWZA 4FNHA 3M30B 3CJTA 4G1QA 3H7HB 1NBEB 4IFYB 2HFNA 2W9BA 4DUZF 4EBEA 2ZE2B 2V0NA 2DK2A 1OSCA 1Q8LA 3T5KA 3CCLS 2E44A 1NB2A 4RUHA 4DV3J 1RAFB 1NKBA 2VL1A 2P2CB 2PO4A 1VLYA 2D3UA 4KV8B 2GJ2A 2V9KA 3S01A 2HFVA 3M6VA 3D3CJ 2XCAA 4R25A 2AWZA 3OTDA 4C3MA 2AD9A 2D3O1 4FF3A 2KRBA 4YUDA 1RDRA 1V6ZA 5A6PA 4ED3A 2E9RX 3G82A 4Q43A 1NZ8A 2HIYA 4GKKF 5K14A 4Q5VA 4CO4A 4QU6A 1FXDA 1S1WB 2B43A 3D1OA 2BBEA 3RU0A 1WKJA 1FKOA 1C0UA 2IM1A 1WSVA 4IG0B 2HWTA 2V4JA 1V5VA 2WB1D 1VQOS 3I0SA 2I9SA 3C19A 1N4LA 3KHLA 4HDGA 5A0YA 5J2MB 1GTEA 2ZOMA 3AODA 2RS8A 2RILA 1UETA 2OEKA 1AA1B 1NKEA 2DKOB 4NEYA 2EK1A 2F8HA 1SC3B 4Q8EA 3AA9A 4NLVA 2BE2B 4U67S 3EM1A 1SKWA 3I96A 2OD4A 2HLTA 2DR7A 1DLOA 2AJ4A 3DRXA 3OBIA 3P96A 4GRSA 4U7UD 3GFYA 1NHUA 1UWAA 2G0CA 4NLDA 4XIUA 2OPRA 1PKUA 2WOMA 2XY6A 4V19J 3A1YG 3WX8A 3HVAA 3J81j 2RU3A 5AJ3J 4C2MA 1NK4A 4NRUA 3BGRA 1DARA 5CYMA 1HWUA 1RSCA 4LF2A 2M3DA 4NRTA 3UN5A 2EFGA 3UFCX 4TLQA 1C1BA 2N3LA 3RG6A 1CJTA 1Q4RA 1IBLF 3LP2A 1D6KA 3CJQA 2YTCA 5A2QY 1VRTA 4Q2MA 2YNIB 1ZM2A 3B4DA 3NY0A 4LFAJ 2RRAA 3KKFA 1U45A 3BSNA 3A8JA 1T95A 4KB7A 4I2PA 2A2DA 4HR2A 5HP1A 1QVGR 1CJKB 4UOGA 5KFWA 4DPOA 2V8PA 4PYAA 2E1RA 2FJDB 1WNEA 1EHWA 2ZHBA 1KRPA 2RVJA 3OVAA 4TXSA 4DX7A 5E33A 2GGPB 2WSCC 1EQMA 1FEUA 5J2NB 1Q0NA 1NB7A 4N41A 4WFAQ 2QJ3A 1WEZA 2BJDA 2HFUA 1WOPA 3C15A 4ZHRA 1CJVB 1KEKA 1FJGJ 1ZM3A 4JI0J 1NM2A 3VQTA 2NSBA 1Q5YA 4I7FA 4ZVQB 5D0HA 5JVGS 1XMBA 1LW0A 3Q8SB 5B0BA 3RW7A 4ZMMA 5KFMA 4M5DA 2VG7A 1V3SA 3SMZA 3T6BA 2YWGA 2QZ8A 2QLJB 1YK9A 5I4MA 3DXBA 5ITHA 2BJ8A 2UUCJ 4CO0A 4WFNS 2B51A 1FJ7A 2CJXB 3K57A 4J9NA 1QSYA 3GR1A 2R7WA 2VQFF 1RT1B 1TKTA 4JI5J 4O4RA 3CJ4A 1NDKA 3GPAA 3GIJA 3GYGA 2AEMA 3P8BB 1JLGA 2IPOB 2D69A 2HRUA 2HZ7A 1F2GA 2GIQA 4NLPA 3R97A 1Q5VA 3JYTB 1TKDA 1MU2B 2QV6A 5KG0A 1GH8A 4QR2A 3CD5A 2KDOA 4WBFA 2HFZA 1VHFA 4LR9A 2FJWA 1OS5A 5GADW 3UDLA 1JLEB 1RA7A 4NLYA 2VC1A 2HW3A 3IO1A 3R5DA 3HHLD 4DV3F 5IT9U 2RF2B 2A6MA 3QRRA 4Q0BB 3RBDA 5DLFA 1KVIA 4B9LA 1G2EA 1RABB 5KFDA 2BYCA 3M8QA 2CQDA 3L7OA 1NDLA 2GZOA 1LFWA 4GKJJ 2FB0A 1BMQB 1PIEA 2K8GA 1HR0J 1HFEL 2VG6B 3AFGA 3BBBA 3RUBL 3RAMA 4UT4A 4IH6A 2LECA 4CCHA 1HHSA 4V19X 4LREA 5HMYA 1LK7A 4TVAB 2HNZA 2AYBA 1SH3A 3BSCA 3CCUS 3VZIA 3DGVA 2D3OR 2HFSA 3T9NA 3TP2A 3MURP 3HT0A 1F5CA 1P1LA 2KM8C 1RT5B 5G0RA 1FRMA 5IXUA 2YH1A 3MEDB 3CMQA 1FE0A 1RK8A 4TU9A 2Z2MA 2Z56B 3FMWA 2XS5A 4N8OA 4ITSA 1IBMJ 1L3TA 1U1LA 2ASDA 2J5AA 2NR0A 3HM9A 1ZTWA 2GAHC 5CXTA 3O44A 3G82B 4PRFA 5K14B 5HQMA 4PCQA 2X7IA 3MPWA 3B82A 3D0GE 4CLUA 2BANA 2K3KA 4CYUA 4M5JA 1XJWB 1C0UB 1R8AA 3W65A 3SFGA 3OXGA 5AJ3F 2V4JB 2DHXA 3I0SB 4HACA 4K4XA 2C2OB 2AZ3A 2JLFA 2DH7A 5A0YB 1N5VA 3MFIA 1T0TV 5IC4B 4UUXA 4A47A 3CDUA 1DTTB 2CPJA 2VPXB 3D54A 1W25A 1RI7A 4HYKA 2CPDA 1WG1A 2Q6BA 4PWDA 2QYGA 3D67A 2ROGA 4UZCA 1ZJWA 4DPUA 1BQMA 1DLOB 4WP8A 3PM9A 2WVBA 3HKZD 1NH8A 2F8MA 1TAQA 4LFAF 5KFZA 3I6PA 3BB5A 3SXLA 3PX4A 2WOMB 4ZVUB 4WPAA 4TYAA 2DR5A 1PC5A 4CH7A 1Q95G 3LQVA 1S12A 4AT1B 1S5ZA 4X4RA 1CC8A 2H9ZA 1RHRB 1T3NA 4FP9A 5K8OA 2XZDB 5CYMB 3D7SB 1UAWA 4KKOA 3N79A 5I3UB 2IM2A 3NGUA 4ZN3A 4ECYA 1Y3KA 2BR0A 4CLPA 1U6FA 1N48A 3GLJA 4LJMA 2EKNA 2GCFA 1JXVA 5DGAA 1C1BB 4O3PA 3IR7B 1M0SA 1CJTB 1WKLA 3LP2B 5CYQB 1FJGF 3JSBA 3ZZ0A 2MKHA 1GMUA 1NAQA 1VRTB 5DGBA 1RTIA 3E01A 3S1TA 3EZ5A 4TY8A 2OELA 2WW8A 4DV7J 4GO5X 3ZTOA 4I2PB 3SFUA 4BC7A 2A6OA 3R5CA 1F5AA 2L41A 5ETTA 3TAMB 2UUCF 3Q23A 2AJFE 1HD0A 3OXFA 2ZH4A 1XK8A 4QCLA 1YJRA 2FZGB 2N82B 4FVCA 2DPJA 4DV2J 3DLEA 5HN0A 4NYZA 4XDDA 2KT3A 4NL5A 4JI5F 2FJVA 1HNIA 1ULRA 4B02A 3CO9A 4YS2A 1RT4A 2QA4G 4QU7A 4ZJOA 1EETB 2K1RA 3C15B 1SC1B 2DXEA 5KFFA 1HQUB 3HI9A 4I7FB 2P9EA 3F73A 2VBYA 3BF4A 1LW0B 2RRBA 3DKDA 5DM7Q 4NX9A 4Q44A 1GFWB 2VG7B 1T9TA 2YKQA 4F0HA 2MYFA 5EWGA 2ZHAA 2ZDOA 5FDLA 2XHCA 3MR2A 4M5MA 2VJUA 1KTQA 2BE9B 3LO3A 2ZH8A 2ZEJA 3MEEA 4MK9A 1SJ4P 3L9ZA 1Q16B 2B9XA 1C2PA 2D1CA 2BZ2A 3PR5B 1DQ8A 2C2ZB 3R6LB 3JXOA 4ECSA 4K5SA 2I5JA 2J7UA 3KLIA 3MCOA 2LKZA 1FRKA 4GKJF 5ADZA 3LUYA 3NAIA 2YWHA 1FKAF 1HR0F 1R0AB 1S72S 4Y65A 3VVUA 3M9MB 1U1NA 3RBZA 3L09A 2FLOA 1T7PA 5C5JA 2W2MP 2IBOA 3Q0AA 5FIIA 4C8MA 2XQCA 2CZ4A 3M8SA 2E7VA 1HD1A 5KOXA 4L3KA 5C7PA 3ZTQA 1O8BA 1PBAA 2XYGB 5J1NA 4JYAJ 3A12A 3VGUA 5CH7B 1D3WA 3TOQA 2KYZA 5LSOA 3LH2S 4NYOA 2ZOGA 4JI6F 2HWIA 4TN2A 4NCBA 1IBMF 2VASA 1WUUA 3M8QB 3BBCA 4XK8C 3C66A 3Q89A 5JMNA 1Y9OA 3HVWA 4YB7A 4RUAA 2YBVA 5T14A 3IBCB 3E2EA 2P9CA 1AB8A 5A8KA 4ECQA 3OL8A 5HAOA 2PC6A 1S7HA 3DHXA 1HPZB 2HNZB 2RS2A 3PCOB 1OQ3A 4AYBD 2Y1LB 2XGQA 5K9FA 2EWHA 3GMGA 2EBGA 2HRTA 2MZQA 2ZZTA 4NI2A 4WZMA 3HJFA 1Y5LB 2PEHA 4ZCIA 2HBQB 2ZVIA 4LR7A 1SKRA 1S6OA 1IKYA 3FDSA 4J9PA 1J2VA 2X51A 3G6VA 4YB5A 3OFHA 3GV5B 2WAQD 1HWJA 2PA3A 2MMYA 3OD2A 1VIXA 4LUBA 2CNKB 2HAFA 4CO3A 4P52A 2ZH5A 2B9EA 1PG5B 3KMSA 1N6QA 3WC2A 2BANB 4PQAA 3Q22A 4X4VA 1GXTA 4CYUB 2IRUA 2BW7A 3WZ0A 4K7QA 4UY8T 3IGVA 2WONB 1OSDA 4KAIA 4KPYA 2WTFA 2L9WA 3NGSA 3M1VB 8AT1B 3OUYB 2W4DA 2OEJA 2V4RA 4LR8A 4FF2A 1UFWA 4USKA 2ZH7A 2NSCA 3ZTSA 4JI4J 2ZVSA 4LMZA 3BYPA 2IHR1 2ZC3A 4F26A 4IOCQ 3W9JA 1GK8A 1B7FA 4Z7CA 4PWDB 1BQNA 2OFHX 4Y2KA 2FGOA 2NXEA 4ER8A 5F3ZA 2CUYA 2J8AA 4OYAA 2H3EB 4ZJLA 2LQ8A 1TVRA 3W62A 1E6YA 1WEYA 2G2ZA 3IAM9 1QJHA 5T41A 2W7AA 3I55S 2EI5A 3CMES 2WBMA 4OMFG 2NUUG 2RDJA 1RTHB 1ZZNA 1T3OA 4DR4J 3UVJA 3HFZB 1FCAA 1H2UX 4RZRA 4P6QA 5J1EB 2PI8A 2M2BA 4DV2F 3GIKA 3KYLA 4JI7J 1G7CB 3HPOA 2F9DA 1AFIA 4NA3A 2WB4A 4KHPJ 4I69A 1TMMA 3D66A 1C0TA 1Q53A 2VFTA 2ZJQS 2BE7D 4URSA 3TW0A 1SB6A 4LRDA 2NXNA 5JJBA 2HHUA 2ZBRA 3MR3A 2F9JA 4O3OA 3RR7A 4ED7A 3A13A 2L48A 2P8IA 4KGXB 3VAIA 4YN3B 4DLGA 4H3SA 3GFZA 1N5QA 5ETNA 1BD6A 1O0CA 2G13A 4F67A 2XO6A 1VLOA 3FJ2A 1PAUB 4DF8A 2VJVA 2MZRA 1UPPA 3JSYA 2C3YA 2J9DA 2ZH3A 4J3CA 4ECUA 3IS9A 3PW4A 2GVDB 4DQQA 3W8GA 1YZ7A 1D09B 3GIMA 5KT5A 1HI1A 3OW2R 3P4UB 2UV8G 3AD9C 1D8YA 2KT5A 1T02A 2EFPA 4ZPWR 5LXYA 3E8OA 2FIUA 1S0VA 1X4GA 2CZ9A 3MCMA 1NUEA 5D4OA 1ICEB 1VBYA 3CJKB 2OPQB 2GW8A 2GVZB 1PYOB 3RR8A 4G6VB 2WVEA 5DO2A 5FDLB 2OD6A 3MF5A 1Q81T 3THTA 4F4XA 2CJ9A 1H98A 2HHHJ 2XLKA 3TANA 4O4GA 3FUYA 1OO0B 1NJYA 4F36A 3V81A 5HL7Q 1LEOA 4JYAF 4KO0A 5HO4A 4RNOA 1VFJA 2B9WA 4O3NA 1P9YA 1S4FA 2ADCA 4RO0A 2G5DA 3FK4A 2IYGA 2AGOA 5L1JA 4K4ZA 4OI3A 1W7WA 1VOMA 4B9VA 2YWWA 4NE9C 3I82A 2BVZA 2EKYA 1YI2S 4C8ZA 2F5GA 4DV5J 1O0BA 2HHVA 2W7PA 2BMBA 4CLTA 2DISA 1G4CA 1QRTA 5D0GA 2LXUA 2G9OA 3PYFA 3TUJC 1RT6A 4IO1A 4Y3CA 2MGZA 5ETOA 4WK3A 3BREA 3KLEA 3JSMA 4O3RA 1HL6A 4FYDA 1UZDA 2FVSA 3MPDA 2XMUA 3KJVA 1YWXA 4IYQA 4B9SA 4F2RA 1KFDA 1XR5A 5DZ7A 2VV5A 1RUSA 4K4YA 1RT7A 1SH2A 5EWEA 1REGX 1S99A 4NEZA 5HATA 5C42A 2Y0BB 3IR5B 5J2QA 1BGXT 2O5DA 2RMLA 2DB1A 2NCKL 4LF1A 1LK5A 2GO8A 3QGGA 1NSKL 3G6YA 3Q24A 1VQ8S 3MM8A 1N8RT 5D3GA 1FXRA 1S97A 3H25A 2YQ0A 1YJ9S 2HYIB 2AJ1A 2H51B 3CWJA 4IFVA 1PYTA 3U1NA 5L1LA 5BNZA 1HBMA 3F56A 5A8RA 2BW2A 1UTAA 3BH6B 2M5YA 2MY8A 5J1PA 4JI4F 4NI2B 2YH0A 2AGQA 4EBCA 4KR0B 2Y1RI 1X4FA 2AV5A 5KTQA 1IKYB 1HLWA 5H1SV 2O1PA 3K17A 1TL5A 3BN7A 2XLJA 2VA3A 4WFBQ 1PYSB 2HNDA 1N6QB 4OFZA 3VALA 1U4BA 4OHXA 2XGPA 3LWLA 1UEKA 4NLUA 3BKUA 4I2QA 1X4DA 1PAEX 4CT9A 4DR4F 1S7IA 4FF4A 3NP5A 4F3OA 3PY8A 1B4SA 3EZOA 3V4IB 2ZFHA 2Z30B 4WKRA 2ZH2A 2H4YB 4JI7F 4PXEA 4XPCA 4USVA 3FFIB 2LLZA 4KHPF 5CHCB 3GP9A 1HBUB 3WIUA 3VHQA 2M9KA 3IWNC 3IA0A 1NDPA 1U26A 4KGZB 2BJEA 3DLLQ 3RBEA 3ZC4A 1DURA 1RAEB 2B4VA 1M1KT 3KK2B 2IRXA 1TVRB 2I2YA 3NS5A 1WD6A 4WCEQ 3HHLA 4K2XA 4WP3A 5KG1A 1RWPB 1IXKA 4KYZA 2RQ4A 3KHGA 2OH2A 4Q8FA 5K5MA 2FJBB 2OKQA 5KT2A 3A8IA 1CQMA 2HGMA 3UVJB 1M1HA 5EUHA 5EGYA 4DF4A 2DJWA 2GA7A 3VAFA 4DR5J 1C4CA 1NHVA 4L76A 4ECXA 3FQKA 1KOOA 2V2VA 1QTQA 4TKTA 2KT2A 1R6YA 4OI1A 1WDDA 2HGNA 3TQ1A 4ETZA 1LWXA 5KFJA 4CLFA 4ANCA 1QAXA 3M6XA 4OYBA 5LM7E 2V8HA 2XEXA 3S6EA 1NEEA 2Q43A 3R1LA 2MDAA 4IDKA 2C3MA 2ROEA 1RTDA 4X4OA 3JB9k 5DG9A 2QFIA 4O3SA 4ZS6A 5I42A 4RWWA 3JQKA 2RDIA 2XY5A 5KFRA 2XS7A 4U8VA 1GMWD 2MXYA 1YGYA 3NAHA 2JLGA 1SL0A 2HHHF 1S6QA 2X1FA 2V5HG 4OHYA 1U1OA 3A8KA 5GAEU 3KUGA 3D5MA 4YHHJ 4NLGA 5CZVA 1RAHB 1DY3A 1UPMB 2Y1IA 2FGCA 3NXZA 1VC6A 2M70A 2PEBA 1OWXA 3KW2A 4LRAA 4DSEA 4Y0FA 4WYWA 3D4JA 5LJ3Y 1VJQA 2AX1A 3DU5A 1XEZA 3PRDA 5BYSA 4ETXA 4PG5A 4DV5F 3SYZA 1I6JA 2AT1B 3K58A 3MCNA 3HHNB 1FDBA 3CJ3A 2MQPA 1WC5A 3GWCA 4DFPA 1JLCB 1FI4A 1F1BB 3Q8QB 4RW9A 1V9OA 4NLRA 4WXWA 3LANA 3D0IE 3TYTA 5HVHA 5U47A 4OJHA 1I51B 3PVXA 4O4GB 1UW9A 4LIRA 3J7A1 2HVHA 4KO0B 3QQCD 4X4PA 3HXMA 3BPDA 3RB0A 1UP1A 2BM0A 4EWTA 2CDRB 1KNZA 2B9YA 4HLBA 2ATCB 1QSLA 1FEEA 2G2OA 4OZJA 4K0KJ 4MMOA 3I4PA 2QL9B 3QFWA 2MQNA 5F8HA 3MD3A 2DNQA 4DPXA 1X0FA 3E51A 1YITS 1VYAA 1H2TZ 4U67Q 1VC0A 2RUGA 1XN9A 2R8IA 2Q1LA 3W8PA 2YNHA 2DIUA 2YKMA 5CQGA 1BWVA 4NMLA 2IJNA 4YDXA 1NK7A 5KG6A 2GMJA 3KG4A 2IMWP 4XTTA 1RT6B 4DCJB 1KHWA 1TR0A 1XQIA 4MKYA 4DX6A 5KT4A 2ATLA 3M4XA 4CRJA 3H59A 5AXNA 3WX4A 2DGVA 2BV3A 2DRBA 4ILRA 2DHSA 3EDRB 3BH7B 3RAXA 2ZJPS 3HZGA 3IAS9 4I4BA 3KJVB 2HIQA 4E8UA 3OL6A 2QE5A 4P2MA 3GE9A 1WF0A 2YKPA 1XMOJ 2IY5B 3TWZA 4BWMA 1RT7B 4AFFA 1Q7YT 4YR2A 4H4KC 1U1MA 3D6TB 4IR1A 2HK2A 5C42B 1G3OA 4J9LA 2UXDJ 3RRGA 3W1YC 3Q8UA 5HBMA 3O5TB 4QQBA 2CWXA 3J81U 3KUEA 1DQAA 2DGUA 3I5AA 1VQPS 2OO4A 4WF9S 5D3GB 1YJVA 2ROPA 1KP6A 2FDNA 2Y9HA 2NS1B 3L7PA 4IFVB 4QIFA 3QWPA 2OSQA 5KG4A 5AXKA 2DITA 4QIGA 4TNOA 2Z57B 4RNMA 2W8KA 4M5LA 3FEZA 2R7UA 5EWFA 2ZWPA 2QMXA 1TKZB 3H4DA 2IYIA 2W8LA 3J80U 5C24B 4ZVSB 4DI6A 2QL7B 5DZ6A 2CWKA 3SBMA 3R9LA 4QYZK 4CTAA 1WEXA 2CKWA 2R7VA 3AOCA 3DFEA 4LBPA 1T03A 5DDPC 3DNCA 4WJBA 2XMAA 1T94A 1GMVA 5JVGQ 2JC0A 4C6AA 2AGPA 4C9DA 4I2QB 1U02A 4DSFA 3EXCX 3ZNJ1 3QRQA 3PRBA 4P7VA 2CVIA 2IVMA 4KQZA 4A48A 3TNVA 4DR5F 2W2QP 3U27A 3IRWP 4QIWD 2YNFA 2LEAA 2KKHA 2X3DA 1FVSA 3EDQB 4WFNQ 1ZA2B 2XYHB 4P2SA 2MKKA 2PSZA 1RAAB 4XPEA 2XG8A 5KFIA 5HANA 3KUHA 4MYUA 4AE5A 4KBIA 4V1Ak 1L3UA 3FEXB 1C1CA 2Y0SD 3V2UC 4F8RA 2J9EA 3UE2A 5H9FJ 3HHLB 4YY3J 2CG4A 4CT8A 3EPGA 2JVRA 1PCAA 1HMVB 1M5HA 1JB0C 4DXLA 3G4SS 3HSJA 3R2DJ 4C7QA 2QMWA 3W63A 3DC2A 2FPHX 4M1KA 3FSXA 3MEGA 1A9NB 1RTZA 1VRUB 2APOA 3FEYB 4KH0B 3PW7A 1QDUB 3MM9A 1UJ4A 3VGTA 2RJZA 2QA4S 3AXMA 2KXNB 1M5OC 3TI0A 1TL3A 2RH3A 4YHHF 2CRLA 1N36J 2EG2A 3K5LA 3V6HA 2JSXA 2DGTA 3FSYA 2ZNZA 5EX3A 1R7IA 2PFDA 2W4PA 2KVIA 2GX8A 4IDKB 3HD1A 2EGWA 3H5YA 3ISND 1V3ZA 4NOHA 2ZM6J 1HBOA 4O3QA 1LWEA 1VHIA 3H20A 2FHKA 2A3JA 2CNOB 4DOZA 2CX8A 1F9EB 1U0HA 4LSZB 4CO1A 3TZXA 3J7YI 1CEZA 1NU4A 2KG0A 5K20B 3EGWB 1F9FA 2ZBCA 2DY1A 4MK7A 4J9KA 2XWYA 5AE2A 5B09A 4XAKA 3AJ2A 4L6V3 5DM6S 3HO1A 4J5OA 2YNGB 4P2BA 1BQXA 3G6ES 4K0KF 2FLLA 2CIMA 3CNQP 1F60B 3VAMA 2ZZMA 4LBHA 3M05A 3OL9A 3CT9A 4DBQA 3ZNUA 5KFAA 5AXLA 1WSRA 5A2QU 3EVWA 3V6DA 3BYRA 3PO5A 3AIIA 3PHTA 4I6YA 3IG1B 2GQ2A 3SSRA 4E98A 2FZCB 1YBUA 1WG4A 1JX4A 3N28A 3W2WB 1GTRA 4PXCA 3DGPA 1RHUB 2IMOA 3IRXA 2VUGA 2HBZB 4IH5A 4C8YA 3W9IA 3NKYA 2HHTA 4TU7A 1XMOF 1N5SA 1N32J 3L4BC 2R2TA 2XWXA 5K8NA 3VZHA 5KOWA 1HNZF 1FVQA 4ZITA 2JZ5A 4I0WA 2JH3A 4PXDA 2UXDF 1Z2ZA 5GAGI 4ZP6A 4G1IA 3KK1B 1XNQJ 3LWMA 4R0JA 2PI5A 4DS4A 2YNHB 4ID5B 3LGHA 1GTHA 3AOBA 1T9UA 3HF5A 3N5FA 3RRKA 4IUFA 1I5OB 1EX8A 4HI2A 3Q8YA 1R8PA 4IG3B 3OVSA 2VPYB 1Y3JA 4EEYA 5HROB 1UWBA 3GIIA 3VF0B 4WFYA 4G3IA 5A6WA 2XO7A 2AEFA 3QT5A 2FVCA 1QLNA 5ETQA 1GNKA 5E3PA 3W2VA 2AX0A 2LU1A 1VQSA 5L39A 2EK6A 3N4WA 3GG1A 1XERA 9RUBA 3QT8A 5HBMB 1NSPA 3QSYB 1S1XB 2FHMA 4HHJA 4DQIA 3DRPB 3MUVP 1X9SA 3QRPA 2ZE2A 1QUPA 3TUPA 1BY9A 3OTCA 3NOCA 3OJUA 2ZOFA 4DS5A 2ASJA 3MTJA 5D4NA 2B56A 4I56A 4LQ9A 4WXOA 2N3OA 5KFCA 2YPZA 1XR6A 2PICA 4RR5A 1UVIA 3MM5A 1T9YA 5D6GA 2CFXA 2DO0A 4KV8A 3DI6A 3A8EA 4CQ1A 1GTSA 2BQRA 1RGVA 5BXIA 5LSRA 3MECA 4ZPAA 4ZVFA 4N77A 5SZTA 4CTAB 2ZBQA 3W3SA 1RBLA 2VOOA 1VQ5S 1QAJA 1ZETA 1RYRA 2B4UA 1IR0A 2RHQB 5GMKa 1S1WA 5AE3A 4YY3F 1YDLA 1R3NA 3B8HA 4JI2J 4DPWA 3J7YU 4Y2CA 4IG0A 3FBBA 4NLTA 3PDNA 2XM3A 1ZH5A 2VODA 1WC1A 1YJTA 5KG2A 5J2MA 3I9V9 4F02A 4ATNA 4D3HA 4B3SJ 5D8HB 4J9MA 1G6BA 1NRKA 3FZ2A 3M9NB 2YNFB 2V2QA 5B0GA 5IQQA 1P9QC 1YLXA 5LSLA 1Q8BA 3V6JA 1MLAA 3SSSA 2BE2A 1N36F 5KG3A 5KAKA 3P5TL 4JYZA 2R42A 2G0IA 4U8YA 3NS7B 1U6BA 1GX5A 3RB6A 1C1CB 2ZWOA 3AA8A 4I64A 4IQXA 1WHYA 4A4JA 3W7BA 2XMMA 4BS2A 1AUDA 3HSDA 2G6GA 3ZZPA 3HJVA 2ZM6F 1FD2A 3FCWA 1L5UA 2VONA 1EAYC 3A3NB 3MEGB 3G86A 1NSAA 1ZYQA 1REVB 2BUNA 3UN2A 2OPPA 4J90A 3E3XA 3O6QA 2NXJA 3MM9B 4AXIA 4JV0A 4ELTA 4WP9A 4DL5A 2KVQE 1NO8A 2V8VA 4J91A 2LXFA 2IVFB 3CCTA 3BR9A 4GC7A 3GZ7A 2PD1A 1Q86T 1EIYB 2HHXA 5GAGU 2XMTA 4B9TA 2HHPA 3M8YA 3ULHA 2A10A 3FCVA 2AYEA 3FRYA 1PJ5A 4NLXA 2FHJD 2RKIB 1JXEA 2HHQA 1IQTA 3IMQJ 1SQEA 2X1BA 1YSJA 3BDEA 1TTHB 2CQBA 2YNIA 1VQLS 5K8PA 5F8MA 2F65A 1HBOB 3Q8RB 5F0UA 3N6MA 1LWEB 2YY3A 2H5JB 5DDOC 1CG2A 4P75A 4MKAA 2C3OA 4A8QA 3US5A 1ZA1B 4XO0A 3H2VE 3NWGA 3EJMA 4KGKA 1FFWB 2ADBA 1AZSB 4USIA 3ZFVA 2GNKA 3DOMA 3CO0P 4OYWA 4G65A 1VS3A 2AJQA 5ETSA 4QOTA 1JLFA 4ECRA 2GGPA 1KQSR 3U1MA 1OYEA 4M5KA 2LQBA 1GXLA 3WHIA 1N32F 3BV8A 2DEIA 2W1BA 1Z85A 2GHVC 3MCSA 3UPFA 1QAIA 2BEFA 3DLBA 3DRRB 1FNXH 1XNQF 2PMZD 3MAQA 4DQRA 4AL6A 3TX0A 4MAKA 2UVWA 2RAQA 3BGUA 3LGNA 2QC3A 2XCPA 4A8OA 2AU0A 3HHLC 2LA6A 4WYLA 2KI2A 4ZVGA 2UZAA 2OGUA 2CNNB 2R3VA 3IRXB 4ZIWA 1SJ1A 5F8LA 3DLLS 2MZJA 2K3IA 3ILOA 5A8WB 5L1IA 2P6TA 2PGCA 2JHEA 2JRSA 2V2KA 5DQGA 3QBCA 4RBUA 1K44A 3PR4A 2N4DA 4PUOB 2UV8A 4RBVA 2E9ZA 4ZLLA 1K9MT 4URGA 4ZP9A 2VC0A 5KFUA 1HNWJ 2L08A 4I1TA 2ERRA 2XYPB 4DPTA 1HW9A 1OQ6A 5IM0B 1RT2A 1AW0A 1JLEA 5IS2A 2MQLA 1U2CA 2DNMA 4ED1A 3PIPS 2NYHA 2E5JA 4C4WA 4B3OB 3CCZA 3LA0A 1UW4A 4USTA 1VBKA 4B3TJ 2HVEA 4OQJA 4C8OA 4B3MJ 1U48A 4X62J 3ITHB 2ZUAA 4DSKA 1IQZA 4KHMA 1FRIA 4Q45A 3MMJA 1D0EA 4Z37A 2W24A 4ED6A 1VQKS 4F3QA 4PAAA 2VG6A 4OZ5A 1GMWA 1NH7A 2DGQA 4RLEA 3TQEA 2ZJQQ 4RNHA 4WIIA 1K8AT 2FJAB 5JVHS 2VZ9A 1YJUA 2RQCA 2DNYA 4JI2F 3LAKA 4ERDA 4ZCKA 3OFFA 2OFGX 1WACA 2HZCA 1RHMB 3ZZYA 3L3CA 1FNOA 1RQ0A 1HW8A 2IAJA 4B3SF 3NGRA 3MM5B 1RT5A 5IT0A 3MEDA 3DI6B 4X4TA 3O2IA 4DX5A 2PE8A 1NK8A 1FFSB 3MECB 2I6WA 4DL7A 3D2WA 4NZ7A 3H5XA 3AAWB 4V194 3M6UA 3ILIA 3QATA 5HQLA 5D15A 3KNAA 2VIHA 3GJQB 2RQMA 3UQSA 3AY0A 1UKUA 1WC0A 3SV4A 1RWKB 2RD5C 4EFAC 3KNGA 3ETMA 1VBXA 2QG9B 2DTJA 2K7KA 3PTWA 1JLQA 1Q82T 2IC3A 5KT6A 1IKVB 4USWA 1ZZFA 5H9EK 1RLDA 2H48B 1DTTA 1I3OB 1GXUA 2OAUA 3VR1A 4ZP7A 3UDVA 3DLHA 5CZXA 3PFEA 4QBUA 3MAHA 1UFLA 2VBWA 4ZCMA 2UXBJ 5KFYA 5E3AA 3SDEA 1KS2A 4RJVA 3LP1B 4QW8A 1AFJA 4IKAA 3FBFA 1RWVB 2MKYA 5KFQA 1NLKL 2I0XA 4U7CA 1S4EA 3NGTA 1UEUA 4W4MA 3G8QA 3Q2SC 4P72A 3V5RA 2DNLA 2CAJA 3PJWA 4OI2A 4FS1A 3QGIA 3W5XA 1RLCL 3DOLA 5C2GA 2OPPB 1YTYA 3SI8A 1SUQB 2LFVA 1RT3B 5I3UA 3MR7A 3M32A 4HVZA 1IBCB 3H4BA 2OHDA 4KC5A 3DYAA 2LA4A 4Y00A 2V94A 2F4FA 3BO3A 1LKZA 2GQCA 5CD4H 2BX6A 5CYQA 1F3VA 3VGVA 2CG8A 3OHAA 1FA0A 3KDOA 4DV1J 3TUIC 2NWAA 4P9SA 1WELA 4J9SA 1YJ7A 2D9PA 3MWBA 3SCIE 3UR3C 4M63A 3C14A 4F4WA 3DDIA 4CO5A 2FYXA 2VA2A 4PG4A 3TAMA 2BKPA 5RUBA 3I31A 2FLPA 1FNMA 4DN9A 2ZZNA 3IC1A 1WI8A 3DOMB 2CA9A 1NJIT 3IXQA 5GMDA 2MKSA 3LPEA 1CBKA 3G87A 1JLFB 1W2BR 4ZN1A 1SIWB 2C2RA 3PKMA 1U2RA 1X60A 4DHVA 4U7UK 4X4NA 4ZOSA 3M2VA 3I87A 4PR6A 1EETA 4C3KA 4EI2A 1HQUA 5L1KA 3MOZA 4DUYJ 5LOQA 4DCPB 1RYSA 1K0VA 1VGYA 1IR1A 4IQMA 4C11B 1HNWF 4F04B 3QLHA 1PILA 4KSEB 5HVGA 1H6KX 2YKAA 1T9WA 3AB4B 1ZM4A 4JI1J 2DNOA 2C2DA 2VG5A 4USMA 3MPYA 2H54B 3MMCB 3HT3A 3GSDA 2W25A 1EUYA 3TA1A 4CDIA 1U1PA 1LV5A 4ZLNA 3BGFA 3ENVA 3WIVA 2LQJA 5ETVA 2PN6A 3M2RA 4GVBB 4B3TF 3UI3A 2M4MA 3BS9A 2B0GA 4B3MF 1VQYA 2ILYA 4RW4A 4X62F 1SIZA 3EGNA 2OMOA 3VAKA 3TX8A 1UA1A 3RBXA 2R4FA 4QWCA 4OV6A 1VCTA 3GYNA 1R0AA 1NJXA 2GO9A 4GMKA 2HSEB 3BGLA 4CLKA 1MN9A 3SQGB 3JTOA 2JFKA 1K1SA 1RT2B 5AXMA 3HHKA 1WTBA 4YOEA 1ZM9A 3GONA 4GVLA 1N5YB 4HH1A 1K0TA 4YB6A 1RXOB 2UUTA 3PJ9A 3QJJA 3PW5A 1R27B 5L8RC 4LFCF 4N76A 2L9NA 4EZ6A 1KKHA 2DH8A 2BOPA 1S9FA 1YKWA 4KGMA 2VFVA 2UP1A 2E66A 1VHKA 1X4EA 1KVKA 3JQJA 3JTNA 1RJJA 2MHNA 4RWXA 3W9HA 3J7Z5 2WSEC 1N5TA 1RWUA 2G1DA 4N5SA 1FX2A 1RAIB 3EGVA 4NA1A 5CCMA 3RAQA 4LF4J 1NCLA 4QWEA 4U96A 3J7ZT 1HPZA 3SEOA 5IC6B 2NYIA 3QWUA 2EC2A 2LDYA 4YR3A 2JWNA 2Y3YA 2IAJB 3TVZA 2LEBA 2E29A 1DRZA 2HFOA 4OYZA 3IBWA 4DSJA 2X1AA 4PQUB 3KLFB 1X0PA 4RW6A 2A0FB 1S59A 4B9NA 2XSFA 3U1LA 4JI6J 2UXBF 4JXXA 4UOFA 3ONQA 3DLGB 4OJ1A 2LQ9A 2KG1A 3GQCA 3I5BA 2DH9A 2C22A 4A8SA 1R6VA 4KRWA 3NMAA 2NXUA 2CDQA 2W2PP 5C2CA 1X4AA 3VV2B 2WONA 1X4CA 4OL8A 1TZ0A 2CQGA 1NDCA 2DCLA 3GYXB 3L95X 3CZBA 3M1VA 5F8IA 3NGDA 1JLQB 1NPKA 3OUYA 2IC3B 2YQ1A 2PIIA 2I8EA 3M8PB 1UVNA 2GJFA 2UXCJ 2MQQA 3PNIA 5KFPA 1JMTA 2H5IB 3NNAA 2KRRA 1HYSA 1R89A 2HKEA 4MH8A 1K1QA 2R9LA 1HQEA 3EYZA 2BQ3A 1RTJB 3SDEB 5F8GA 5EN1A 3I9ZA 4DV1F 1VBZA 2VICA 2OPSA 2DNNA 1SVDA 3OFGA 3TA2A 4DL2A 2EXUA 3KK3B 2R2SA 2I1RA 3T6JA 1T9VA 2XTJP 3I0RA 4B17A 2FC9A 5I3QA 1RTHA 2YX4A 2W2NP 2N4CA 3DOLB 2OI2A 3DOKB 4KFBB 5J1EA 4IOAS 3M32B 2DEJA 1L3VA 2RIJA 3DYAB 3IM9A 1TL7B 4ICLB 3L7UA 4HT5A 1SJQA 2XZWA 2ZJPQ 1N33J 4DUYF 2R7RA 4OV1A 5F3TA 5L38A 3C8YA 4MT1A 2KFYA 5C25B 4DWIA 5F8NA 4JI1F 2PJJA 3PYEA 3C14B 1FRJA 4EO6A 1CPZA 4HHUA 2DNRA 3C16B 4QPXA 1RWXB 4WF9Q 3UWTA 1B75A 3PX0A 2Y1JA 1UA0A 4RL1A 2BOAA 2GVDA 3KLHA 4H4KA 1WORA 1APSA 4X2BA 3X1LB 4L75A 3M2VB 3NOGA 4CNZA 1Y5NB 4J9QA 3GIRA 3KG1A 3HMJG 3CD0A 5F41A 3V4MA 1NYLA 3QIPA 2RDDA 3CJKA 3UCUP 4X64J 2XB2D 3IFEA 2OMLA 1Q1KA 3PJXA 3TEGA 1VQNS 2OPQA 2FVPA 4GO7X 2GVZA 3QLHB 2VQEJ 2HS0A 4LRCA 1TFYA 5T7LA 4L74A 3PW2A 2VG5B 4P7TA 1HI0P 2MKCA 4FKXA 3C6UB 4D3GA 4EMDA 3BJYA 1PSDA 2ZHOA 1VQ4S 3UDEA 2JEFA 3PXGa 2G0JA 1TKXA 3M2RB 2DCUB 2SXLA 2QMUB 3CCMS 4ZKAA 3TO8A 2ACYA 3A3OB 5GAHI 3QO9A 1WDTA 4EYHB 4ZPBA 4RW4B 1ROFA 2K2PA 4KH1B 5IOLA 4IOBA 4Y2IA 4DU8A 3VGSA 2QLFB 2MHEA 4W98A 1FK9B 2U1AA 1D1UA 4X66J 2HZVA 4ENOA 2Z2LA 4LF4F 4A46A 2PI4A 3DRYA 1H7XA 2KFZA 2B3TB 2DT9A 2ILZA 2WZ1A 3DCAA 4PG6A 2CVEA 5JUMA 1UVMA 5GAGW 2FUG9 2MKJA 4ES3A 2ZKTA 5IV3A 2FHJA 2DNGA 5EX0A 2E1AA 2H65B 1M1GA 1S6PB 1EUQA 2IJFA 5B0EA 2JVOA 3NG8A 2F4VJ 1NXZA 5KFEA 1R0BG 5J2PA 3ENWA 4NCAA 5G4DA 4DN0A 1NK5A 2ZJRS 2QIFA 2R8KA 1BC6A 2XMWA 1FDNA 5A76A 3F0NA 1LXNA 4A8KA 2HNYB 3ZZZA 1TP7A 1X5PA 2M88A 4UQTA 1UJ5A 4OI4A 4BLGA 1J5EJ 3BQ2A 1GEHA 1RBOB 1RBAA 5MAOA 4UZBA 4JV1A 2HPUA 4TLRA 4IO9S 1U8WA 2UXCF 3TRGA 4U9RA 3EMTA 4MKBA 2AE0X 4JP8A 5CAAA 1YIJS 2ZD1A 1J5OB 4RW6B 1DAXA 2NREA 3AQPA 2LQ5A 5KFGA 3TJ8A 1YG0A 3BPSP 4DPYA 1F6TA 5DM6Q 2LDIA 2Z2YB 2UU9J 3Q83A 1ZBTA 1CJUB 4NYPA 3CMAS 4UY85 2RNEA 3MTKA 1TAUA 1JQGA 1FHTA 3H2UB 3DRSA 1RACB 1Y4ZB 4OHVA 5BYRA 2FC8A 4R5PB 5D0EA 2EFNA 1FEHA 3AQOA 3UNYA 2QLBB 1H73A 3AJDA 4C8LA 3V4IA 1KDNA 3FQLA 1AYEA 1VQMS 3DMJB 4OLOA 2CQPA 3FFIA 4K59A 3HX9A 1HYSB 1HBUA 2A1BA 1HQEB 3C6TA 1B0PA 1FERA 4CZCA 1H74A 2V63A 4UF4A 4ZLPA 1N33F 3KK2A 1HNXJ 3GG0A 4RNNA 3WDOA 2OPSB 2VF3A 1N54B 3ZXWA 2W9CA 3T5HA 3DU6A 5CCLA 4DR2J 4OYOA 4DV0J 4MTPA 4NCGB 2LVWA 1X4HA 2YKOA 3I0RB 1LNQA 1JLBB 3R3TA 4OHWA 4LF5J 1KR4A 4YP3A 2V69A 1AROP 4UUWA 1IVZA 2C42A 4LT6A 1X31C 4FPIA 3BEGB 3M6WA 1FTCA 4K2JA 5GAHU 4OX6A 1JNRB 2AW0A 1FESA 3ILLA 3SV3A 3QAEA 5ETRA 2R8GA 3N6NA 4LIWA 1F3FA 1S57A 3VAHA 3QIDA 4DR3J 2Z2ZA 2KZZA 3CCVS 3N6LA 3OV7A 4OJ3A 2WK4A 2E7XA 4X64F 3SZ2A 1WC3A 4DUTA 2NZ4A 4ED2A 2M7SA 4WIQA 3PIOQ 2MLYA 3TZWA 2VQEF 2QA1A 1HHQA 3LALA 4WWSA 3DLKB 1KQKA 2Q3PA 2W9AA 4OZNA 4DFKA 3MHYA 2B4OA 4N7TA 2AJ2A 3CCSS 1E6VB 3ZTRA 1HNVB 2WVDA 3LOUA 1SBRA 4PZVA 4QYZJ 4ZVTB 2MZTA 3LAMA 4E0DA 2G2YA 3KLHB 4ZPDA 4O44A 1M5VC 4F4ZA 3CEDA 3G8SA 3UD4P 4ES1A 4KJIA 3GCWP 1U09A 1S1UB 4ZK7M 5DG8A 1QRSA 2HS3A 3QMQA 4ZPVR 3QIPB 2XNQA 3FVYA 2BXJA 3G6XA 2DPIA 1S9EB 4I67A 4L73A 1EKRA 4P73A 3AT1B 4X66F 5T7LB 2V6AA 3O1LA 4CP5A 2VB6A 1JLCA 1K73T 4DMZA 4A8FA 2HHSA 2IJRA 5CA5A 4MKVA 1EJ7L 1D9DA 3MM6B 5F0WA 4AD6A 4I6AA 5JXSA 2KHDA 1M5PC 1TKXB 3CC4S 1IM6A 4QWBA 2DBBA 1QTNB 3QO9B 5HLFB 4DV6J 3CF5S 3TZYA 2F4VF 3O8WA 4NXMJ 2KFNA 4P71A 1OPZA 2YWEA 4K4UA 3TAQA 3CIZA 3CSKA 3X3UA 1MN7A 2HQGA 1TL4A 5LL6d 3CGIA 3OTEA 1YRTA 3MAAA 2I38A 4Z2XA 2V2ZA 8RUCA 1U49A 3AH6A 4HL9A 3CW2C 4ILMA 2CJKA 3ENAA 1J5EF 2FVRA 2B5JB 2NPIA 4NWBA 2ZC4A 2HMIB 1BLUA 2MLXA 5KFNA 1DFUP 1FFGB 4WK1A 1RWMB 1CULA 2GHWA 4QWAA 4ED8A 3ZO7A 4KIAA 2Z4PA 5E3QA 2RQKA 4QR1A 1X9MA 5GAEI 2B6AB 2XULA 4BDPA 2DVIA 4M8LA 5J2PB 3BM7A 1HBNA 1WC4A 1UVKA 1MROA 3CJ2A 1VR6A 2MTLA 4ZIVA 2UU9F 4DR7J 4NZ0A 2CQIA 4MYTA 2DNPA 4C0HA 4Y34A 1D8ZA 4IH7A 2IA0A 4M5HA 3CJSA 4M5NA 1A6LA 1Q8IA 4PWUA 2HBYB 4NMXA 4M94A 2EEYA 1TKZA 4QZVB 2Q6CA 4DDFA 4RW8A 1W26A 5C24A 2LEPA 2CPFA 5KG7A 1VDHA 4LRBA 2ZD1B 3CDWA 1RADB 3OXLA 3NGKA 1TUWA 2DGSA 3H90A 1LWFA 3W64A 4USHA 2G1HA 1D9FA 5DLGA 3FNNA 1CLFA 2NLWA 5GVQA 1HNXF 1U25A 4FVMA 2F3JA 2HS4A 4LBIA 4DR2F 1H72C 2QYCA 3DRSB 1TV6B 4DV0F 2CQ0A 1RAOA 1FT8A 2NPFA 4USJC 4LF5F 5AT1B 2GMLA 4RUBA 2QSFA 1DJ0A 1SL2A 3G8TA 1Y7PA 2HQCA 1YZ6A 3NNHA 4LRFA 4ZLJA 4CIOA 1LWCB 2LCWA 3T1HJ 4AQYJ 1WHWA 3D9BA 3C6TB 1IWGA 4OZ3A 2CJQA 4DR3F 3Q8PB 3NWRA 4DQPA 4OYMA 2UUBJ 4Y2AA 3CB4A 4NLWA 3OR2A 1RHKB 1Q7LB 1UVJA 3QSIA 3JTPA 1QSSA 2C2KB 2XMKA 2W9CB 3ISNC 2DNZA 5HQ8A 4ZDNA 1HMVA 2YKNA 2PT0A 5KFOA 2HGLA 3SSQA 4G1QB 1VRUA 2FZKB 4USUA 2VFUA 2W9BB 3ISZA 1KQFB 4OI6A 5LJ5Y 5DQIA 2L9DA 4FDFA 3PIPQ 1TFWA 2GS8A 2VH7A 3PX6A 1FWKA 4ED4A 2BM1A 3OLBA 2Q66A 1TQLA 3W5ZA 4FBTA 1IKWA 4HI1A 3GCXP 4A8XA 3A3PB 4DV4J 3BN4A 2J9DE 4H4MA 4A8MP 4WKYA 4LF9J 3JQMA 2DHHA 5D78A 2CQ4A 3UN3A 1VJWA 2YXLA 3OVBA 4QJVA 2B4PA 3K59A 1WWHA 3CDEA 5JVHQ 3ZZUA 1FKOB 2AEJA 4DSIA 1QD1A 1WOSA 2ZDPA 4PYDA 1R8CA 2BQUA 1B64A 3TJ9A 1NSQA 4F2SA 3GILA 5KFTA 4ZVRB 1RB0A 1KSPA 2J0SD 4O44B 4OI0A 1EZZB 3KG0A 1YX2A 4DV6F 1NZAA 3CJ0A 2YNGA 1MWYA 5KFKA 3H2LA 3QNWB 4NXMF 2JEJA 1YRXA 1F5BA 2VPZB 3CC2S 3FSIA 4Y28C 5GMEA 2VBXA 1VMBA 1YBAA 4YR0A 3CD6S 1L3KA 3PV8A 1I94J 1EQ0A 2XC9A 2FJEB 2WCXA 3QZ8A 3EICA 4HTJA 5M2RA 3AOAA 4PG7A 3OFEA 3FCHA 3PKYA 3LPYA 2OPRB 1HA1A 1CC7A 2C3PA 4DR6J 2PNWA 2GFFA 2AMCB 3IG1A 4HH0A 3DN9A 2V67A 5KT3A 3CDAA 3W2WA 3KHRA 4WTOB 2LP4A 1CSJA 2DIVA 3BGRB 4KHRA 5FLXY 4FZVA 4I68A 1X7VA 3RZAA 2KZMA 5BJRA 3V6KA 2MJNA 3QGPA 2CNLB 5KFXA 5DETA 4ED5A 3HLUA 5HMZA 2HBRB 2HQIA 2AYGA 1FJEB 1KONA 1F0XA 3JAMY 4UQGA 4DR7F 5LMNJ 1JJHA 1UEVA 3KK1A 2HHWA 2KXFA 5ETMA 1PJ6A 1RCXB 4JI0F 3MAAB 4ID5A 1HKAA 3LW5C 4C0BA 1HQ2A 2MEWA 5THWA 3HVRA 1YRUA 1RZMA 4B08A 2R8JA 3LF0A 2VD3A 3MDFA 1SKSA 5HP1B 3PEHA 2BKNA 4IG3A 5HMWA 3PW0A 2OLWA 5HROA 5HI7A 4CLLA 3POTA 2KJWA 2CJYB 1CULB 4FYYB 4JI3J 2GIFA 3I56S 1HNZJ 4CLZA 4ECVA 2KO1A 2M52A 4J9VA 1HBNB 1MROB 5D0RA 4M5IA 4BC9A 4Q2LA 4ES2A 4ZHRB 2VKRA 1OMSA 1S1XA 1NK6A 2QO3A 2MZSA 4HEA9 2AHOB 3DRPA 3BSAA 1M5SA 2FY8A 1IJEB 2ZH6A 3T1YJ 3OPKA 9ATCB 2H4WB 3K2YA 3VWSA 2Z58B 2RRNA 3AB2B 3EE3A 1KFSA 3Q8VA 4M5DB 2MLZA 3GFHA 3NCQA 1X8DA 2EVZA 1QY7A 1R31A 1SV5A 4W92B 1DHMA 3CPWR 3I32A 1FO1A 4WU2A 4E8BA 1NK0A 4MJKA 4RW8B 2WSFC 2HLUA 1RHQB 2J7KA 1OPIA 3T1HF 3M8ZA 4NPOA 4AQYF 2CQ2A 3UNGC 1ZAWA 2Z8QA 4EO8A 1LWFB 1NJWA 1TKTB 2UUBF 4CM2A 2B8QA 1JWWA 4GC6A 4FYVB 1VQ9S 4CWBA 2MKIA 1B0TA 1HI8A 1JLGB 1EB0A 4YB1P 3CULA 1XBWA 2R7QA 2R2RA 4NA2A 4OIXA 3NCPA 3HDSA 5BR8J 1S9GA 4ANEA 4BHQA 2QGFB 2B8PA 1B3TA 2N7CA 4L72B 4K8RA 3KHHA 4YQWA 2FLNA 4OJGA 4AUKA 3HFKA 2C28A 2EC0A 3IWLA 4OX7A 1X5OA 2ABYA 3LTOA 3ZTPA 2Y8YA 4FF1A 2GC8A 2JX2A 3NS6A 5IT4A 2AYMA 5LXRA 4OYXA 1EP4A 2JJ4D 4DV4F 3OR2B 3BKTA 4AL5A 3GJSB 4LF9F 1DTQA 4UW2A 3CTRA 3H5UA 2K7JA 4C97A 4I6WA 2V8DA 1NPPA 2YKNB 2W2OP 3HHEA 5E0OA 2LXIA 2F40A 1B99A 3HULA 2PMHA 1REVA 1N0VC 3EPIA 2KTQA 4FS2A 5DRKA 5ETKA 3FRZA 4N8NA 4FXWA 1VQ7S 3M9OB 5G0RB 1QE1A 2VPWB 1S48A 1IKWB 2RKIA 1EXDA 3OSPA 4B9UA 2OIHA 4H4MB 3M2UA 3BBFA 4ZCLA 2MQ8A 1I94F 1XTZA 1IBKJ 4DCOB 2DR6A 4ZVHA 2HURA 3PFOA 4P2XA 1RU2A 2ZBPA 4C98A 4OHZA 3GV8B 2DYAA 1VK8A 3JSRA 1T9XA 4DR6F 1AZSA 1S6UA 4DU7A 3IR6B 1SL1A 3MMAA 1A7GE 4HACB 2RU9A 1JJ4A 1NNDA 1X5TA 1XR7A 4NZ6A 1Y0HA 4ZA1A 3CVKA 1RE1B 2LMIA 4KY3A 3G9CA 3F41A 4FKYA 5L9NA 3D0HE 3CJRA 1Q78A 1Z4UA 3QAUA 3MMBA 4HTIA 2EGVA 2J6TA 5LMNF 5HSPA 2AP6A 3DRRA 3OL7A 1BQMB 3FBCA 2AIRB 5H9EJ 2FD2A 1KLNA 3HVTA 3TA0A 3TEHB 2POKA 3CCWA 4DV7F 1BWEA 1QTMA 2MPUA 3JS9A 2JOQA 2QSWA 4OZ0A 3H5SA 5DQHA 2QRRA 4PPDA 2MSTA 2CXEA 3UCZP 4AL7A 1W2IA 2FJXA 2R7OA 4OYPA 4ZVEA 5CD4A 4KKOB 4JI3F 2RE1A 4HT7A 5A8WA 6FD1A 2C2MB 3TZZA 2OJ3A 2HVDA 2V50A 3FKBA 4J9RA 1BHNA 4PUOA 1IR2A 5GAHW 1X5SA 3CCES 5IM0A 1SJFA 3T1YF 2XNRA 1RP5A 1RTIB 2EFQA 3E01B 2JEGA 3TARA 4TY8B 3AD7C 3UCGA 2XLIA 5E3RA 3C46A 1P27B 4P10A 2FY1A 2MY7A 1XC9A 3LP0A 4DG1A 2OTJS 4KTQA 2AQ4A 3SCJE 4ELUA 3KJQB 4PG8A 3FZBA 5KFVA 4B3OA 3POTB 3RJMB 5HVFA 3TR5A 3UD3P 1SQGA 3G2XA 5I3PA 3VAGA 2QLWA 4IOAQ 3DLEB 1G1XA 3MM7A 3RB3A 3ITHA 3VCDA 4X4SA 5AE1A 3P6YC 2DRDA 2HVIA 2UVUA 1Q8KA 1ITPA 2ZNYA 1RKJA 3PIOS 5IFMA 3BO4A 1HNIB 3RTVA 2RT3A 1IM4A 1HWIA 1RT4B 1B0VA 3PO4A 2K1RB 2RUSA 5E5NA 1ZPVA 2HAIA 5SUHA 5BR8F 1UDXA 5E7OB 3NL0A 4LFBJ 4EK2A 3OSNA 3DHWC 2MB0B 3N0VA 3GV7B 4LF8J 2MQMA 5IT9Y 1KLMA 1U6ZA 2PFFB 1SV5B 2R7SA 4YEAA 3VQSA 4U95A 4DZ6A 1TL1A 2EPIA 1LXJA 5KT7A 1RISA 4PKDB 3MEEB 1N88A 2IBKA 1S1TA 1O6XA 3Q2TC 3NBPA 2B7CB 1S77D 3PYGA 4JUZA 1RAGB 3TUZC 2I5JB 1FF2A 3KLIB 4NLSA 3GB0A 2P6SA 1BE4A 3DM2A 6AT1B 1WJ9A 1S9GB 2DRAA 1JKHA 5CABA 3ET6A 3T5LA 1N52B 1FJCA 3R5GA 4JV2A 1IKVA 1SC4B 4DQSA 2WRMA 2C2EA 3BQ0A 4MIWA 2ASYA 1FRLA 2RB7A 2KXHA 3LP1A 4TU8A 2ZBIA 1MMNA 1EP4B 4HKQA 1H7WA 1TK8A 2PDAA 1DTQB 2QLXA 1V3RA 2E1CA 1IBKF 1WKKA 4LSLA 1WTFA 1N34J 3W66A 3D6HB 3MEKA 2M8HA 2XI3A 2XY7A 5DJBA 2BJ9A 2IDLA 3CJ8A 4C0OC 4CM0A 3TVKA 3EGZA 4B3RJ 4JB8B 5A8KB 4UOCA 3THVA 2ACMA 4ZJQA 5KFHA 4ZVPB 1SUQA 4LVNP 1RT3A 3K5NA 1ZAXA 4F25A 5D4PA 2EW9A 4DZDA 4LF6J 2J9CA 2XS2A 4WFAS 1L3SA 1RKIA 3R8YA 2CQCA 1QE1B 1QAYA 1WHVA 1Y10A 2CADA 1IN0A 3R5JB 2VFSA 1JJCB 3M2UB 2JL9A 2FHOB 3K0JA 3P45B 1FD8A 4RW7A 3KLGA 2ZJRQ 2C1EB 4J9OA 1S76D 3BR8A 4JV5J 2J0QD 1YVFA 1TUVA 1KC8T 4EGLA 4WTYA 4IRKA 3HSGA 1U2FA 4EZ9A 4MK8A 1I1GA 2HQFA 3PYDA 2D74B 5DS7A 3P49B 4W90B 2XBPA 3MMAB 3GSIA 1YHQS 2GIRA 1VHYA 1WG5A 4LQ3A 2F63A 4WU3A 1MG7A 2P9GA 1X9WA 1GX6A 2W4CA 3HD2A 3T5JA 4R8UA 1GT8A 3T19A 2DHAA 4PWWA 2QL5B 4IO9Q 2IDEA 3H40A 4H54A 4PEOA 3KFWX 4RBTA 1VIOA 5DDQC 1JJ2R 1F9HA 4BBYA 1HWKA 1M5KC 3OHBA 2GJIA 4FBUA 3MMBB 3C3LA 5IV4A 4Q7AA 1BQNB 4KPCA 2F8EX 4C11A 2JC1A 4F4YA 1E6YB 3N01A 3HVTB 2KH9A 3DLJA 1F2HA 2R7XA 3MMCA 4U6PA 1JXLA 1Z2LA 2VDIA 4G1PA 3R2CJ 3AJ1A 4L69A 4GVBA 2JDJA 2RHSB 1OY8A 1UCNA 3ADAC 1FKPA 2E9TA 4NASA 3CIMA 2UUWA 2GQQA 1T8EA 2QN6B 1ACMB 2K06A 1XNRJ 3GFXA 2PA8D 1C0TB 2X1GA 2J8SA 3VVTA 4FPRA 3N9UC 2BKOA 4CO2A 2VFRA 4EBDA 1UVLA 3RYLA 1N56A 4O23A 4UTGA 3SQGA 2BA9A 3K5PA 4LFBF 2BABA 4WE1A 1TK5A 4KGVB 2WBRA 2BJ3A 1V5IB 3I5CA 3MPUB 3EWGA 1H3DA 2D9OA 1RWOB 1WF1A 4LF8F 1LW2A 3DDKA 3NCRA 4ELVA 1FTRA 2GMHA 2M0GB 3LP0B 4DG1B 1N5YA 1TU0B 3HSZA 5M2UA 1U1RA 3KJFB 3EX7B 2QT7A 2OEMA 1VI7A 3IS9B 4DJBA 4KE5A 1U0SA 3PRVA 1V6HA 3MM7B 2NUHA 4FXDA 3SCKE 2O66A 4CI0B 1CVJA 3QGHA 4RUCA 2ASLA 1WOOA 1KN6A 1Z1ZA 2Q79A 2BDPA 3QFHA 2H1YA 5E2QA 5GAEW 2CZVC 2P5VA 2IVYA 3OQ2A 4X4UA 1OY6A 1KLMB 2MJUA 2ZKUA 2HZAA 2ZH9A 2CPYA 1KHVA 3ZZTA 4C48A 1U47A 1SCJB 3CXCR 1KVJA 3FGVA 5FJ4A 2YVSA 5HJXA 4N47A 2F1FA 4LFCJ 1RHJB 1TL1B 4PQUA 3KLFA 4OZLA 3V81B 3NNCA 2QX0A 4DL4A 2UVVA 4J9UE 3M8RA 1S1TB 2DNKA 3BKFA 3NBPB 3IN5A 1KTVA 4M95A 3K5OA 4ID8A 3DLGA 1DBDA 4RU9A 4LSNA 1SXLA 3R6GB 3WC0A 2Z0YA 5GADI 3R7NB 1SH0A 1KBRA 1N34F 3DM2B 4K4TA 1UL3A 3EZUA 1N0UA 3KDNA 4OZ2A 2IA6A 2DNHA 1JKHB 4DX8H 1T05A 4WFZA 4DL0C 3ET6B 2QEXS 2KYXA 5DG7A 4J7CA 4CNYA 1OIAA 2CPHA 3WBZA 1MMLA 3NMRA 4B3RF 1DZ5A 3M8PA 5KFBA 3EVOA 3HK2A 3GR0A 2J7WA 2MGZB 1KWMA 1U24A 3WQPA 4EYIB 1NK9A 4LF6F 5B7WA 3KLEB 2CQHA 3ICLA 3JSMB 4Z7YA 3R5AA 4NXNJ 3S8SA 2E1PA 1RTJA 1RA6A 5D4LA 4C8KA 2AF6A 1FRHA 5BYQA 3CF5Q 2N7YA 3P3DA 4OX9J 3KMQA 3UO0A 4LSLB 3MR5A 4DFMA 3KK3A 2RE8A 3SCLE 5J2QB 3ZZOA 1C4AA 4WZQA 1O51A 4JV5F 3HHDA 4QR0A 3MM8B 4O0IA 4IRDA 1UZHA 1S49A 1XMQJ 2E5HA 2X3GA 3DOKA 4KFBA 3IM8A 5L9XA 3HP6A 4URQU 1LQ9A 5KFSA 1DFDA 4K5RA 1JK9B 1RWNB 1HBMB 3QJLA 5A8RB 3HZEA 4P2FA 3Q86A 1TL7A 4ICLA 4J37A 2J6UA 4O0NA 2UUAJ 2AZ1A 2KB2A 4ZVOB 2XMJA 2HG4A 3T9ZA 2A18A 4FYWB 2LYVA 3MR6A 2V34A 1RCOB 2R2UA 1SKUB 1Q79A 5DM7S 5C25A 4RW7B 4HDHA 1QUVA 3KLGB 4Y2MA 4ED0A 1RAJA 2HNDB 1TK0A 4F3MA 3K89A 4JOUA 1OYDA 3J7ZV 5B0DA 3C16A 1VQ6S 1MNEA 4KT0C 1B70B 7FD1A 4DR1J 4P74A 2YQ3A 4DL3A 1NHKL 3IGNA 2YPYA 3A4TA 2MQOA 1FRXA 3OR1A 1S10A 1MWQA 2MZ1A 2IRYA 3ETOA 4F4KA 1UJ6A 3K8VA 3H42A 3QPIA 3D6MB 3G96A 4R8UB 4FYXB 4X65J 1MW7A 5D77A 1XWLA 1JLAA 4DL6A 1TMJA 2HQDA 1XNRF 2VHGA 4TYBA 1CS4A 3R5BA 4TQRA 1S0MA 2XSJA 3D28A 4F4AA 2DXDA 5B0AA 1PBUA 1JIHA 5B0FA 3CCRS 1UFKA 1SJ3P 1U1QA 3C6UA 2V9WA 1SJRA 2G4BA 3RGIA 2VKZG 2C2NA 2NXCA 1U7LA 1NPRA 4OX8A 4YFUA 3BDPA 2BACA 1O5JA 4QPTA 2E1MC 1FKPB 1JNZB 2FVQA 5GADU 2DGWA 3RW6A 5IWAJ 2UVRA 4FXVA 3S7RA 2M8DB 4F7VA 2O3DA 2HQ3A 1PO6A 3MI7X 3AHPA 2V8GA 1ZTTA 2YX1A 1EARA 3R7SB 4CH0S 1FK9A 3MUMP 1TELA 3D1QA 3M7VA 7FDRA 1S1VA 3MOJB 4WE1B 3MGJA 1RTDB 3T3FA 2KU7A 1K47A 3W60A 1R0CB 1HWLA 3MZIA 1B7YB 1LW2B 5I42B 1OJ4A 2O67A 2KN4A 1J27A 4UOHA 2EFOA 4F0KA 2E5IA 5E41A 2XMVA 3B54A 3R1HA 2KJVA 3HFVA 1Y5IB 3FC9A 2JNJA 1S6QB 1S6PA 3D68A 1IJFB 2D7SA 2VDHA 4ALZA 3RB4A 3I4HX 2E7WA 4X4QA 3EXYA 5KG5A 4H4OA 1FXLA 1P8GA 4NLOA 2R7TA 5KFLA 1UMJA 2HNYA 2IM3A 3PHEA 1D9AA 3U7JA 4IR9A 3CC7S 3T41A 4K4SA 1VK3A 4PPZA 4XDCA 2Y8WA 3N5BA 1VRQC 3CDBA 1OY9A 3PEJA 2E5LJ 1R8BA 4RW9B 3CJ5A 5LMUJ 2CQ1A 1URNA 1NJZA 4IOCS 4MFBA 2IIHA 3LGMA 3IWXA 2OUGA 2HRYA 1J5OA 4NXNF 2CPZA 1LOUA 1SPBP 1AUSL 3DDNA 1R8HA 1FWLA 2DY9A 1WHXA 3BQ1A 3OTOJ 2L3MA 4LSNB 4YDDB 4K4WA 1CJUA 5FD1A 4OX9F 5IQ6A
chains in the Genus database with same CATH topology
4RX6A 4F3QA 1H2UX 2VG6A 4F2SA 4RZRA 3GILA 4MIBA 4OZ5A 2DGQA 1NH7A 4P6QA 4RLEA 5J1EB 5KFTA 1FE4A 2ZJQQ 4RNHA 1S0NA 3MXHP 2M2BA 1S79A 4DV2F 4WIIA 3GIKA 1K8AT 1KSPA 2J0XA 2FJAB 4O44B 2J0SD 5JVHS 1QM9A 2VZ9A 3NLCA 3KYLA 4OI0A 1YJUA 1G7CB 3HPOA 4R0EA 2F9DA 3KG0A 2RQCA 1T05B 4NA3A 2DNYA 4JI2F 1AFIA 4DV6F 2WB4A 1NZAA 3LAKA 3CJ0A 4R5PA 2YKMB 4I69A 1S0OA 2YNGA 1WI6A 1MWYA 5KFKA 3H2LA 4ERDA 1C0TA 4NXMF 1XMQF 4ZCKA 3OFFA 3OTBA 1Q53A 2VFTA 2JEJA 1YRXA 1F5BA 2VPZB 3CC2S 3FSIA 2ZJQS 2OFGX 4Y28C 4URSA 4YMEA 1WACA 2HZCA 3TW0A 1SB6A 3ZZYA 1FNOA 2VBXA 3DMJA 4RKUC 1VMBA 1RQ0A 1YBAA 3L3CA 4YR0A 1ZAVA 3CD6S 1HW8A 2IAJA 1L3KA 4C3LA 2B7BB 3PV8A 4B3SF 3R27A 1IKXA 5JJBA 3MM5B 1RT5A 2HHUA 5IT0A 4TY9A 4QYRA 2XC9A 3MR3A 2F9JA 2FJEB 4O3OA 3RR7A 3MEDA 4ED7A 3DI6B 4X4TA 3O2IA 2L48A 2WCXA 1H2VZ 3QZ8A 4HTJA 5M2RA 4PG7A 3QJPA 2YWFA 2PE8A 3VAIA 3OFEA 4DLGA 3FCHA 1NK8A 3PKYA 3LPYA 2OPRB 1HA1A 4H3SA 3DXSX 3GFZA 1HARA 2UUAF 1CC7A 1N5QA 2C3PA 3MECB 4DL7A 2Z0GA 2E5GA 3D2WA 1BD6A 2GFFA 1O0CA 2G13A 3IG1A 4F67A 4HH0A 4NZ7A 3H5XA 3DN9A 3FJ2A 3AAWB 4DF8A 4V194 5KT3A 3CDAA 3W2WA 3KHRA 3M6UA 3MPVA 1CSJA 2MZRA 1FDAA 3JSYA 4K50A 2DIVA 2C3YA 4X84A 3BGRB 4KHRA 5FLXY 2J9DA 4FZVA 3OLAA 2ZH3A 3KNAA 4ECUA 3CCQS 5IZNA 3IS9A 3PW4A 4I68A 4DQQA 1X7VA 3MFHA 2RQMA 4NCGA 3UQSA 3AY0A 1UKUA 2AJ0A 3RZAA 2KZMA 5BJRA 3V6KA 3GIMA 3THPA 2DO4A 5KT5A 1JLBA 1HI1A 1O0PA 2MJNA 3OW2R 3SV4A 3M30A 2UV8G 3QGPA 2RD5C 5MLCV 1D8YA 5KFXA 4EFAC 3KNGA 4IFYA 1VBXA 2KT5A 3QZ7A 2DTJA 1T02A 4EUVA 2NQPA 5DETA 4DFJA 2EFPA 4ED5A 3HLUA 5HMZA 4DR1F 3NRBA 2HQIA 4ZPWR 2AYGA 1FJEB 1KONA 3G71S 5LXYA 1F0XA 2K7KA 3JAMY 3E8OA 4UQGA 2FIUA 2DHGA 1S0VA 1X4GA 2IFXA 1JLQA 1SC6A 2OSRA 1Q82T 2IC3A 5D4OA 4MIAA 3BSOA 1VBYA 4DR7F 5KT6A 5F9NA 1JJHA 2EG1A 1UEVA 3CJKB 3KK1A 2HHWA 3KOAA 2KXFA 1IKVB 2DGOA 1ZZFA 5IZHA 4JI0F 2CJAA 4ID5A 5CYJA 3KTQA 1DTTA 4X65F 3LW5C 1GXUA 2OAUA 2OPQB 3VR1A 4C0BA 4ZP7A 3DLHA 2GW8A 5CZXA 1URRA 5THWA 3HVRA 1YRUA 3PFEA 3ENQA 4QBUA 1H0HB 3RR8A 3MAHA 1UFLA 4B08A 4G6VB 4C8NA 2VBWA 2R8JA 3LF0A 5DO2A 4ZCMA 2VD3A 5KFYA 5E3AA 3SDEA 1KS2A 4K4VA 3MDFA 5FDLB 1SKSA 5HP1B 2OD6A 3LP1B 3MF5A 1Q81T 3THTA 3PEHA 4IG3A 1KQGB 4IKAA 1R43A 4QW8A 5HMWA 4F4XA 1AFJA 2CJ9A 3PW0A 4ILLA 2OLWA 1H98A 5DDRC 5HROA 5HI7A 3O3LA 3UW1A 2XLKA 3POTA 1LFPA 1T03B 4QW9A 2KJWA 3TANA 4O4GA 1OO0B 1NJYA 1CQNA 5KFQA 3V81A 5HL7Q 2I0XA 4U7CA 2BRLA 3DLKA 4JYAF 1UEUA 4A8WA 4KO0A 2V4QA 1KD1T 5HO4A 2ZH1A 4RNOA 1VFJA 2B9WA 2ALZA 3G8QA 4O3NA 1X4BA 3Q2SC 3V5RA 1S4FA 2DNLA 2ADCA 3I56S 3PJWA 2IYGA 2AGOA 4OI2A 4FS1A 5L1JA 1E6VA 3QGIA 1HNVA 4ECVA 2KO1A 2M52A 4K4ZA 1YJWS 4OI3A 1VOMA 1HBNB 4B9VA 1MROB 4DLEA 3DOLA 5HL7S 2OPPB 4BC9A 1YTYA 4Q2LA 3OR1B 4ES2A 3SI8A 1SUQB 4ZHRB 2VKRA 1RT3B 3I82A 5I3UA 3M32A 2BVZA 1S1XA 2EKYA 4HVZA 1NK6A 1YI2S 3K8WA 2QO3A 4C8ZA 2MZSA 2J76E 4HEA9 3H4BA 4ZP8A 4KC5A 1O0BA 3DRPA 3UDCA 3BSAA 2HHVA 1M5SA 1IJEB 2ZH6A 2W7PA 3OPKA 3H8YA 3K2YA 3VWSA 3DYAA 2LA4A 4Y00A 2RRNA 1JLAB 1S1UA 3AB2B 2EBEA 2DR9A 1KFSA 2V94A 2HVZA 4M5DB 2DISA 3BO3A 1QRTA 5IWAF 2LXUA 3GFHA 3NCQA 1LKZA 2GQCA 2G9OA 5CD4H 1X8DA 2XSJB 5CYQA 2EVZA 3TUJC 1RT6A 1S9EA 1QY7A 1R31A 1YJNS 1SV5A 3OHAA 4IO1A 2HWHA 4Y3CA 2MGZA 4W92B 3KLVA 1FA0A 3QYYA 3MUTP 4WK3A 3BREA 1DHMA 3TUIC 3I32A 3OJSA 3CPWR 1FO1A 4WU2A 2CPEA 3KLEA 1NK0A 4AXJA 4MJKA 3H98A 1WELA 4RW8B 2WSFC 3JSMA 2HLUA 4O3RA 1HL6A 2J7KA 1OPIA 2ZITA 4FYDA 4J9SA 2D9PA 3MWBA 3T1HF 3SCIE 2CPXA 4JBCA 4NPOA 3U02A 4AQYF 3UR3C 2FVSA 4M63A 2CQ2A 2O01C 2XMUA 3UNGC 1ZAWA 3KJVA 2Z8QA 4EO8A 4F4WA 1YWXA 4IYQA 1LWFB 4B9SA 4F2RA 1VC5A 1KFDA 4CO5A 1XR5A 1NJWA 2VA2A 1TKTB 2MSSA 4PG4A 3TAMA 2UUBF 2VV5A 3I31A 2R8HA 4K4YA 1RT7A 1SH2A 3MD1A 3MM6A 2FLPA 1JWWA 5EWEA 1KOHA 4GC6A 2EFVA 1VQ9S 4BCAA 1FNMA 2MKIA 1B0TA 1HI8A 1S99A 1JLGB 2DGXA 1MMDA 4DN9A 3IC1A 2ZZNA 4YB1P 3CULA 1WI8A 5C42A 1XBWA 1IUJA 2R7QA 3IR5B 5J2QA 1NJIT 2XHWA 1BGXT 2O5DA 2RMLA 4ZPTR 2DB1A 4OLPA 4RNFA 3IXQA 4NA2A 4CH1A 2R2RA 1PGZA 4OIXA 1LK5A 3NCPA 2MKSA 3HDSA 2GO8A 3QGGA 5HLFA 1S9GA 1JLFB 1W2BR 3G6YA 3Q24A 4BHQA 1SIWB 2C2RA 3MM8A 1VQ8S 1TL3B 3PKMA 1U2RA 1N8RT 5D3GA 5F8JA 2N7CA 4DHVA 1FXRA 4L72B 4U7UK 3CD7A 2C3UA 3KHHA 4ZOSA 4X4NA 3M2VA 4WFXA 1S97A 4YQWA 3H25A 2FLNA 1YJ9S 3I87A 2AJ1A 1EETA 4OJGA 4PR6A 4C3KA 3CWJA 4AUKA 2HYIB 4IFVA 1HQUA 5L1KA 3HFKA 2C28A 2EC0A 3U1NA 3IWLA 3MOZA 2JLEA 4OX7A 2CYYA 3CUNA 1X5OA 1U1KA 2COLA 1SI9A 2ABYA 5L1LA 5BNZA 3K5MA 1RYSA 1HBMA 1K0VA 3F56A 5A8RA 1VGYA 4FF1A 2BW2A 1QRUA 4IQMA 1S1VB 4C11B 1HNWF 2GC8A 2M5YA 2MY8A 2JFDA 5J1PA 3QLHA 1PILA 2JX2A 4KSEB 1H6KX 2YKAA 4JI4F 2ZUGA 3AB4B 2D41A 1ZM4A 2YH0A 3ZZRA 2AGQA 4EBCA 3EUNA 4KR0B 2DNOA 4DEZA 2B5JA 3NS6A 2C2DA 2Y1RI 2H5EA 1X4FA 2VG5A 5IT4A 2AYMA 2HMIA 2AV5A 2KHCA 5LXRA 3CE8A 1IKYB 5KTQA 2LU2A 2YWKA 5HMXA 3MPYA 1EP4A 5H1SV 5EDWA 2JJ4D 2E5LF 4RU2A 2O1PA 3MMCB 4DV4F 3OR2B 4N56A 1TL5A 3HT3A 3BN7A 3GSDA 3HKWA 2W25A 5LMUF 4AL5A 1EUYA 3TA1A 4LF9F 1DTQA 2XLJA 1U1PA 1LV5A 2VA3A 3BGFA 4UW2A 3ENVA 3CTRA 4WFBQ 3H5UA 2K7JA 2LQJA 2HNDA 2PN6A 2YX7A 4C97A 3M2RA 4I6WA 2F7VA 3UI3A 3TAPA 4B3TF 2V8DA 1N6QB 4OFZA 2M4MA 2YKNB 5E3CA 3T1AA 3VALA 3BS9A 4OHXA 1U4BA 2DR8A 3HHEA 2B0GA 4B3MF 5E0OA 2XGPA 1P1TA 2LXIA 1YQHA 3LWLA 1VQYA 2B6AA 2F40A 2ILYA 2CJBA 4RW4A 4X62F 1SIZA 1Y00A 4NLUA 5B0CA 3RRHA 3EGNA 2PMHA 2OMOA 3D1HA 3VAKA 1WF2A 5J2NA 3TX8A 2OTLS 1UA1A 1REVA 4I2QA 3OTOF 1X4DA 1N0VC 4WFBS 2R4FA 4CT9A 3EPIA 4QWCA 4DR4F 4FF4A 2KTQA 4FS2A 3GYNA 3NP5A 1ZPWX 5DRKA 4F3OA 3FRZA 3PY8A 4H4OB 5B08A 4N8NA 4A8YA 4FXWA 1R0AA 2A2CA 1NJXA 3BO2A 3V4IB 3VAJA 2GO9A 4GMKA 1GAOA 2ZFHA 2FTRA 2IM0A 4WKRA 1VQ7S 1PC4A 4ECWA 3BGLA 2ZH2A 3TVYA 3FMBA 4JI7F 3UR0A 4PXEA 3SQGB 4XPCA 3M9OB 3FFIB 3JTOA 5G0RB 1M90T 2JFKA 2LLZA 4LF7F 4KHPF 1K1SA 4BWJA 5CHCB 1RT2B 2GHPA 5AXMA 4NLQA 1QE1A 3V6DB 1HBUB 2VPWB 3HHKA 4JXZA 2KM8B 1WTBA 1S48A 1QVFR 1IKWB 2RKIA 1ZM9A 4YOEA 2M9KA 5EHHA 3IWNC 3PACA 3IA0A 4LVOP 1EXDA 3OSPA 1U26A 4Y6IA 2W7OA 2BJEA 1N5YB 4HH1A 3RBEA 3DLLQ 4B9UA 2OIHA 4H4MB 1ZOTA 3ZC4A 3M2UA 1K0TA 1DURA 4ZCLA 2B4VA 3CCJS 1M1KT 1I94F 3PZPA 1XTZA 2IRXA 2RSQA 4YB6A 2OP5A 2UUTA 3KK2B 1TVRB 2I2YA 2VBZA 3NS5A 4MFBB 4ZVHA 4ECTA 3QJJA 1WD6A 4WCEQ 3HHLA 3PW5A 4K2XA 1R27B 3PFOA 5L8RC 4LFCF 5KG1A 4N76A 1ELOA 1HHTP 1IXKA 4ZPCA 4ECZA 3B78A 4DSLA 2L9NA 3VTIA 2RQ4A 3BZQA 1RT1A 4C98A 3KHGA 4PXBA 4OHZA 2DH8A 2OH2A 3GV8B 4EZ6A 1VK8A 2BOPA 4Q8FA 3JSRA 5K5MA 2FJBB 2J6SA 4DR6F 3K7RA 4OZ1A 1S9FA 2OKQA 5KT2A 1H38A 4KGMA 2VFVA 2UP1A 1CQMA 2E66A 2HGMA 1S6UA 4QIVA 4WCES 3IR6B 5EUHA 3C2PA 1X4EA 2XI2A 5EGYA 4DF4A 1SL1A 2DJWA 2GA7A 1A7GE 3JTNA 2RD2A 3MMAA 3J81Y 3JYTA 1RJJA 2RU9A 1MU2A 1P6TA 3VAFA 1JJ4A 2MHNA 1C4CA 1NNDA 1NHVA 4ECXA 3FQKA 2D3ZA 1X5TA 1KOOA 1XR7A 1QTQA 4RWXA 4TKTA 3J7Z5 2KT2A 3B4MA 5M2PA 2WSEC 1TV6A 4NZ6A 1N5TA 1RWUA 2QA2A 1Y0HA 2G1DA 4N5SA 1R6YA 5F9LA 4B9MA 4ZA1A 4OI1A 4NA1A 3CVKA 3F44A 2J0WA 5CCMA 3RAQA 2HGNA 3TQ1A 2BRKA 4ETZA 2LMIA 4QWEA 2QFJA 3J7ZT 1HPZA 3KWMA 5KFJA 3G9CA 3F41A 3SEOA 5L9NA 2NYIA 3D0HE 3QWUA 1Q78A 1Z4UA 4FNIA 3QAUA 4FN5A 2LDYA 1QAXA 4JI8F 3M6XA 4IRCA 3MMBA 4YR3A 2JWNA 2V8HA 4HTIA 4UY88 1U8SA 2XEXA 1FDDA 2GV1A 3S6EA 2J6TA 5LMNF 2AP6A 3DRRA 1NEEA 2IAJB 2Q43A 3J80Y 3OL7A 3R1LA 2MDAA 1IKXB 1LWCA 4IDKA 3TVZA 1BQMB 6FDRA 2LEBA 2E29A 2C3MA 1DRZA 2HFOA 2ROEA 1DQ9A 1RTDA 4X4OA 3JB9k 3IBWA 4DSJA 5DG9A 2RF2A 1UWBB 2X1AA 2DD8S 4Q0BA 1GQEA 5H9EJ 4PQUB 4O3SA 3KLFB 2CQ3A 1X0PA 2FD2A 2WHOA 3HVTA 4RW6A 4ZS6A 3TA0A 1KLNA 2POKA 3CCWA 5I42A 4B9NA 1MSWD 4RWWA 2XSFA 3U1LA 4DV7F 1AXQA 2RDIA 2UXBF 1BWEA 1QTMA 4L3NA 4JXXA 4QIEA 2U2FA 2XY5A 5KFRA 2JEIA 5LT5A 2MPUA 2XS7A 2MXYA 2VOPA 3ONQA 3DLGB 4OJ1A 1YGYA 2JOQA 2QSWA 3NAHA 4OZ0A 4TQSA 2JLGA 1SL0A 3W2VB 2HHHF 2LQ9A 2KG1A 3GQCA 3H5SA 3I5BA 5DQHA 2QRRA 4PPDA 5K8MA 1S6QA 2DH9A 2C22A 2V5HG 2X1FA 4EU0A 4OHYA 2MSTA 1U1OA 3UCZP 4AL7A 1W2IA 4A8SA 4F50A 2FJXA 2R7OA 4KRWA 4ZVEA 5GAEU 1NKCA 4KKOB 3NMAA 4JI3F 2NXUA 2CDQA 3D5MA 4QWDA 2RE1A 2CPIA 4HT7A 5A8WA 6FD1A 1X4AA 1MWZA 4NLGA 4FNHA 3M30B 5CZVA 2OJ3A 4G1QA 2Y1IA 4J9RA 2WONA 4IFYB 1X4CA 2FGCA 4OL8A 2HFNA 2W9BA 1TZ0A 2CQGA 4DUZF 4EBEA 1VC6A 2M70A 2DCLA 2ZE2B 2V0NA 2DK2A 3GYXB 1OSCA 3L95X 1OWXA 4PUOA 1Q8LA 3M1VA 5F8IA 3NGDA 1JLQB 3OUYA 3CCLS 2E44A 2IC3B 4Y0FA 4DSEA 3T5KA