3W2VB

Crystal structure of the cmr2dhd-cmr3 subcomplex bound to 3'-amp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
322
structure length
281
Chain Sequence
MIEVTFTPYDIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRITVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Cmr2-Cmr3 Subcomplex in the CRISPR-Cas RNA Silencing Effector Complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Immune system
molecule keywords CRISPR system Cmr subunit Cmr2
total genus 61
structure length 281
sequence length 322
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3w2vB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3w2vB03
3X1LB 4H4KA 3W2WB 3W2VB
chains in the Genus database with same CATH superfamily
2DXFA 2L9DA 4NLPA 5KFGA 1KTVA 2UV8G 3NY0A 3TUJC 4UOGA 4DLGA 3GV8B 1KWMA 1HPZB 2IC3A 2MZTA 3LGHA 1LFWA 3SFGA 3W8PA 3DI6A 5B0BA 4IRDA 1JLFB 4B3TJ 3CD6S 3TQ1A 2QX0A 1TP7A 4R25A 2Q6CA 5J2MB 5ETKA 3PR4A 3BN4A 3UE2A 4X4NA 4NZ6A 2Z2LA 2KN4A 2VG7B 2Z0YA 1Y00A 2C3YA 3LALA 4ZJQA 2FHJA 3D68A 3QIPB 4QZVB 1CEZA 1T9UA 3JS9A 4WIQA 4P2BA 3DLEA 5HL7S 3I4HX 5GMEA 4S0MA 4B9MA 4CO1A 1RQ0A 3SXLA 1J5EJ 1N54B 4CO3A 4Y2AA 4FF1A 4CLPA 4O4GB 4PRFA 5KG0A 3FCWA 3G8QA 4HTJA 4P2MA 2MKIA 2OP5A 2ZJRQ 4DL7A 2KVQE 1DZ5A 2D3UA 2VBWA 4RW4B 4MK9A 2UP1A 2GZOA 4O0NA 3ZZYA 1M90T 5K8PA 4C0HA 4CO2A 1YRXA 1B7FA 4CI0B 3MTJA 4DJBA 4IH6A 3C2PA 4LQ3A 3EM1A 1S9FA 1ZOTA 4PEOA 1YTYA 1PGZA 3M8ZA 4DR3F 2LEBA 3RBDA 1N0UA 3MEGA 4PXBA 3W66A 4A4JA 1AFIA 5G4DA 2Q79A 2XYHB 3MM8B 4CH1A 4O4RA 2N3OA 3KJVA 4DV5J 3KLFB 4PQUB 2WSEC 4BLGA 3M32A 3TVYA 2CQ2A 5DZ6A 1QAIA 1M1GA 3V6KA 2ZH6A 4L3KA 2X3GA 1GQEA 1EZZB 1SJRA 1WC3A 1FXDA 4DV7J 1N6QA 2X1FA 3NL0A 4JXXA 2ZITA 3UWTA 2RAQA 2SXLA 3SSRA 2R42A 2AYBA 2KG1A 1YJRA 3CDWA 2DNZA 4BHQA 3OSNA 2R8KA 4YFUA 2HFUA 1GK8A 2HAIA 4RNMA 2I2YA 2PC6A 3QJLA 1M1KT 5HMWA 3R9LA 5D78A 4CNYA 2ZH8A 5HN0A 2E66A 3PJ9A 4RR5A 1UJ4A 5DDOC 2KHCA 2DR9A 4LF8F 5DETA 1SKUB 1WG5A 2AGPA 1FTCA 4ZCLA 3CXCR 2GV1A 2VKZG 3W5ZA 4JI4F 2COLA 4USJC 2LXIA 1JLGA 5KFFA 3RYLA 1GMUA 1EB0A 3D6MB 4QCLA 4AD6A 4E8BA 2GHPA 4DV7F 3TUPA 4ILLA 1TL1B 4F67A 1UFLA 4RJVA 1K47A 5HVFA 5C2GA 5KFPA 5GADI 4P2FA 3G4SS 1JJCB 2ZOFA 4FYYB 3EDRB 5KOWA 1Q82T 4OYBA 1SKRA 1RHQB 3DDIA 2AQ4A 5JMNA 3MGJA 4KQZA 3SSQA 1FVSA 1KFDA 2O3DA 3LWMA 4K0KJ 1HNVA 3IBCB 4M5JA 4OIXA 4ZVFA 3WC0A 5DDRC 3CPWR 4G3IA 1TL1A 3FSXA 4J9MA 4DV3F 4I6YA 1RABB 2N7CA 2WW4A 3LP1B 4DFPA 3E01B 3J80Y 3N01A 5KT3A 4ED2A 5KOXA 4KHPJ 1CLFA 3PIPQ 3MECB 5FIIA 3UN3A 4MJKA 4NI2B 4NXMF 2LQ9A 4LSZB 3OJSA 2GJFA 1NPPA 4DI6A 3BSAA 1I6JA 3OL8A 1CC7A 4H4OA 4UZCA 2O67A 4ELUA 2UXCF 1KLMB 5IXUA 3QZ7A 1IKYA 2Z30B 2MZJA 5ITHA 3BGRB 2HLTA 3DGPA 1G3OA 1HI0P 4YN3B 4CNZA 2ZE2B 4PUOA 2H5EA 4O44A 5L9XA 5DG8A 1FWKA 3J7YU 1ZPWX 4ID5B 5C2CA 4HH1A 5B0AA 2B7BB 3KK1B 1RKJA 1L5UA 2V0NA 2OSRA 4ZLJA 3QPIA 3DLHA 3M7VA 4B3TF 2C2RA 2Q66A 1S1XA 1RBOB 4RW4A 3CE8A 3Q2SC 2GCFA 2WW8A 1MU2B 4OX6A 4WFZA 1XK8A 2JDJA 1R6VA 2MQLA 3ZTQA 4Y2CA 2CUYA 2WSFC 3J7YI 5CYMB 2ZBQA 2P9GA 2ZD1B 3QT7A 2IY5B 3F41A 2BABA 2HYIB 3ICLA 3KKFA 1OSDA 3QFHA 2A6MA 2F65A 1J5OB 5F8MA 1R8AA 3ZTPA 4NCAA 5DQGA 2NUUG 3D1OA 5LSRA 1RWMB 3M9NB 3TAQA 4EGLA 2OPSB 5KT4A 3M8YA 1TR0A 4OJGA 2FGCA 1HQEB 2HHTA 2DGUA 1TKTB 3W8GA 2CJ9A 3LGNA 4DF4A 2N7YA 2ZVSA 4ED1A 4DV0F 4ZJOA 1NK4A 1JLGB 2OEKA 4LF5F 3W65A 4RPFA 5F0UA 2G1DA 4ZP7A 3W63A 5L1KA 1AZSA 2IJNA 1FJEB 2M52A 2A2CA 2NXCA 4PYAA 5I42A 2IYIA 1AROP 3I4PA 5DDQC 2HHQA 1V3RA 2ZEJA 1NLKL 2HHWA 1FFGB 2JC1A 3VGUA 2HIYA 4C0BA 1FRHA 1FK9B 2V8PA 3MPDA 3CCTA 3QQCD 5IWAF 3SZ2A 2J6TA 1CJUA 5IFMA 2V68A 5RUBA 3OTEA 2JEGA 1X4AA 1OWXA 3C46A 3BDEA 1IKXB 1JLQA 3GCWP 5AXKA 4Q43A 3I32A 5KFOA 5KFEA 3TVKA 2DNLA 4ZVPB 3R5AA 2VQFJ 4QR0A 4WFAS 4LR8A 5E0OA 1LK5A 2ABYA 1NO8A 2B51A 4X65F 3MF5A 4I64A 2EFOA 2VZ9A 2HKEA 3HDSA 1R8CA 4C98A 1ZTTA 1N5TA 1RHMB 2C1EB 4NLRA 4OJ1A 4DR1F 1N32J 3GFXA 1VBYA 2V8DA 4ZP9A 3I31A 4C3MA 3HO1A 1R43A 1KLNA 3D9BA 3QT6A 4NASA 1EAYC 1WSRA 4WBFA 2E9TA 5LSOA 1SH3A 2R8JA 1ICEB 3NOCA 4L69A 2OPRB 4M8LA 1RI7A 5LXRA 7AT1B 3VAFA 5EHHA 2V5HG 2W2OP 2MY7A 1UWBA 3E8OA 3JSYA 1VISA 4K8RA 1XNRJ 4K4ZA 4DX6A 3MPYA 1K1QA 5CZVA 4HDHA 4NLOA 2XS5A 1G1XA 5F9LA 4CLZA 3RB0A 3VV2B 1LQ9A 3R8YA 1U1OA 4JI1F 2Y8YA 4NEYA 1PCAA 3P5BP 2NZ4A 4ZVOB 5FJ4A 2CJAA 2VG7A 5T41A 3T1AA 2VBZA 4Z2XA 1Y3JA 2WONA 4DFMA 2KHDA 1AYEA 2LDIA 3C6UB 1N88A 2JVRA 2LEAA 3C8YA 2AV5A 3QT5A 2MJUA 3NGTA 4HL9A 4LSNB 2CVIA 3LANA 3PX0A 1Y10A 1LK7A 4QU6A 3GV5B 5B0DA 4EWTA 4NA2A 5LL6d 2MQOA 3AFGA 4Q2MA 2PA8D 2DHGA 3IC1A 5D15A 3BQ1A 1QAXA 2IBOA 4IOCQ 5F8LA 4A8MP 1SIZA 2W9AA 2ERRA 1D8YA 4USTA 2NXJA 2V4JB 1X5PA 4ZKAA 4KGMA 3HJVA 4TYBA 4DV1F 3C19A 1PBUA 2EPIA 3M2UA 1TL7A 3HI9A 3TP2A 1S6PA 5EX0A 4DG1B 3IRWP 3W64A 4C9DA 3NLCA 2W7AA 3DLKA 3UQSA 3JQMA 5A8RB 3CF5Q 4FDFA 3MAHA 4P10A 2PE8A 4QJVA 1L3UA 2B3TB 3JSMB 3IAS9 1CQMA 1WDTA 4F0KA 2Y1JA 1JLBB 1RKIA 1S7IA 2AZ3A 1W7WA 3TUIC 5A0YB 5A76A 1QDUB 4MYUA 1VC5A 1JJHA 4NLYA 1TUGB 1LW0A 1UW4A 3G71S 4H3SA 3BBBA 4C11A 3OTOF 2D9PA 2K3KA 3A1YG 1VHKA 1JQGA 2Y1LB 2NPFA 2DH9A 3NKYA 1C1CA 2J8AA 3RBXA 1N0VC 1ACMB 4RUHA 3DOKA 3RRKA 3GU0A 1DQ9A 2CQ0A 4CM2A 2HQCA 3LP2B 8ATCB 5KFWA 1U2FA 3Q0AA 1WKKA 1JXVA 1TKXB 2MHNA 4FNHA 1HMVB 4WKRA 3QFWA 4OYMA 3D5MA 1SL1A 2MKKA 1HNZJ 3NG8A 2Q1LA 4OMFG 3ZNJ1 3PIOQ 2RRBA 1UJ5A 1PKUA 1CC8A 2M7SA 2ROGA 1BQNA 3DRYA 1A6LA 4M5LA 3C14A 2BUNA 2PA3A 3FK4A 1CJKB 3M6VA 4DQQA 3T1YF 4B9UA 3N6NA 1KRPA 3T5LA 1RWXB 2HSEB 3T9NA 3HVTB 3CULA 4B3OB 2BR0A 3LW5C 2DO4A 5J2QA 2H51B 4RW8A 2QLFB 4RW9B 1VS3A 4I7FB 4PUOB 1C0TB 1OMSA 2ACMA 3M8WA 2G9OA 3WIUA 4UQGA 1EIYB 4A47A 2BJ8A 4OZ1A 3RR7A 4ZHRA 1RHJB 2H1YA 4FYXB 2VH7A 2L48A 3D1HA 3PY8A 5DM6S 1V3ZA 3KYLA 1NSQA 5KFZA 4QWDA 4JI1J 2G0CA 3Q8SB 4YUDA 1QRTA 2WB4A 1NK7A 3CF5S 1B7YB 2G0JA 5IS2A 1CBKA 1VRTA 2WOMB 1R27B 3LH2S 4K50A 5C25B 2B9YA 2EBEA 4WFYA 4N76A 3ZZ0A 3B4DA 3TZYA 2VBYA 5K8NA 1R8HA 2YH1A 2Q3PA 3WHIA 2UVVA 1SJQA 5HI7A 4DSEA 5B0CA 4DMZA 2QRRA 3JSRA 1C0UA 1RAFB 5DLFA 4DV6J 1RT4A 3WDOA 4YMEA 4OL8A 3OVSA 3IR6B 5HJXA 2VFUA 2JC0A 4TY8B 2M9KA 4DR5J 5GADW 5L46A 3ILLA 4J9SA 3OTCA 4LF6F 3BO4A 1S1UB 2VFTA 5JXSA 4YS2A 2AT1B 4NMLA 4U8YA 3ZFVA 1R31A 4DPXA 4DS4A 1YRUA 3GG1A 3HVTA 3KG0A 4DUZF 1P1LA 1RWOB 2HNZB 3WBZA 1WUUA 2OPPB 4DPWA 1XNQF 4IOAQ 3QO9B 4TVAB 5CA5A 2IM1A 4NX9A 1NXZA 3AJ2A 3QWPA 3HX9A 1S12A 1UA1A 2DPJA 1X4HA 4CYUB 2YWWA 4DU7A 2MZRA 3CD5A 3TO8A 4CIOA 3VGTA 3PR5B 4IOBA 4J37A 4PPZA 1FNOA 2GQ2A 4DXLA 1GEHA 3DGVA 5K5MA 2R2SA 3KLGA 1ZS6A 3IGNA 3ISND 4KIAA 4A48A 2KXNB 3OUYB 1RT1A 1FEHA 4MK7A 1UVJA 1HR0F 1HW9A 4FYDA 2BKPA 2P6SA 2V8HA 3FFIA 1JLCA 3IM8A 4R5PB 5IQ6A 1GMVA 2PI5A 4OI0A 3MM7A 2LA6A 1VQ8S 4ID5A 2L41A 2CXEA 5GMDA 2A18A 2QA4S 4RX6A 4KGZB 3H5UA 4MKAA 4C8ZA 5L1JA 3DGPB 3EJMA 1RU1A 3BKTA 3M6WA 4ED5A 1FJ7A 4ZCMA 2VQEJ 3GP9A 4Y2IA 3R5JB 1TKZB 2H54B 1L3KA 1F6TA 2FZCB 1R0CB 2CQ3A 3KUEA 4WYLA 4CYUA 3BKUA 5EDWA 1IBKF 1MG7A 2EXUA 2FLOA 2K7KA 2Y0SD 4WCEQ 2KL8A 4R8UA 4TYAA 1HD1A 1TZ0A 4F2SA 4WXOA 1VC6A 3BM7A 4UOFA 1IJFB 2BW7A 2ASYA 3UW1A 3T5JA 2ADCA 2KVIA 4PXDA 4DDFA 5DQHA 2UXBF 3KG1A 1S6QA 3AJ1A 2FJBB 4KY3A 1HR0J 1LNQA 1QRSA 1HNVB 1RBAA 2IJRA 1HBUB 2LYVA 2YKQA 5DG7A 1B64A 3L7OA 1GTHA 1DAXA 3QRPA 3H2UB 2X1GA 3OV7A 4WZQA 1PAEX 1SC6A 2HNDA 1QSSA 2UUBF 1T03B 3WX4A 3J7ZV 2UXDJ 2W7OA 1REVA 3JAMY 4LJMA 3U1NA 5BJRA 2R8IA 3P6YC 3RBZA 2C2EA 2R4FA 4DR6J 5I42B 1SL2A 2XZTB 3VZHA 1VQNS 1JNRB 2XMTA 1NXIA 2XHCA 2VD3A 2MQPA 2KO1A 1B99A 3CSKA 5KT6A 3HHLD 4NXMJ 5CHCB 3C3LA 3MMBB 3H4DA 4RU2A 1YGYA 3CJKB 4IFYB 4KBIA 1WORA 4NLQA 1YJ7A 2J7KA 4OLOA 2RDJA 1NJZA 3HD2A 3A8EA 2HRUA 3A8KA 4RBUA 2XWXA 4DCOB 1S1TA 2CZ4A 3B4MA 3LUYA 1MROA 4KHMA 2D3O1 4DSIA 3WX8A 3KLHA 2CPZA 2V9KA 3KLEB 1RAOA 3M9MB 4Q0BB 2XHWA 3G6ES 4GKKJ 3PHTA 3HK2A 2L3MA 2WRMA 2QFIA 1TTHB 1O0CA 4JI5J 1HKAA 2VFSA 1HNIB 2VDIA 3H90A 5DG9A 1U2CA 1FI4A 1SQEA 2UUTA 4F0HA 3OL6A 5I3UB 4PXCA 4B08A 2FUG9 5GAEW 4ES1A 4DL4A 2OEJA 3ELHA 2H4WB 2X1AA 1AFJA 4NCGA 4UQTA 5KG1A 3OLBA 1U1PA 4UUXA 1A9NB 4A8QA 2VA2A 1IM6A 2FD2A 2PEBA 3AXMA 1M5HA 3RBEA 4JI4J 2PT0A 2OH2A 2M3DA 4TN2A 4BC7A 3DM2B 3DRRB 1FF2A 3NCRA 4EO6A 5BYRA 2F1FA 1AB8A 3IO1A 4PG6A 2ZH9A 4DR2F 4DLEA 2XLKA 1EARA 2BVZA 2BYCA 3CJ3A 2YXLA 4OI1A 2HZVA 1FWLA 4DWIA 3SCKE 1MROB 3AQOA 3PRBA 2N3LA 1IQTA 2CQHA 2PEHA 1RA6A 3FNNA 2JEFA 4DQPA 2DGOA 4JI3J 2B5JA 4LFCF 1N34J 3GIKA 4I2QB 4Y28C 1LW2A 4IH5A 3PG9A 4O0IA 3GSIA 3AB2B 1I5OB 2JWNA 3IA0A 3KNGA 4F4XA 2K1RA 3MEDA 1WELA 4K4VA 5DJBA 1U0HA 2YWEA 3DHXA 1N56A 2RD2A 1Q8LA 1SBRA 4TLRA 3V4IA 1QE1A 1RT2B 1PO6A 4Q44A 1MMLA 2F4VJ 3OL7A 3NGUA 3RJMB 4IO9Q 1FJGJ 1IKXA 5J2NB 5KG4A 2Q43A 6FDRA 5J2PA 2HHVA 1AW0A 2KFZA 1FEUA 5ETVA 2XULA 1KFSA 3T1HJ 3UDVA 3W5XA 1G6BA 4GKKF 2E5HA 4DPYA 4EUVA 3DI6B 4CZCA 2D74B 5E3PA 2J76E 5ETRA 3GG0A 4A8FA 4ELTA 2NQPA 1YJVA 1L3TA 1S0MA 1TFYA 3BB5A 4BDPA 1X31C 1NJXA 3FCVA 1LXNA 1UP1A 1JLAA 4X4RA 5C42B 1IKVA 1K8AT 4QR2A 2XY5A 1APSA 2DY1A 1QRUA 4DQRA 1Q81T 3LQVA 4LF2A 3VQSA 5E3AA 3TRGA 5IQQA 2M5YA 3IRXB 1JNZB 2W2PP 5KFHA 3CCZA 1OS5A 4UY85 4ILMA 4L6V3 2V2KA 1HBOA 4FYVB 3RB6A 2FC8A 3MOZA 1O5JA 1UWBB 1Z4UA 2XYGB 3DN9A 4RLEA 5F8GA 4AXJA 1DTQA 1U0SA 2VUGA 3D3CJ 1CS4B 2W9BB 4F02A 2RE8A 3TZXA 3ULHA 4I1TA 2V8GA 5IM0B 5KFKA 2J7UA 3MM7B 3D0HE 3ITHA 2JH3A 4NI2A 2XCAA 4BC9A 2RF2B 3BSOA 5AJ3J 2XO6A 4RNHA 2RKIB 1QUPA 1X5TA 1JK9B 3ENVA 3M2VA 1R0BG 4PAAA 2NXEA 3D0GE 4UUWA 3HFVA 3LP1A 1M5VC 3CJ8A 2E7WA 4HLBA 2C2NA 3ZTRA 4J9VA 3HSJA 5DRKA 4AL7A 1WWHA 1WF1A 4ICLB 1BHNA 2BRKA 3W1YC 2XG8A 1S6PB 3GJQB 4ED0A 2RT3A 2PICA 1RAJA 2YPYA 4OYIA 1XQIA 5KT7A 3HZEA 2KT3A 3NS6A 1UDXA 4AL5A 3DOLB 3DYAA 4PWUA 4EBDA 5MAOA 1JLQB 5IZNA 1HBNA 2DRBA 4B3SF 1NJYA 1HQUA 4ZVTB 1RLCL 2GC8A 2YKOA 5A8WA 1I1GA 4NYOA 1AA1B 3MMJA 1FK9A 4OHZA 1GAOA 5DO2A 3DHWC 4NEZA 2MY8A 5F41A 4DUTA 2ZJQQ 3E2EA 2M4MA 1UEUA 2MKCA 3JYTA 2MGZA 1Q5VA 1XN9A 1IKWB 3G86A 4OHWA 4D3HA 2C2MB 2HBYB 1FRMA 3AY0A 4WJBA 5IV3A 3D67A 5KAKA 1S79A 1EETB 3VGSA 1RGVA 5GAEU 4DR4F 4LF7F 1T95A 2DCLA 3KHGA 2CPDA 3E51A 3Q2TC 2HQIA 5CAAA 2K1RB 3A8IA 3MEDB 1NJIT 2W24A 4OJHA 4ZS6A 1NB7A 4KRWA 4ANDA 2PMZD 1RT7A 1YIJS 1TKDA 2KDOA 4L73A 3EWGA 4IFVA 2FHMA 2AMCB 2FJXA 2VHGA 3KOAA 2VG5B 1WC5A 2DBBA 4U67Q 1W26A 3IAM9 1U25A 2X51A 3Q83A 4Y3CA 3IWNC 2DITA 1UVIA 4N8OA 4JI8F 3NNHA 3FRZA 1HLWA 3G6VA 1J5OA 3FEZA 3DMJA 4MK8A 2G2ZA 3SYZA 2UUAF 2HIQA 2MLZA 4DN9A 3UN5A 3M6XA 3C6TB 1XMOF 4M95A 3HVAA 2HK2A 3POTB 4DV6F 4LF5J 1N33J 2M2BA 1S0OA 1UWAA 2QG9B 1WACA 2QO3A 1ZA2B 4NYPA 1ELOA 4RW7B 3CDUA 1RTHB 1U1LA 2CNKB 2RDDA 2JLGA 5HROA 4X4VA 1UTAA 1XBWA 2YVSA 3GJSB 3FEXB 4N8NA 4B3MJ 1UFWA 3VZIA 3G2XA 5A2QY 4F50A 4HYKA 2GO8A 3BGRA 1ZJWA 1EX8A 3LOUA 4DX7A 2KH9A 1SC3B 4IG0B 4NWBA 4NCBA 3CD7A 2E5LJ 2CQ4A 3LF0A 3PYGA 3U1MA 4ATNA 4ZIWA 3OVAA 4DSFA 4R0EA 1U24A 2KXFA 4Y00A 3M30B 4MIAA 4MIBA 3R6LB 1UZDA 2GHWA 4KE5A 5A0YA 1FXRA 2UUCJ 3MMBA 3CMQA 4ENOA 1NK5A 1N5QA 2MZQA 1T8EA 5G0RB 1S0NA 2Z58B 3NP5A 2XMUA 4M5NA 4OYXA 4ECRA 4OYPA 3TZWA 4X4TA 1Q1KA 2IRYA 2OPSA 3GYGA 3UN2A 2M8DB 4IOAS 3GV7B 1JLEB 2HRYA 4X64J 4IKAA 2BMBA 3FBFA 3I5CA 4IQMA 1KEKA 4K4XA 4ZHRB 3F56A 2OKQA 1TL3A 4P9SA 1OPIA 1X4EA 2CQBA 2DEJA 5KFJA 3AB4B 2CADA 5D77A 5KFLA 3R3TA 4I7FA 2IAJA 3BBFA 5K14A 2LKZA 2QSFA 1HHSA 1Y5IB 2XMWA 5J1EA 3EUNA 2W9CB 4B3OA 1VHYA 2RRNA 5KFTA 5IV4A 5HROB 4RUBA 4DV3J 1FTRA 2XMMA 4I4BA 3IWLA 3HP6A 2VG6B 4RBVA 3KHRA 2FVQA 2U1AA 3T1HF 1X9MA 3RB3A 2FYXA 2E9ZA 1F0XA 1Q53A 4CO0A 4YHHF 4JI2F 4EK2A 3CJTA 5H9EJ 1WEYA 2RILA 2PN6A 1VRQC 3I9ZA 1FJGF 3D28A 2RUGA 2AEMA 3QMQA 3UI3A 2MZ1A 1UA0A 2FJDB 2KYXA 5KFIA 1RZMA 2OPQB 4KO0A 2D1CA 2XTJP 3MM9B 3J81Y 4C48A 3PW0A 2P8IA 4M1KA 1NHVA 2ZOMA 3BF4A 3MECA 2VC1A 2VG6A 1NDPA 3GFYA 1KOOA 4MT1A 1CULA 5HQMA 1WSVA 3E01A 3G82B 3HLUA 2BJ9A 3SQGB 3RRGA 3CEDA 1FO1A 2FQQB 3JQJA 1E6YA 1DQAA 2VBXA 5BNZA 1B0PA 3BH6B 2IVFB 4OZNA 3ZZRA 3I55S 4JI3F 1KC8T 4KPYA 1TAUA 4WCES 2CZ9A 4DL0C 4LFAF 2RIJA 4J5OA 2L9NA 4M5IA 3Q8PB 3AD8C 3F73A 1PG5B 3MFIA 2GQCA 3CCMS 2WZ1A 4DV4F 1R8BA 2BE9B 1WTFA 4DCJB 3R1LA 1KN6A 3QWUA 2ZC3A 2LQ5A 2DR8A 4K5SA 3P49B 2EC0A 5D8HB 4WFNS 2XMAA 1S6OA 1RCOB 2VODA 1W25A 3QRRA 2J5AA 1WTBA 1D3WA 2QYCA 3V2UC 5J1EB 2ATLA 1FT8A 1HBUA 2B8QA 3N0VA 5L39A 3EYZA 1Y7PA 2HVEA 2MTLA 2PMWA 2YY3A 5LJ5Y 1HNWJ 2UV8A 2X1BA 3CC2S 4KYZA 4DV5F 1R0AB 5AE3A 2AZ1A 3KUGA 1I3OB 2XSJB 2NWAA 2C2KB 3PW2A 1HIYA 1DLOA 3P8BB 5F8JA 3C6UA 1EUQA 4P75A 4WU2A 2L9WA 4UZBA 2HFNA 8AT1B 5FLXY 1F9HA 2CAJA 5IZHA 1PSDA 2VV5A 2KT5A 3MCSA 2ZZTA 1YG0A 3OLAA 2YKNB 5GAHU 2FLNA 1VQYA 1U0HB 3MR2A 4G1IA 2LEPA 2MKSA 1N36F 4AFFA 3W9JA 5KFAA 2ZNZA 2VQFF 4WE1A 2GIFA 4QPXA 2YTCA 5DM6Q 1C4AA 3UD5A 1UVMA 1P9YA 3HF5A 3OXGA 2QA4G 1U49A 2W2MP 3IR5B 4NXNF 1VRUA 5HLFA 2HWIA 1QSLA 1VQKS 1MN7A 1N6QB 3I9V9 3A4TA 3PKMA 1RJJA 2B6AB 2FZKB 2DO0A 3TEHB 3VVTA 4DR6F 5DGBA 2IA6A 3DM2A 3DRRA 3BO3A 1IM4A 3CMES 3OR1A 2R7XA 1KONA 1PYTA 1XERA 4ECYA 1FD2A 2JJ4D 2QMXA 1Q8IA 2I5JB 1HI1A 2R7OA 3B8HA 3PO4A 3M8QA 2MLYA 4OX9F 2EVZA 1KR4A 3BGLA 4OZJA 2J6SA 2HFVA 2B4PA 1YI2S 2Z4PA 1FJCA 3VQTA 3CD0A 2FHJD 1VK3A 4QW8A 3IBFB 2ZBCA 4A8SA 4QWBA 3V6DB 3GIIA 4JV1A 4OHVA 3X3UA 2XYPB 5HQ8A 1IJEB 1VBXA 2B4OA 1O51A 3DOKB 2UZAA 4C8MA 3CJ4A 3KLHB 4YP3A 3KLVA 1DQ8A 5J2PB 4HR2A 4C97A 5HLFB 3BPDA 3NNAA 2QYGA 2F8MA 1RTDB 2BJ7A 2XM3A 1SJ1A 3I5BA 3R1HA 2AP6A 3W3SA 2Y0BB 1H0HB 2ROEA 3OHAA 1VQLS 3HSDA 2QIFA 4IFYA 3ZXWA 2CG4A 3LP0B 1Q7LB 4U8VA 1VQ6S 3IR7B 2BEFA 5U47A 4QIFA 1OO0B 2GO9A 4P72A 3K17A 2NS1B 2YWHA 3R97A 2AYEA 5KT5A 4XPEA 2W2QP 2DNQA 4PXEA 2OMOA 4NL5A 1UMJA 4CDIA 4ECWA 4IOCS 1TL7B 2EFVA 1UW9A 1P6TA 3EMTA 4DR7F 3H98A 2VA3A 1WG1A 2QZ8A 1ZAVA 1QUVA 2YX1A 1V5IB 2V67A 2ZFHA 2CQCA 4C7QA 3R5DA 3CT9A 3L4BC 2MEWA 5D0HA 1U47A 2UXCJ 3H42A 4TKTA 1N5YB 2IJFA 2QL9B 5K8OA 2DR7A 1WEXA 2HMIA 2EFGA 3V4MA 4DUZJ 2B9XA 3M1VA 4WTYA 1NPKA 1SQGA 2ZZNA 9RUBA 3RAXA 3PVXA 1QVGR 4WFBQ 4ZA1A 2C2DA 4JI7F 2RKIA 3ET6B 5I3QA 1WG4A 2BE7D 2OUGA 2YWFA 3CDBA 3PEHA 4MMOA 4OZ2A 4P52A 4Y6IA 5LT5A 1S7HA 4DX5A 4DZ6A 5IM0A 1BE4A 3SDEB 3T6BA 3PW5A 5BR8F 4CO5A 4DX8H 1YJUA 2AJFE 1H2TZ 4G1PA 3QRQA 2GA7A 3FC9A 4K0KF 4XO0A 1YSJA 4DFKA 1FRJA 2J7WA 2E29A 1NZAA 4J9QA 1IWGA 1EHWA 2BA9A 2D69A 2KI2A 2RQ4A 5KTQA 2NREA 3KTQA 1JIHA 2HHUA 2ZWPA 3PDNA 1WHYA 1A0OB 1LW0B 2ZH5A 1HNWF 1GTSA 4RZRA 4ZVEA 1UCNA 4FF2A 1YX2A 2EK1A 3M8PA 5HK4A 3MM9A 3UVJA 4EYHB 1Y5LB 1PC4A 2EGVA 4CT8A 1U4BA 3P45B 3G9CA 2V63A 3HFKA 3FQLA 1YJTA 3QYYA 5IT9U 1F60B 4AT1B 2ASJA 1N32F 2MPUA 3C6TA 3V6HA 3CCRS 3GR0A 1F2HA 3BPSP 4FXVA 3UR3C 1JXLA 4PWDB 2YNGA 4H4MA 1RISA 2XMKA 1HQ2A 4UF4A 3NAIA 4HH0A 4NRUA 1VBZA 2ZUAA 4XK8C 4BCAA 2H9ZA 1S72S 3NXZA 3D6FB 2LA4A 5H1SV 4OHXA 4JB8B 2BJDA 2LVWA 3M8SA 1IWAA 2JFDA 2ZH2A 1NSPA 3NBPB 2V4JA 2GX8A 1C0UB 2JX2A 4U7UK 4ECZA 2IAJB 1TV6B 5K14B 3CW2C 1NHUA 2CPYA 2QL5B 4USHA 1PBAA 3SBMA 3KK2A 3UCUP 3T1YJ 1IR1A 2A2DA 2O66A 4PZVA 5IOLA 2R2TA 1NRKA 4IG3A 2IDLA 4CWBA 3CNQP 4QIWD 1OSCA 2FGOA 4Q5VA 1ZBTA 2DYAA 2CQIA 3CDAA 4OX7A 2HBZB 5KFVA 1RWVB 4AQYF 3IFEA 4R8UB 2HFOA 3HHLA 1T9XA 1U8SA 2GS8A 3BGUA 1NDLA 2CPFA 1PYOB 2HEKA 5DQIA 3FMWA 2J0WA 3H2VE 2AGOA 1F5AA 2XSFA 3QGHA 4QQBA 5D3GA 2IHR1 4ES2A 2G6GA 1UPPA 2DY9A 1ZAXA 3GYNA 2I1RA 4K5RA 5M2RA 1SJFA 1RWWB 1KP6A 1RA7A 4C2MA 4ZITA 4CCHA 3Q23A 1H73A 2OHDA 1P27B 1L3VA 3PXGa 1TV6A 3VAGA 1FD8A 3QLHA 2AJQA 4ZDNA 3THTA 2B5JB 3ZC4A 4YB7A 5AXNA 2BM0A 2FIUA 3MMAB 4XDDA 1Q7YT 3DRSB 5CYQA 2APOA 2BANA 2DB1A 3PNIA 4USIA 1NPRA 3VAIA 2W01A 4AE5A 1Q95G 1BQNB 2JFKA 3F44A 4ICLA 4H4MB 2ZC4A 3VAHA 2DVIA 4FKYA 1SL0A 4ZLPA 4DV1J 2VONA 3TX0A 1S9EB 3NAHA 2MB0B 4W4MA 3J81U 1RYRA 3QGPA 1PJ7A 4WU3A 5B0GA 2CX8A 1ZETA 4C8NA 1NH7A 4J9NA 2JZ5A 3IM9A 3MMAA 4QW9A 1NJWA 1S1TB 1RT3A 1YQHA 3TA0A 4JYAJ 3QLHB 4U7UD 3CJQA 1VI7A 2G0IA 2GAEA 2PD1A 3EGVA 4MAKA 4MFBA 1FNXH 2CPJA 2GFFA 2K2PA 5CCLA 3MR3A 3VAJA 2I8EA 1HBOB 3EDQB 2LECA 3HD1A 3L9ZA 3TJAA 4XAKA 3ZZZA 4ZLNA 5K8MA 5KG5A 4DV2F 1C4CA 4O3QA 2Z2YB 5E3CA 4CRJA 2V4QA 2DHXA 3MUVP 1FDNA 1H72C 4CLKA 2BE2A 2BKNA 1LXJA 1IN0A 4J7CA 3BN7A 1WC6A 3CC7S 4LF9J 4ZVSB 4NOHA 1RT7B 1O0BA 4WTOB 1VQ9S 4BWMA 1R3NA 5DGAA 1WC1A 3I0RA 2JLFA 2HS0A 2Z8QA 2W9CA 5EN1A 1S97A 5KFYA 4EEYA 2BJEA 2A6OA 3Q89A 4FXWA 1VJQA 2MMYA 4DHVA 5HMXA 4PR6A 5C25A 4NPOA 4F4AA 1U1KA 5LMUF 1S9GB 4UW2A 1RWKB 4WZMA 3VAMA 4B9SA 1REVB 1QTNB 2HFZA 3FQKA 4ETXA 2FB0A 4QIVA 5AT1B 3JB9k 1U6FA 1S1VA 2C3PA 2FHOB 4GVBA 4M5MA 2J0QD 4WF9Q 4X4UA 3CCES 1BLUA 3MI7X 4QOTA 2BBEA 2G4BA 1VOMA 1RHUB 5FDLB 1NKEA 1PJ6A 1LWXA 2LQJA 5GVQA 3FRYA 3FZBA 2R3VA 2IYGA 2G13A 1Y0HA 2EI5A 4PG4A 4ZCIA 1P1TA 4URSA 1WOOA 3R5BA 5JVHS 5AE1A 5AE2A 1Y11A 1LW2B 4F3MA 5LXYA 3KMSA 3M2VB 1VQSA 4WKYA 2XQCA 2NUHA 4AYBD 2ZJPQ 3T5HA 3M4XA 4WP9A 2OPRA 5E5NA 2BXJA 4CH7A 1VQPS 5DLGA 2XS2A 3DU6A 5BYSA 2HS4A 2ZVIA 3AOBA 1T3NA 3CGIA 3HT3A 2V94A 1RTJB 4LQ9A 4RNFA 3PACA 3AAWB 1HMVA 3A12A 1WF0A 2ASLA 3CJSA 2VJUA 3VTIA 1H7WA 2CDQA 3NS7B 4KKOB 1VGYA 2DNGA 4UOCA 2V6AA 4TNOA 3EXYA 4KGVB 2CPXA 1SKSA 4OI6A 2DHHA 4NCGB 1JJ2R 1T0TV 3BDPA 2EFPA 5L1IA 2K8GA 4U7CA 4TU8A 3L3CA 1FFWB 2W8LA 4DF8A 4B3SJ 4YY3J 3S6EA 4DPOA 3KLFA 4LT6A 2R7QA 5F0WA 5FLXU 5M2UA 3J7AN 1YZ7A 4R0JA 2YX4A 4EBCA 3D7SB 4MH8A 4ECTA 1RAIB 3MEGB 5EX3A 1VHFA 3TAMA 1HNIA 4LR9A 3NRBA 4ZP6A 5A8RA 2YKAA 2HQ3A 2PIIA 1KQSR 4EU0A 1V3SA 4WFNQ 2UVRA 2AJ1A 1RDRA 4DV2J 1ZAWA 1PILA 3DRSA 3GWCA 3SEOA 4UY88 1ZTWA 2DTJA 1RT4B 1XR5A 3FSYA 4PG5A 4Y34A 5T7LA 1Q16B 1UVKA 2WVEA 1KDNA 3SIPB 2QFJA 2WK4A 3JAMU 1CSJA 3PYEA 1MNEA 1OPZA 5D6GA 5LSLA 3UNYA 2AD9A 3DLLQ 4P2SA 4AUKA 5B0EA 3AXKA 1SXLA 1Y5NB 3ENWA 3AA9A 2EBGA 4CM0A 3MURP 4DL5A 1TKTA 3HKWA 1HFEL 1NK0A 3PTWA 3CCWA 2DCUB 2JL9A 4X4OA 1CVJA 2DNKA 3EE3A 2HHXA 5C24B 4EO8A 3W2WB 1HI8A 3OBIA 4ED8A 2HNDB 3ENQA 3KDNA 3K5OA 3R7NB 2DNNA 1YVFA 2ILYA 4NMXA 3I0SA 3GFZA 3BQ2A 4ELVA 2KTQA 1Z2LA 3Q8UA 5A8WB 3J7A1 3BZQA 2ZH4A 5CYMA 4N47A 2WBMA 3JTOA 1FRIA 4ZMMA 2WAQD 2Z2MA 3SV4A 2FLLA 1QM9A 1DFDA 1QVFR 4E98A 3KHLA 4QR1A 4TQSA 4N7TA 5ADZA 2WB1D 3A3NB 4KJIA 1FXLA 1IR2A 3CCUS 1H98A 3M8QB 3C14B 3KWMA 3M32B 1DHMA 2I9SA 2ZUGA 3HSGA 2OLWA 1OYDA 1ROFA 3QGGA 4LSLB 4PWDA 1S9EA 4NE9C 3HHNB 1TK0A 3AA8A 3SMZA 1E6YB 1FRLA 3TI0A 1DRZA 1JKHA 5E41A 2DGQA 1VLOA 2RHSB 2BANB 2KJWA 2LXUA 1T94A 3LO3A 4CTAA 3QIDA 5HMYA 2WVBA 4Y2KA 1N52B 1SV5B 4CQ1A 1VQ7S 2LU1A 1MSWD 2FTRA 9ATCB 2NPIA 2K06A 4WE1B 4C8LA 4MYTA 3NGRA 3DLLS 2Y8WA 2HBRB 2Z2ZA 3LP2A 2EG1A 4ZVQB 2OD4A 3MM6B 3P96A 4HACB 1RTJA 2BOPA 2ZJPS 3PRDA 4M5DB 4DZDA 4OYZA 2OFHX 2KFYA 1IBLJ 3PIPS 3PW7A 1T02A 5LOQA 3RW7A 4DEZA 2GMLA 3Q8VA 5B09A 3JYTB 4Y0FA 2ZZMA 2XGPA 3P5TL 2OAUA 1V6ZA 2E7VA 1C1BB 4FPRA 4LUBA 3S7RA 3ZZOA 4J9PA 4PABA 4NRTA 3HULA 4KV8B 3M2RB 5GAHW 3MAAA 3MOJB 1T11A 2KG0A 2P5VA 5BXIA 3MEKA 4P7VA 4ECVA 1TFWA 4JUZA 1RHKB 3UCZP 4E8UA 1NBEB 2RS2A 4NLGA 4P73A 3G6YA 4DR3J 2VB6A 3NGKA 4JXZA 3AD9C 4F3QA 4IO9S 1TK8A 3J7ZT 2E9RX 2KZMA 2WONB 1KHVA 3G6XA 2RVJA 3LGMA 4M5DA 1LWCB 4FVCA 3IS9B 4L76A 2BV3A 1YHQS 1TELA 2POKA 3TAMB 1M1HA 2CJYB 4MKBA 1U8WA 5CH7B 2GGPA 3NGSA 1K44A 2V34A 3B6BA 1EKRA 3CC4S 3GR1A 2KJVA 3V81A 4N5SA 2WOMA 5CYJA 1YK9A 2CPEA 1ZM4A 5DS7A 1SKWA 3O3LA 3JTPA 3GONA 3OR2B 1F3VA 1FDBA 4O3PA 4R5PA 3CZBA 1FWPA 3DLBA 5JVGQ 2C3UA 4ZPVR 4IRCA 2F8EX 2NLWA 1NAQA 2C42A 5HATA 1GXLA 1E6VB 3CDEA 5L38A 3T3FA 4FN5A 2F4FA 4NZ7A 3X1LB 3N6MA 3TZZA 4C4WA 1X4BA 2MLXA 3HKZD 4DR7J 2OSQA 1QLNA 1NK8A 4F8RA 2CJBA 1RT5B 2G5DA 1WOPA 3H0PA 3QATA 1OQ6A 2A10A 1MWYA 2HHPA 3ZTSA 3D6TB 1AUDA 4QWCA 2UUCF 4IDKA 4B9TA 3MM5A 3TA2A 2MSTA 1GXTA 1LKZA 4ED3A 1Q5YA 5IT9Y 1FRKA 2QL7B 3I6PA 3HHEA 3M1VB 1NEEA 2IM0A 1OY9A 5ETLA 3W2VB 4Q7AA 3TARA 3EICA 2E5LF 1XJWB 1TK5A 3EZOA 3K2YA 5KG7A 3W61A 1FX2A 1U6BA 2CQGA 4I56A 4LSLA 5SZTA 1ZM2A 2MQMA 2RS8A 3QIPA 3LTOA 2GJIA 4H54A 5E3QA 3SSSA 1HA1A 1T7PA 3EGWB 4F4WA 3CCLS 2V50A 1Y4ZB 4CO4A 4Z37A 4I2PA 1VCTA 3GJTB 1NK6A 2YBVA 1CJUB 3R7SB 1FFSB 3GB0A 4DOZA 2EGWA 3HHDA 4I68A 3TWZA 3CTRA 3O2IA 3UD3P 4JI6J 1XC9A 1SVDA 2IDEA 4X4SA 1BY9A 2LP4A 2WVCA 5KFQA 3ILJA 2GQQA 4A8OA 1B3TA 5KFCA 2HNYB 1K1SA 3BQ0A 3UFCX 1EQMA 1C0TA 2ZJRS 1YKWA 2HVDA 1M5PC 4UY8T 2YKMA 1RB0A 5E3RA 4K4YA 3O44A 2DXDA 1O8BA 3NBPA 3HMJG 3GYXB 2E5GA 1FESA 3OFGA 2B0GA 1H74A 2RQKA 1SUQB 2P6TA 2QJ3A 4YEAA 3D6HB 4JOUA 1S1XB 3UDLA 1U02A 4P71A 4V19J 4GO5X 1T9WA 2AWZA 4DQSA 4L74A 3KK1A 1FKOA 1RLDA 1ZA1B 5IC4B 2A1BA 2IRXA 1RADB 4WIIA 5DM7Q 4LF4F 2HAFA 3MCNA 4DPTA 1Q0NA 4KC5A 3MDFA 2KM8C 2FLPA 1E6VA 2AX1A 5ETMA 3US5A 5F3ZA 5CABA 5LMUJ 4PPDA 4B9VA 4DSKA 1YDLA 3FGVA 3HSZA 2VICA 4C11B 3ZZUA 2Y1RI 5K9FA 3SCIE 4ZPTR 4NLVA 1U1RA 1RK8A 2AJ4A 3TJ8A 3EPGA 5HANA 1RT1B 2OPQA 3N4WA 4QWAA 2ZBRA 3HM9A 4RNOA 1YJNS 4LRFA 3RU0A 4RUAA 1NB2A 1TKXA 1Q4RA 5KFMA 2CWKA 1B4SA 1URNA 5D4LA 2VJVA 1NM2A 3LPYA 4YR0A 2J8SA 4LFAJ 4F4KA 3RB4A 5GAEI 2U2FA 1EETA 1Q79A 3MUTP 4URGA 2MZSA 2EWHA 3M2UB 4DG1A 3ET6A 2J9EA 2MKHA 3IWXA 1SH2A 2HNZA 4YDXA 1FE4A 2NXUA 3A13A 1KQFB 1X5OA 2RH3A 5AJ3F 4A8WA 1DURA 1T9TA 1GX5A 2FC9A 4OZLA 5HL7Q 5HJYA 2HK3A 5ETQA 2ZM6F 3PV8A 3MAAB 4U95A 2GAGC 2O1PA 3W62A 5FDLA 2VU5A 2HHHJ 5HMZA 1UVNA 3H25A 1TL5A 4JV5J 4WF9S 3MD1A 1AUSL 4DCPB 2N82B 3NNCA 1JLEA 2M88A 4KPCA 4GRSA 1SJ4P 1HNZF 1KQGB 2XS7A 4J9RA 2GIQA 4J90A 5HAOA 2PSZA 1BC6A 5J1PA 1LV5A 1IBMF 6FD1A 2PO4A 4Q45A 1N4LA 2R7WA 1TKZA 2HURA 4JI2J 1FCAA 4BWJA 5HVHA 1K0VA 1R6YA 1QSYA 2LLZA 5I4MA 3LP0A 1VFJA 4I67A 3PCOB 3D3BJ 4I6AA 3KXDA 4JP8A 3SQOP 1UAWA 3VGVA 4C0OC 2RDIA 1KKHA 3O5TB 1YJ9S 4CTAB 3OD2A 1QTMA 3IBWA 1RCXB 4DS5A 3EGZA 1P9QC 2E44A 1Z1ZA 2P9EA 2DGSA 2QTWA 3CWJA 1V9OA 4KKOA 1NUEA 4MTPA 1REGX 2LXFA 2DGVA 1S0VA 4X64F 3MMCA 2F4VF 2R7VA 3H20A 4MFBB 4OI4A 1GFWB 4TQRA 2Z0GA 2D7SA 2KB2A 2M0GB 3O1LA 4RW8B 3SDEA 5A2QU 3MPUB 4M5KA 1S49A 2YX7A 5LM7E 3K59A 1S10A 1T05B 4JBCA 2AEJA 3GTYX 3MM5B 4F36A 2HHHF 2JLEA 5CYQB 4BBYA 4CLLA 1X60A 4WFBS 1X8DA 2NYHA 2AF6A 3I87A 1HHTP 4B9NA 4KSEB 2E1MC 1N34F 2YQ3A 1FNMA 1Y3KA 2KYZA 2XWYA 4M63A 5SUHA 5EWEA 4FS1A 4O4GA 1RWUA 2ZKTA 2JEJA 1R8PA 2QLJB 4YQWA 2CDRB 3EVWA 4DUYF 4FBUA 1NDKA 2IPOB 4P7TA 3NMAA 2N4CA 1TL3B 5HP1A 4KAIA 1NH8A 3TEGA 2CQPA 4DR2J 3JXOA 1RXOB 4IR1A 3L95X 4LRAA 3MPWA 3W2WA 3I56S 4YR2A 1D09B 1RTIA 1X0PA 4IUFA 3OFFA 4FP9A 1HNXJ 4K4TA 4USVA 3GFHA 3D54A 2WHOA 2E1RA 4X4QA 4IO1A 4RWXA 4B3MF 3RUBL 1SCJB 3HHLC 3MEEB 4G1QA 2FDNA 2Z56B 3MFHA 4AL6A 3I0SB 1JLFA 1BQXA 2XI2A 3D2WA 4ERDA 2HHSA 1UETA 5LMNJ 1RT6B 5CD4A 4I2QA 2QT7A 3TJ9A 1VRTB 1YZ6A 3PJXA 4L3NA 2RU3A 1N33F 4DR1J 3HVRA 4ECXA 3OVBA 3DU5A 4NLDA 4LF4J 4OYOA 4EMDA 3BKFA 4A46A 2UUAJ 1VYAA 2XI3A 1X4GA 4ZLLA 2FJEB 1YJWS 1H3DA 2DT9A 2IM3A 1HWIA 4KFBA 3RTVA 3MXHP 2E1CA 1MMNA 1VK8A 2LQ8A 4F7VA 2R7SA 4KH0B 1HPZA 2IC3B 2QC3A 3UO0A 4DSLA 1GXUA 3AODA 2HG4A 3K57A 4KR0B 1BWEA 3N79A 1GT8A 2D9OA 4YB6A 1WHVA 2XC9A 4QPTA 3CMAS 1RTHA 3CO9A 1Q78A 4HEA9 1NSKL 1TVRB 6AT1B 2ZNYA 2OJ3A 3KLIA 2F3JA 3UDCA 2NSBA 5KG2A 2I5JA 2VFVA 2I0XA 2PI4A 2F9JA 1CJVA 5EWGA 1K73T 2UUBJ 2UXDF 3OPKA 2H3EB 3MM6A 3PZPA 1X5SA 1ZM3A 2HGMA 2MSSA 4D3GA 3OQ2A 5M2PA 4QWEA 4ANCA 2XO7A 3GIJA 2MHEA 2PFDA 1ZH5A 2MDAA 1B0VA 4QBUA 3FSIA 4K4WA 4FF3A 4NLXA 4J3CA 3KLEA 4ZIVA 2DGXA 2G2OA 4HDGA 3OR2A 4DL3A 3S01A 1VMBA 3SFUA 1D9FA 2HS3A 1LEOA 1XEZA 4ZVGA 3AT1B 2DKOB 3C16B 2GVDA 3NWRA 3PEJA 3H8YA 4V1Ak 5B0FA 4F0MA 3HXMA 3THVA 2R2RA 3EVOA 3EXCX 2HZ7A 4J91A 4OI3A 1W2BR 5H9FK 3JQKA 3K5NA 1UFKA 3CCSS 2YKNA 5CZXA 4ZN1A 3FEYB 2HQGA 3DKDA 1TQLA 1CJVB 2CPHA 3U1LA 5MLCV 3Q8QB 1EP4B 3MZIA 3TNVA 1YITS 4P74A 3OW2R 3I82A 2KXHA 2OEMA 3RAMA 4CLFA 4WK3A 2XY6A 4M94A 2JSXA 3UR0A 1VR6A 4RBTA 1VIXA 2DH7A 5L1LA 3FCHA 2RRAA 3GCXP 5GAGU 2ZH1A 2GGPB 2C22A 3OTDA 2YKMB 4YB1P 2BJ1A 1UPMB 3EZUA 3IS9A 4Q8EA 3EX7B 2R8HA 1NZ8A 5IT0A 2JRSA 4J9UE 4FZVA 4RUCA 2KRBA 2VQEF 3K7RA 3WC2A 1PJ5A 4WFAQ 3BSCA 1NSAA 3R2DJ 1SC4B 4I6WA 3R5GA 1VJWA 3G96A 5EGYA 1F9FA 3IN5A 4EZ6A 3BO2A 1S9GA 4Q0BA 1QE1B 1RT2A 2CRLA 1VLYA 1XNQJ 4DFJA 1I51B 1R89A 1YBTA 2NCKL 3ISZA 3R27A 2J9DA 3D4JA 1IUJA 5IC6B 3Q24A 4NXNJ 4RNNA 4FS2A 4G1QB 2F7VA 3WIVA 3QSIA 3BH7B 4M5GA 3W5YA 1JX4A 1EKSA 5ETPA 2KRRA 4CLTA 2UU9J 1XWLA 2QEXS 4LMZA 1WC0A 2CG8A 1P8GA 1CULB 2DNHA 1F5CA 1HQEA 2CKWA 3M30A 4OI2A 5T7LB 1R7IA 3NCPA 4YDDB 1RTIB 3KHHA 1N36J 2DPIA 2AIRB 2B4UA 5GAHI 2GAHC 3C66A 2EKYA 4HACA 1LWEB 1RAHB 1YBAA 2HLUA 4PQUA 4IRKA 2OTJS 4PKDB 3IG1B 2DNPA 2QLWA 3N9UC 3M8RA 3V6DA 5D0GA 3W2VA 5LMNF 2VKRA 1FKOB 1DTTB 3BBCA 4M5HA 4WFXA 1YBUA 2ZOGA 3BV8A 3H2LA 3EPIA 2C2OB 4WK1A 2O01C 2LFVA 2IBKA 1EXDA 1Z85A 4WP8A 3ONQA 5KFSA 1IBMJ 2QGFB 4ETZA 1UVLA 1T05A 3DLGB 2DNRA 2R7TA 1HNXF 3POTA 1NHKL 2XZDB 4LIRA 5D0EA 5I3UA 2AU0A 1WHWA 2YNFA 2D41A 2VDHA 3EVMA 1PAUB 2E5IA 5EUHA 2ZE2A 1LFPA 4GC6A 3RW6A 3IG1A 3OXFA 4LVNP 4LFCJ 2UVWA 1M0SA 4HHHA 2L08A 1BQMA 1IKYB 5KFNA 4X84A 5HSPA 4LRDA 1TUWA 2VF3A 1WF2A 3CIMA 1QD1A 2CPIA 2W8KA 1N5VA 4CH0S 3EGNA 2MKJA 5J2NA 2J6UA 2DNYA 1RE1B 3N6LA 2HPUA 1W2IA 3A3PB 2YWGA 2FVRA 2HRTA 4BS2A 2EFNA 2AJ2A 5J2MA 4K2XA 3KUHA 2KZZA 5B08A 3G8SA 3DCAA 4IG3B 1HYSA 2B4VA 5CD4H 1GMWD 2PMHA 2XMVA 4OZ3A 1SPBP 2E5JA 1TMJA 5DZ7A 3DFEA 1AT1B 2KKHA 3DC2A 4PQAA 3KK2B 4C8YA 2XBPA 3D66A 1KD1T 2YNHB 4ANEA 2GVZA 3KK3B 3TQEA 2W7PA 3TAPA 1SH0A 3HHLB 1XR6A 1EQ0A 1NMEB 4QU7A 2H5JB 2B9WA 2X7IA 4G65A 4YR3A 4JI5F 4JYZA 2NXNA 3W7BA 4YHHJ 3AOAA 3FJ2A 1G7CB 3BREA 5DM7S 1OIAA 4ALZA 3M2RA 1WI6A 4TLQA 2YQ0A 5THWA 2WTFA 2LCWA 4NZ0A 1WOSA 2MJNA 2W4CA 3DLGA 4V194 5IT4A 3H7HB 4LRBA 1H38A 1D0EA 3DXBA 2ZHAA 1SQFA 2B8PA 2G2YA 2C3OA 4IYQA 4ER8A 1M5OC 2F5GA 1TU0B 1XR7A 4J9OA 1WNEA 1S1WA 2ZJQS 1X4DA 2LDYA 4I0WA 5KFUA 3WQPA 1YRTA 4C3KA 4JV2A 2RNEA 2XMJA 2ZH7A 4JV0A 5JUMA 4ECUA 3QGIA 3GLJA 1RT3B 2ALZA 2ADBA 2ZHBA 1GTRA 3OHBA 3B54A 4HTIA 2R2UA 4NA3A 3HPOA 4KO0B 2K3IA 4OV1A 1NYLA 5ETSA 4O3NA 1JLBA 3DDNA 3W9IA 2AGQA 1WD6A 2WVFA 5A8KA 4WP3A 2G1HA 2C3MA 2UXBJ 3NMRA 2K7JA 3I96A 2QSWA 2H5IB 2QV6A 2AX0A 2IFXA 4LBPA 4F4YA 4DL2A 1BD6A 1TAQA 3DDKA 4PYDA 5ETOA 5F3TA 3V5RA 4CLWA 1XTZA 4A8YA 1N5YA 3WZ0A 2DNMA 2O5DA 4B17A 1XNRF 3DLJA 1IBKJ 4Y65A 3MAQA 1SUQA 2J9DE 3N28A 4DQIA 2AE0X 2ROPA 4PG8A 1MWZA 3OFHA 1U1NA 1Y9OA 1CPZA 2ZDOA 2ZBIA 4JI0J 1UJ6A 4DU8A 3B78A 2GJ2A 3DLEB 1O6XA 2EC2A 2FY8A 4QIEA 3QBCA 3S1TA 2PFFB 3I0RB 1C2PA 1XMOJ 3AQPA 3W9HA 1X4CA 4LSNA 3PJWA 4ZPWR 3VF0B 1S57A 3LAKA 2KU7A 4X65J 2BQ3A 2IA0A 1FRXA 3ISNC 3JTNA 4USMA 5CCMA 4TU9A 2GVZB 3KK3A 4EZ9A 1FVQA 4JI8J 1JWWA 1AZSB 4O3RA 4FBTA 2F9DA 2CWXA 2DR5A 1FDDA 1OJ4A 3FMBA 2UUWA 3UNGC 1UZHA 2AEFA 2PGCA 3ZZPA 3G8TA 4ZJLA 4Q8FA 3MR6A 5I3PA 3PKYA 3FBEA 1HYSB 1BXNA 2QLXA 2R9LA 1D6KA 2V2VA 4ZPCA 1KVIA 2XLJA 5GADU 4H4KC 3VAKA 1NKCA 1K0TA 3SCLE 5E2QA 1DTQB 2GNKA 4ZVHA 1FDAA 1AXQA 1RBLA 4NLUA 1X7VA 2XNQA 1T9YA 2CFXA 4LF7J 3BGFA 2W25A 2DH8A 5HP1B 1U2RA 1BWVA 4DR5F 3ENAA 3MD3A 4DL6A 5D4PA 3TUZC 1VHIA 2XEXA 1N48A 4E0DA 4O3SA 3CVKA 4AXIA 4XTTA 2XGQA 3O8WA 2ACYA 4E2FB 1LWFB 3QO9A 2C2ZB 3KLIB 3CUNA 4UOHA 2BW2A 2JHEA 4C3LA 4JI0F 1CJKA 1U26A 1RAEB 4QYRA 2EW9A 2VPYB 4RW6A 5H9FJ 3PO5A 4G6VB 4CLUA 3H4BA 2AHOB 1Z2ZA 3DNCA 4O44B 1PC5A 3GJRB 1A7GE 3R2CJ 2HGNA 3HHKA 4TXSA 1HWJA 2HNYA 4Q2LA 3MHYA 3A8JA 2CZVC 4LVOP 4OYWA 3MR7A 1MLAA 4ZK7M 2CJKA 1TMMA 3LA0A 1RYSA 2BQRA 3I5AA 4U67S 1GX6A 4PCQA 1SC1B 4LFBF 1BUXA 3VHQA 5KFDA 3OTBA 2MGZB 2Y3YA 2DISA 1VQ5S 4JYAF 4C8OA 4ED7A 4ZPBA 3KW2A 4LR7A 1V6HA 2QN6B 3C15B 4FVMA 3OXLA 3FVYA 1LWCA 3ZTOA 2YH0A 1ZZFA 1EJ7L 3RR8A 3A3OB 3Q86A 2ATCB 2RJZA 3PHEA 4WWSA 2IMWP 4GVBB 2PNWA 1DLOB 2XNRA 2PDAA 4HKQA 2HZAA 2W2NP 3T41A 1JB0C 3V6JA 2XLIA 2P2CB 3AJDA 5E33A 1R0AA 4KTQA 3GPAA 3K5LA 1CQNA 3PX4A 1SB6A 2YNGB 3BGOP 1S5ZA 2OTLS 1S77D 1XMBA 2CQ1A 2W1BA 4USKA 2EK6A 3T5KA 3IGVA 3RAQA 3NOGA 1BGXT 1RWPB 4U96A 3OTOJ 1PYSB 4W92B 2FPHX 3CJ0A 4QYZJ 1Q8KA 1Q8BA 4KGXB 1RUSA 3RRHA 2YKPA 2EEYA 1DY3A 2M8HA 3M8PB 2ZWOA 4O3OA 3UVJB 2AJ0A 3QJJA 1S6UA 2VOPA 4U9RA 4N56A 2GMHA 5EWFA 3MUMP 1RAGB 2JVOA 3J81j 1B75A 1CS4A 1WEZA 4NLTA 3PYDA 4F2RA 1D9AA 1U09A 5KFRA 3FUYA 5GAGW 4ED4A 3E3XA 1HWUA 5D0RA 4FF4A 4L72B 4DN0A 1T3OA 1X4FA 2RMLA 3ETOA 1B0TA 3G82A 3SQGA 2HGLA 1C1CB 5HBMB 5DDPC 1S99A 5KFXA 3UD4P 3OL9A 1NDCA 3BR8A 1SV5A 3KJNB 1RSCA 3L7PA 3MPVA 4HI1A 2ZM6J 5K20B 4K4SA 3R7BB 2IM2A 2QA2A 4NLWA 4HHJA 4LF8J 2B43A 2DD8S 2X3DA 4P2XA 5GAGI 4ILRA 4OHYA 5B7WA 2LQBA 4ZOSA 1MW7A 1I94J 4OFZA 1WKJA 3DLKB 1HBMB 2ZH3A 5JVHQ 4UTGA 4K4UA 5KFBA 1QY7A 4HI2A 5H9EK 2FVSA 1S1VB 3VALA 3BS9A 1I94F 4J9KA 4HT5A 2OI2A 2E7XA 5KT2A 2OD6A 2AYGA 1GMWA 5C42A 1RP5A 3OFEA 4F25A 2DEIA 2DR6A 2VL1A 1N8RT 2GIRA 2BRLA 2A0FB 4NYZA 3BR9A 3S8SA 4KV8A 5G0RA 4GO7X 4DSJA 1FERA 1JXEA 3PYFA 3L09A 4OQJA 3T19A 4KFBB 2CNNB 1C1BA 2DGWA 2IMOA 4F26A 5GMKa 1OY8A 3AOCA 1HARA 2MKYA 1S4EA 1V5VA 4TY8A 3MR5A 2JOQA 3MCOA 3EZ5A 2RUSA 2DNOA 3JSBA 4KB7A 2DHAA 2ZKUA 1RWNB 3DXSX 4ID8A 3BYPA 4USWA 3HT0A 1RTDA 1S4FA 2Q6BA 1GNKA 2J0XA 2NSCA 2FHKA 1FEEA 3LPEA 1G2EA 3QNWB 3HVWA 5BR8J 2RSQA 2R8GA 4HHUA 7FD1A 4NA1A 1ZM9A 2BM1A 2DXEA 4ZVRB 2IVMA 4LBIA 4RL1A 4QYZK 4LF1A 3AH6A 2UU9F 3C16A 3JSMA 4ZCKA 4F04B 4ZPDA 2P9CA 2RF2A 4ECQA 2BQUA 3HFZB 2W4PA 3IP0A 4WPAA 3M6UA 4DBQA 1IR0A 3KJFB 2CQDA 2RB7A 5CXTA 2J9CA 3Q8RB 2DIUA 1UL3A 4ECSA 2HVZA 2OGUA 1HBMA 2DGTA 3KJQB 3MCMA 4Z7CA 4X62J 2B56A 2DHSA 2YNFB 2KM8B 2VIHA 3TVZA 4WXWA 1RAAB 2RQMA 3FZ2A 5J2QB 1NCLA 2DJWA 2RE1A 2VC0A 4X66J 1DJ0A 3FBBA 2BX6A 3HCXA 4UT4A 4IDKB 1TVRA 2MQQA 3J7Z5 1VRUB 3TOQA 1IKVB 1RU2A 4XIUA 1LWFA 2F63A 3BJYA 4DV0J 1RT5A 3KNAA 2FVPA 2ILZA 4B02A 4EFAC 5F8HA 3CJKA 3DOMA 3SV3A 3MMCB 2DIVA 1JMTA 1U45A 3DMJB 4W98A 4U6PA 2I6WA 2BKOA 2BJ3A 1M5KC 3ILOA 3UDEA 4TU7A 4H4OB 1KOHA 3GE9A 4X2BA 3H5YA 3R6GB 5HO4A 4FNIA 3QT8A 4ZN3A 2F40A 4KHRA 2ALYB 2RQCA 3Q8YA 2ASDA 2YNHA 1KVJA 4YY3F 4IFVB 1VBKA 1F1BB 2GHVC 1WHXA 1HW8A 2RU9A 2W4DA 2XSJA 2CNOB 3R5CA 3M05A 2MQNA 3O6QA 2D3OR 2VPXB 3T9ZA 3CB4A 3SCJE 3W60A 3AD7C 4C6AA 4DPUA 4H4KA 2XY7A 2VASA 5L9NA 2C28A 3KDOA 4I2PB 3H59A 4OX9J 4C8KA 4X66F 1TUVA 3K89A 4EI2A 4OX8A 1TL4A 1VC0A 2FJWA 3DYAB 5AXMA 2ZBPA 2NYIA 2NZCA 4X62F 4X4PA 1JJ4A 4JV5F 3UPFA 8RUCA 5BYQA 4IH7A 1NU4A 5F9NA 1VDHA 1BQMB 2HWHA 5JJBA 4B3RJ 4GMKA 3PIOS 1G4CA 2BZ2A 2ZD1A 3C15A 3QAUA 4KH1B 5C7PA 3GIMA 4A8KA 1D9DA 2YNIA 1HBNB 3HJFA 2D3ZA 1F3FA 1QJHA 2V2QA 4KHPF 3DOLA 1U6ZA 1NNDA 1KVKA 3CJ2A 1WI8A 4USUA 1FX4A 4FXDA 4LF6J 1O0PA 2OFGX 3N5BA 4PG7A 3GMGA 1WKLA 1YWXA 2BOAA 2V4RA 4OJ3A 1S1WB 3NS5A 2FJAB 2ZHOA 4RKUC 4IG0A 4RO0A 4IQXA 5A8KB 2VPWB 3OJUA 4K7QA 4QIGA 3ADAC 1WC4A 1IQZA 3GQCA 2EKNA 2FZGB 3H40A 3BEGB 1RTZA 3K58A 1ULRA 3MTKA 1HL6A 3FFIB 4HVZA 4LREA 3BSNA 2KFNA 5HBMA 4B9LA 3GILA 2WCXA 2EFQA 2HWTA 2LMIA 3VCDA 3KLGB 2DRDA 4N77A 2Y1IA 2YQ1A 2HQFA 3MM8A 2UVUA 2YNIB 2WVDA 2HFSA 1FKPA 4L75A 1OY6A 3IRXA 4ITSA 3TX8A 1IXKA 4GKJJ 3P3DA 1IBLF 4FYWB 4LBHA 4DV4J 1FE0A 3QAEA 1DARA 2ZDPA 1H2VZ 2FJVA 2N4DA 1T03A 3H5XA 3OT9A 3CJRA 4DUYJ 4A8XA 4J9LA 2IIHA 4OZ5A 2V2ZA 2RHQB 1X0FA 1S76D 1H2UX 1PIEA 5C5JA 5E7OB 1HWLA 1RHRB 1EUYA 2V8VA 3D1QA 3K0JA 5C24A 2GW8A 2WBRA 1FA0A 3CCVS 1S1UA 1S6QB 4MIWA 1U1QA 1U1MA 4GC7A 2DRAA 4EBEA 3LWLA 1F5BA 1KS2A 2CVEA 2YPZA 3LAMA 3K5PA 5D3GB 1HWKA 4OZ0A 2DK2A 2E1PA 1CG2A 3G87A 3GZ7A 2HW3A 2BE2B 2QMUB 3T6JA 4ED6A 3ILIA 1K9MT 1MWQA 4CP5A 4RWWA 3HZGA 3QSYB 5F8IA 1ZYQA 3VVUA 2QMWA 1KBRA 4HT7A 2XB2D 3QJPA 3ZO7A 4K59A 2R7UA 1UKUA 1S59A 3FDSA 2IVYA 3N5FA 1VQ4S 2OIHA 4RW9A 3TA1A 4RU9A 1ZZNA 1IBCB 4URQU 4YB5A 3UCGA 3F0NA 5ETNA 2R7RA 4RW6B 4F4ZA 3J80U 3K5MA 1JLCB 2LU2A 2HQDA 2PJJA 1J5EF 3QZ8A 1MN9A 3K8WA 1GTEA 3D0IE 3OUYA 2H48B 3KJVB 3PM9A 3PX6A 2FVCA 3TANA 3U7JA 4AQYJ 3PFOA 1CJTA 2I38A 2BACA 4LIWA 3KG4A 4YOEA 4CT9A 1SIWB 1MU2A 3AHPA 4OV6A 4CLYA 2BDPA 3DRXA 3THPA 4XDCA 5FD1A 2HVHA 1OQ3A 3OSPA 3ITHB 1H6KX 2VG5A 3K8VA 3NGDA 1ITPA 3AIIA 3Q22A 1DTTA 2HZCA 3NWGA 4ES3A 3MWBA 2W9BA 5JVGS 2B9EA 5LJ3Y 2VOOA 4DR4J 3ZZTA 4F3OA 2CIMA 1NKBA 4LFBJ 1T9VA 4Y2MA 2CJQA 2JEIA 4LRCA 2PI8A 1KHWA 1KLMA 1HHQA 1RACB 1BMQB 1LWEA 1YLXA 2XZWA 3BYRA 4FKXA 2V69A 4GKJF 1QTQA 4MKVA 1U48A 1D1UA 3NEKA 5D4NA 4ZVUB 1LOUA 2CNLB 2OMLA 4NLSA 2QA1A 4OYAA 4P6QA 5L8RC 5HVGA 1NK9A 4MKYA 1XIQA 4OLPA 1H7XA 1UEKA 1RT6A 2NR0A 5F8NA 1L3SA 3PW4A 5KG3A 1JLAB 1KTQA 2HBQB 1VQOS 1WJ9A 4IR9A 2AKWB 1FHTA 4Z7YA 2OO4A 3MEEA 1X9WA 1OYEA 4ZPAA 1KSPA 1HQUB 3PFEA 3VWSA 2V9WA 1D8ZA 1QAJA 4ZP8A 1XMQJ 1ZPVA 2EG2A 3KMQA 2AW0A 5A6PA 3IMQJ 2M70A 7FDRA 4KGKA 4KT0C 3U02A 1SI9A 2QE5A 1VIOA 2CJXB 2MQ8A 1IKWA 1KQKA 3U27A 1SJ3P 1FKAF 1DBDA 4N41A 3CJ5A 4O23A 3RZAA 3SI8A 1EP4A 4FPIA 2F8HA 2QLBB 3FBCA 3V4IB 2JNJA 3GSDA 2H65B 3ETMA 1X9SA 4JI7J 1FKPB 1QAYA 2A3JA 1S48A 2KT2A 3P4UB 3TYTA 1F2GA 3DRPA 2YWKA 5J1NA 2MXYA 5ETTA 3CO0P 5KG6A 3CCJS 5D4OA 1WDDA 1MMDA 1N5SA 2MYFA 1HD0A 5AXLA 5IWAJ 3FKBA 1KNZA 3CCQS 4B3RF 2RD5C 3PRVA 1U7LA 3H5SA 5HQLA 4WYWA 3RG6A 2HVIA 4JI6F 1J2VA 3M9OB 1DFUP 1VQMS 4GVLA 4PWWA 4TY9A 5CQGA 3DOMB 4V19X 3ZNUA 1M5SA 2GVDB 5T14A 2Y9HA 4K2JA 2J0SD 2VFRA 4XPCA 4I69A 2H4YB 3B82A 1XMQF 1F9EB 4CLSA 4RW7A 3V81B 3CIZA 2XCPA 5A6WA 2FY1A 3DRPB 1JKHB 3TW0A 4EYIB 2VPZB 2HMIB 2IRUA 1CJTB 2E1AA 2OELA 1URRA 3GIRA 3RGIA 3IXQA 3OR1B 3TR5A 4LF9F 2B7CB 3VR1A 1J27A 1Q86T 4W90B 2WSCC 1IVZA 2GMJA 2B6AA 3L7UA 1GH8A 2CA9A 2Z57B 1UEVA 2OPPA 2CYYA 1B70B 3NCQA 3KFWX 2AYMA
chains in the Genus database with same CATH topology
2L9DA 4NLPA 5KFGA 1KTVA 2UV8G 3TUJC 4DLGA 3GV8B 3SFGA 1HPZB 2IC3A 2MZTA 5B0BA 1LFWA 4IRDA 3DI6A 1JLFB 3CD6S 3TQ1A 1TP7A 4R25A 2Q6CA 5J2MB 3PR4A 3BN4A 3UE2A 4X4NA 4NZ6A 2Z2LA 2KN4A 2VG7B 1Y00A 2C3YA 3LALA 2FHJA 3QIPB 4QZVB 1CEZA 4P2BA 3DLEA 5HL7S 3I4HX 4B9MA 4CO1A 1RQ0A 3SXLA 1N54B 4CO3A 4Y2AA 4FF1A 4PRFA 4O4GB 5KG0A 3G8QA 4HTJA 2MKIA 2OP5A 2ZJRQ 4DL7A 1DZ5A 2D3UA 2VBWA 4RW4B 4MK9A 2UP1A 3ZZYA 1M90T 5K8PA 4C0HA 4CO2A 1YRXA 1B7FA 4CI0B 3MTJA 4DJBA 4IH6A 3C2PA 4LQ3A 1S9FA 1ZOTA 1PGZA 1YTYA 4DR3F 2LEBA 3RBDA 1N0UA 3MEGA 4PXBA 4A4JA 1AFIA 5G4DA 2Q79A 3MM8B 4CH1A 4O4RA 2N3OA 3KJVA 4PQUB 3KLFB 2WSEC 3M32A 3TVYA 2CQ2A 1QAIA 3V6KA 2ZH6A 1N6QA 2X3GA 1GQEA 2HVHA 1SJRA 1FXDA 2X1FA 3NL0A 4JXXA 2ZITA 3UWTA 2SXLA 3SSRA 2AYBA 2KG1A 1YJRA 3CDWA 2DNZA 4BHQA 3OSNA 2R8KA 4YFUA 2HAIA 4RNMA 2I2YA 2PC6A 3QJLA 5HMWA 5D78A 4CNYA 5HN0A 2E66A 5DDOC 4LF8F 1UJ4A 2DR9A 2KHCA 5DETA 2AGPA 1WG5A 1FTCA 4ZCLA 3CXCR 2GV1A 2VKZG 4JI4F 2COLA 4USJC 2LXIA 1JLGA 5KFFA 3RYLA 4QCLA 2GHPA 4DV7F 4ILLA 1TL1B 4F67A 1UFLA 5KFPA 5GADI 3G4SS 2ZOFA 5KOWA 1Q82T 1SKRA 2AQ4A 3MGJA 4KQZA 3SSQA 1FVSA 1KFDA 2O3DA 3LWMA 1HNVA 4OIXA 4ZVFA 3WC0A 5DDRC 3CPWR 4G3IA 1TL1A 3FSXA 4J9MA 4DV3F 4I6YA 2N7CA 3LP1B 4DFPA 3E01B 3J80Y 3N01A 5KT3A 4ED2A 5KOXA 1CLFA 3PIPQ 3MECB 5FIIA 4MJKA 4NXMF 2LQ9A 3OJSA 1I6JA 3BSAA 3OL8A 1CC7A 4H4OA 4ELUA 2O67A 2UXCF 1KLMB 5IXUA 3QZ7A 1IKYA 2MZJA 5ITHA 3BGRB 2HLTA 3DGPA 1G3OA 1HI0P 4CNZA 2ZE2B 4PUOA 2H5EA 4O44A 5L9XA 5DG8A 3J7YU 1ZPWX 4ID5B 3KK1B 4HH1A 5B0AA 2B7BB 1L5UA 1RKJA 3DLHA 2V0NA 2OSRA 3QPIA 4B3TF 2C2RA 2Q66A 1S1XA 4RW4A 3CE8A 3Q2SC 2GCFA 2WW8A 1MU2B 4OX6A 4WFZA 1XK8A 2JDJA 2MQLA 4Y2CA 2WSFC 3J7YI 5CYMB 2P9GA 2ZD1B 3F41A 2BABA 2HYIB 3ICLA 3KKFA 1OSDA 1J5OB 5F8MA 1R8AA 4NCAA 5DQGA 2NUUG 3D1OA 5LSRA 3M9NB 3TAQA 4EGLA 2OPSB 5KT4A 1TR0A 4OJGA 2FGCA 1HQEB 2HHTA 2DGUA 1TKTB 2CJ9A 3LGNA 4DF4A 2N7YA 2ZVSA 4ED1A 4DV0F 1NK4A 1JLGB 4LF5F 5F0UA 2G1DA 4ZP7A 5L1KA 2IJNA 1FJEB 2M52A 2A2CA 5I42A 2IYIA 1AROP 3I4PA 5DDQC 2HHQA 1V3RA 2HHWA 2JC1A 4C0BA 1FRHA 1FK9B 3SZ2A 2J6TA 3CCTA 5IWAF 5IFMA 3OTEA 2JEGA 1X4AA 1OWXA 3C46A 3BDEA 1IKXB 1JLQA 5AXKA 4Q43A 3I32A 5KFOA 5KFEA 3TVKA 2DNLA 3R5AA 4QR0A 4WFAS 5E0OA 1LK5A 2ABYA 1NO8A 2B51A 4X65F 3MF5A 4I64A 2EFOA 2VZ9A 3HDSA 1R8CA 4C98A 1ZTTA 1N5TA 4NLRA 4OJ1A 4DR1F 3GFXA 1VBYA 2V8DA 4ZP9A 3I31A 4C3MA 3HO1A 1R43A 1KLNA 2E9TA 5LSOA 1SH3A 2R8JA 4M8LA 2OPRB 1RI7A 5LXRA 3VAFA 5EHHA 2V5HG 2MY7A 1UWBA 3E8OA 3JSYA 4K4ZA 2XS5A 3MPYA 1K1QA 5CZVA 4HDHA 4NLOA 1G1XA 5F9LA 3RB0A 4JI1F 1LQ9A 1U1OA 2NZ4A 5FJ4A 2CJAA 2VG7A 5T41A 3T1AA 2VBZA 4Z2XA 1Y3JA 2WONA 4DFMA 2KHDA 2LDIA 3C6UB 1N88A 2JVRA 2LEAA 3C8YA 2AV5A 4LSNB 2MJUA 4HL9A 3PX0A 2CVIA 3LANA 1LK7A 4QU6A 3GV5B 5B0DA 4EWTA 4NA2A 5LL6d 2MQOA 4Q2MA 2PA8D 2DHGA 3IC1A 3BQ1A 1QAXA 2IBOA 4IOCQ 5F8LA 4A8MP 1SIZA 2W9AA 2ERRA 1D8YA 2V4JB 1X5PA 4ZKAA 4KGMA 4TYBA 4DV1F 2EPIA 3TP2A 3M2UA 4DG1B 3HI9A 3IRWP 1S6PA 5EX0A 4C9DA 3NLCA 2W7AA 3DLKA 3UQSA 5A8RB 3CF5Q 3MAHA 4QJVA 2PE8A 1L3UA 2B3TB 3IAS9 1CQMA 2Y1JA 1JLBB 1RKIA 3TUIC 5A0YB 4MYUA 1VC5A 1JJHA 4NLYA 1LW0A 1UW4A 3G71S 4H3SA 4C11A 3OTOF 2D9PA 2K3KA 3A1YG 2NPFA 5K8OA 4DSFA 3OL9A 2DH9A 3NKYA 1C1CA 2J8AA 4RUHA 1N0VC 1GH8A 3DOKA 3RRKA 1DQ9A 2CQ0A 5KFWA 2M8DB 3LP2B 3Q0AA 1U2FA 1TKXB 2MHNA 4FNHA 1HMVB 4WKRA 1SL1A 3D5MA 2MKKA 3NG8A 2Q1LA 4OMFG 3PIOQ 2RRBA 1UJ5A 1CC8A 2M7SA 2ROGA 1BQNA 3DRYA 1A6LA 2BUNA 2PA3A 3M6VA 4DQQA 3T1YF 4B9UA 3N6NA 1KRPA 3T5LA 3T9NA 3HVTB 3CULA 4B3OB 2BR0A 3LW5C 2DO4A 5J2QA 4RW8A 4RW9B 1VS3A 4I7FB 4PUOB 1C0TB 4UQGA 2G9OA 3RR7A 4A47A 4OZ1A 4ZHRA 2VH7A 2L48A 3D1HA 3PY8A 5DM6S 1V3ZA 3KYLA 5KFZA 4QWDA 2G0CA 3Q8SB 4YUDA 1QRTA 2WB4A 1NK7A 3CF5S 5IS2A 2WOMB 1VRTA 1R27B 3LH2S 4K50A 5C25B 2B9YA 2EBEA 4WFYA 4N76A 3ZZ0A 3B4DA 2VBYA 5K8NA 1R8HA 2YH1A 2Q3PA 2UVVA 1SJQA 5HI7A 4DSEA 5B0CA 4DMZA 2QRRA 3JSRA 1C0UA 5DLFA 1RT4A 3WDOA 4YMEA 4OL8A 3OVSA 3IR6B 2VFUA 2JC0A 4TY8B 2M9KA 5GADW 4J9SA 3OTCA 4LF6F 3BO4A 1S1UB 2VFTA 5JXSA 4NMLA 3ZFVA 1R31A 4DS4A 1YRUA 3GG1A 3HVTA 3KG0A 4DUZF 1P1LA 3WBZA 2HNZB 2OPPB 4IOAQ 1XNQF 3QO9B 5CA5A 2IM1A 4NX9A 3AJ2A 3QWPA 3HX9A 1UA1A 2DPJA 1X4HA 2MZRA 3CD5A 3TO8A 4CIOA 3PR5B 4IOBA 4J37A 4PPZA 1FNOA 2GQ2A 2R2SA 5K5MA 3KLGA 3IGNA 3ISND 4KIAA 4A48A 2KXNB 3OUYB 1RT1A 1FEHA 4MK7A 3HK2A 1HR0F 1HW9A 4FYDA 2P6SA 2V8HA 4R5PB 3FFIA 1JLCA 2PI5A 5IQ6A 4OI0A 3MM7A 2LA6A 1VQ8S 4ID5A 2L41A 2A18A 2QA4S 4RX6A 3H5UA 4MKAA 4C8ZA 5L1JA 3M6WA 4ED5A 1FJ7A 4ZCMA 4Y2IA 1TKZB 1L3KA 1IBKF 2CQ3A 4WYLA 5EDWA 3P6YC 2K7KA 2FLOA 2Y0SD 4WCEQ 4R8UA 1HD1A 4TYAA 1TZ0A 4F2SA 4WXOA 1VC6A 3BM7A 3UW1A 1IJFB 2ASYA 3T5JA 2KVIA 4PXDA 4DDFA 5DQHA 2UXBF 3KG1A 1S6QA 3AJ1A 2FJBB 2YKQA 1QRSA 1HNVB 2LYVA 5DG7A 1HBUB 1B64A 3L7OA 1GTHA 1DAXA 3H2UB 2X1GA 3OV7A 4WZQA 1SC6A 2HNDA 1QSSA 2UUBF 1T03B 3WX4A 3J7ZV 2W7OA 1REVA 3JAMY 4LJMA 3U1NA 5BJRA 2R8IA 2C2EA 2R4FA 5I42B 1SL2A 3VZHA 1VQNS 1JNRB 2XMTA 2VD3A 2MQPA 2KO1A 5KT6A 3CSKA 3HHLD 5CHCB 3C3LA 3MMBB 3H4DA 4RU2A 1YGYA 3CJKB 4IFYB 4KBIA 4NLQA 2J7KA 4OLOA 2RDJA 1NJZA 3A8EA 2HRUA 4RBUA 2XWXA 1S1TA 2CZ4A 3B4MA 3LUYA 1MROA 4KHMA 4DSIA 3KLHA 2CPZA 2V9KA 3KLEB 3M9MB 4Q0BB 2XHWA 3G6ES 2L3MA 2WRMA 1O0CA 2VFSA 1HNIB 5DG9A 1SQEA 2UUTA 3OL6A 5I3UB 4PXCA 4B08A 2FUG9 5GAEW 4ES1A 4DL4A 2X1AA 1AFJA 4NCGA 4UQTA 5KG1A 3OLBA 1U1PA 4UUXA 1A9NB 4A8QA 2VA2A 2FD2A 1M5HA 3RBEA 2PT0A 2OH2A 2M3DA 4TN2A 4BC7A 3DM2B 3DRRB 1FF2A 3NCRA 4EO6A 5BYRA 2F1FA 3IO1A 4PG6A 2ZH9A 4DR2F 4DLEA 2XLKA 3K0JA 2BVZA 2BYCA 3CJ3A 4OI1A 4DWIA 3SCKE 1MROB 3AQOA 3PRBA 2N3LA 1IQTA 2CQHA 2PEHA 1RA6A 3FNNA 2JEFA 4DQPA 2DGOA 2B5JA 4LFCF 3GIKA 4I2QB 4Y28C 1LW2A 4IH5A 4O0IA 3AB2B 3IA0A 2JWNA 3KNGA 4K4VA 4F4XA 2K1RA 3MEDA 1WELA 5DJBA 2YWEA 3DHXA 1N56A 2RD2A 1Q8LA 1SBRA 4TLRA 3V4IA 1QE1A 1RT2B 1PO6A 4Q44A 1MMLA 3OL7A 4IO9Q 1IKXA 5J2NB 5KG4A 2Q43A 6FDRA 5J2PA 2HHVA 1AW0A 2KFZA 1FEUA 2XULA 1KFSA 1G6BA 4GKKF 2E5HA 4EUVA 3DI6B 4CZCA 2D74B 5E3PA 2J76E 4ELTA 3GG0A 4A8FA 2NQPA 1YJVA 1L3TA 1S0MA 1TFYA 3BB5A 4BDPA 1NJXA 4X4RA 1LXNA 1UP1A 1JLAA 5C42B 1IKVA 1K8AT 4QR2A 2XY5A 1APSA 1QRUA 4DQRA 1Q81T 3LQVA 3VQSA 5E3AA 3TRGA 5IQQA 2M5YA 3IRXB 1JNZB 5KFHA 3CCZA 1OS5A 4UY85 4L6V3 2V2KA 1HBOA 3RB6A 2FC8A 3MOZA 1O5JA 1UWBB 1Z4UA 3DN9A 4RLEA 5F8GA 3K58A 4AXJA 1DTQA 2W9BB 2VUGA 2C22A 4F02A 2RE8A 3ULHA 4I1TA 2V8GA 5IM0B 5KFKA 2J7UA 3MM7B 3D0HE 3ITHA 2JH3A 2XCAA 4BC9A 2RF2B 3BSOA 4RNHA 2RKIB 1QUPA 1X5TA 1JK9B 3ENVA 3M2VA 3D0GE 4UUWA 3LP1A 1M5VC 2E7WA 4HLBA 5DRKA 4AL7A 1WWHA 1WF1A 4ICLB 2BRKA 4ED0A 2XG8A 1S6PB 2RT3A 1RAJA 5KT7A 3HZEA 2KT3A 3NS6A 1UDXA 4AL5A 3DOLB 3DYAA 4PWUA 4EBDA 5MAOA 1JLQB 5IZNA 1HBNA 2DRBA 4B3SF 1NJYA 1HQUA 2GC8A 2YKOA 5A8WA 1I1GA 4NYOA 3MMJA 4OHZA 1FK9A 3CC2S 1GAOA 5DO2A 3DHWC 5F41A 2MY8A 2ZJQQ 3E2EA 1N32F 2M4MA 1UEUA 2MKCA 3JYTA 2MGZA 1XN9A 1IKWB 3G86A 4OHWA 4D3HA 3AY0A 4WJBA 1FRMA 5KAKA 1S79A 1EETB 5GAEU 1RGVA 4LF7F 1T95A 2DCLA 3KHGA 2CPDA 3E51A 3Q2TC 2HQIA 2K1RB 3MEDB 1NJIT 2W24A 4OJHA 4ZS6A 1NB7A 4KRWA 2PMZD 1RT7A 1YIJS 1TKDA 2KDOA 4IFVA 2FHMA 2FJXA 3KOAA 2VG5B 2DBBA 4U67Q 3IAM9 1U25A 2X51A 4Y3CA 3IWNC 2DITA 1UVIA 4N8OA 4JI8F 3NNHA 3FRZA 3G6VA 1J5OA 3FEZA 3DMJA 4MK8A 3SYZA 2UUAF 2HIQA 4DN9A 3M6XA 3C6TB 1XMOF 4M95A 3HVAA 3POTB 4DV6F 2M2BA 1S0OA 1WACA 2QO3A 4RW7B 4NYPA 1ELOA 1U1LA 3CDUA 1RTHB 2JLGA 5HROA 4X4VA 2YVSA 1XBWA 4N8NA 3FEXB 1UFWA 3VZIA 4HYKA 5A2QY 4F50A 2GO8A 3BGRA 1ZJWA 3LOUA 2KH9A 4IG0B 4NWBA 4NCBA 3CD7A 2CQ4A 3LF0A 3U1MA 4ATNA 3OVAA 4R0EA 1U24A 2KXFA 4Y00A 3M30B 4MIAA 4MIBA 4KE5A 2GHWA 5A0YA 1FXRA 3MMBA 1NK5A 1N5QA 2MZQA 5G0RB 1S0NA 3NP5A 2XMUA 4ECRA 4X4TA 1Q1KA 2IRYA 2OPSA 4IOAS 3GV7B 1JLEB 2HRYA 4IKAA 3I5CA 4IQMA 1KEKA 4K4XA 4ZHRB 3F56A 2OKQA 1TL3A 5KFJA 1OPIA 1X4EA 2CQBA 3AB4B 5D77A 5KFLA 3R3TA 4I7FA 2IAJA 5K14A 2LKZA 2QSFA 1HHSA 1Y5IB 2XMWA 5J1EA 3EUNA 2W9CB 4B3OA 2RRNA 5KFTA 5HROB 1FTRA 2XMMA 4I4BA 3IWLA 2VG6B 4RBVA 3KHRA 2FVQA 2U1AA 3T1HF 1X9MA 3RB3A 2E9ZA 1F0XA 1Q53A 4CO0A 4YHHF 4JI2F 5H9EJ 1WEYA 2RILA 2PN6A 3I9ZA 1FJGF 3D28A 2RUGA 3QMQA 3UI3A 2MZ1A 1UA0A 2FJDB 2KYXA 5KFIA 2OPQB 4KO0A 2D1CA 3MM9B 3J81Y 3PW0A 4M1KA 1NHVA 2ZOMA 3BF4A 3MECA 2VC1A 2VG6A 3GFYA 1KOOA 3E01A 3HLUA 3SQGB 3RRGA 3CEDA 1FO1A 1E6YA 1DQAA 2VBXA 5BNZA 1B0PA