3W2VB

Crystal structure of the cmr2dhd-cmr3 subcomplex bound to 3'-amp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
322
structure length
281
Chain Sequence
MIEVTFTPYDIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRITVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Cmr2-Cmr3 Subcomplex in the CRISPR-Cas RNA Silencing Effector Complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Immune system
molecule keywords CRISPR system Cmr subunit Cmr2
total genus 61
structure length 281
sequence length 322
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3w2vB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3w2vB03
3W2VB 4H4KA 3W2WB 3X1LB
chains in the Genus database with same CATH superfamily
1ZM2A 1QUPA 4OFZA 5ITHA 4JI0J 2ZH6A 4DR5J 2E9TA 2XBPA 2JC1A 3CE8A 1LWEB 1MWZA 4J9MA 3NMAA 2VPYB 5KFSA 3A1YG 4I2QB 1TR0A 2IM0A 1WUUA 1BQNA 1T02A 1VS3A 2DHHA 2OMLA 2OPSB 5HAOA 3TX8A 3K59A 2IM3A 5L38A 5BR8J 2FJVA 3KK3A 3S8SA 4A8SA 4NPOA 2CQCA 4CTAB 4ED3A 2FC9A 2QMXA 3E51A 5IM0A 4GVBB 4GKJF 2XGQA 4Y28C 2V2ZA 5JUMA 1HR0F 1D8YA 1S77D 3CJKA 3VAHA 3AA9A 1YTYA 3DOLB 5KFWA 2CNLB 3HSDA 4TN2A 5BYSA 1CEZA 2HRTA 3QPIA 3ZNUA 3CO0P 1FKPA 1VHKA 2FZCB 1Q95G 1RTJB 2AYEA 2B9XA 1GNKA 1TKZA 2IAJB 2MQMA 2Z2YB 3CDAA 3UWTA 1IBKJ 4IR1A 4DX8H 4KB7A 4XDCA 2ZOMA 4LBPA 3ETOA 2Y8YA 3M7VA 5I42A 1C4CA 1ZS6A 2LDIA 2JJ4D 4QR1A 2D3ZA 3Q83A 4PYDA 2UUAJ 1S76D 1FX2A 4X4RA 5ETKA 3CF5Q 2FLNA 3H5SA 3IG1A 2XMAA 3PKMA 2W8LA 4CQ1A 3RBDA 2LEPA 3IWXA 3MMAB 5KFGA 2WVDA 2GV1A 2Z8QA 3MECB 3T9ZA 4YS2A 4YY3F 3VGVA 4DV3J 3DRSB 2OKQA 2AGQA 3TI0A 2JC0A 4CT9A 2VG6B 2E1CA 1QUVA 3KUGA 1XWLA 3M2VB 3BN7A 4CO5A 4LQ9A 2DEIA 1IQZA 2BJ3A 4FKXA 4NRUA 4QPTA 4YY3J 1ZZFA 1DY3A 2R2RA 1FXLA 3MM9B 3O5TB 4NXMF 1FO1A 4C8ZA 4M5HA 1T9UA 4DUZF 2KFNA 1CPZA 2VH7A 3PJ9A 3V6JA 4LF1A 1HNVA 7FDRA 5EWFA 1GMWD 3D28A 4AXJA 3T3FA 2K06A 2DVIA 2QMUB 3IS9B 3K8WA 3LGNA 3HPOA 4ZMMA 2KRBA 2XY5A 1CC8A 1CJTB 2ZBIA 3GB0A 3ILLA 4LIWA 1IJFB 3NCQA 3UR0A 1JJHA 4NLRA 4ZLPA 3H20A 3MEGB 4EWTA 2CJQA 1F6TA 2RF2B 5HJXA 3WX8A 4J9LA 5DM6S 1JLEB 1HL6A 1S0VA 4QU6A 3ZTPA 3W65A 4NASA 5LMUF 1FVQA 4HLBA 5GMEA 2OD6A 3PV8A 4DSJA 4JYAJ 3DU5A 5JJBA 4DUYJ 1NH7A 2EG1A 3OVSA 1FEUA 3VAKA 3DN9A 1FRXA 1HBOB 2ACMA 1PBAA 3I0SA 5IV3A 2W9CA 1WTBA 4PKDB 3G4SS 5B09A 3HJVA 4DFMA 1HD1A 4ZPTR 3VGTA 1G2EA 1H74A 2CIMA 3D1HA 4X84A 3HVTA 4HTJA 1I1GA 4ETXA 2C2DA 3CZBA 2AEJA 5CZXA 3UPFA 2MQNA 3W5ZA 2V9KA 2MJUA 1N56A 1N54B 2HHQA 1ZOTA 2PICA 2Z57B 4DV0J 1IKYB 2JVRA 4RUAA 3MUVP 2DCLA 1VIOA 1X5TA 3MPUB 3T5LA 1V5VA 1U0SA 2Y8WA 2FPHX 4QWDA 3KLGA 1R6VA 4CTAA 4X65F 4O3PA 3T1YF 3V6DA 4HDGA 1VC0A 3Q8RB 1QAYA 3DOMB 1G6BA 5H9EK 2J8AA 4I2QA 1DTTA 4L76A 1EKSA 3B78A 5CYQB 1OY6A 2B51A 5D0GA 1HA1A 3SMZA 4DR5F 3TUPA 4QU7A 3W8GA 2XSJB 1RT6B 4CLYA 4HDHA 1KLMA 3T1AA 3CJ8A 4TYBA 3OHBA 2W7OA 3SYZA 2VU5A 2MQ8A 1RT3A 5GMKa 2OTLS 2E9ZA 3SQOP 2C2OB 3D9BA 1JXEA 5CYJA 4PPZA 2X7IA 1F9HA 2OP5A 2VBYA 1BD6A 4OX7A 5FLXU 3DRSA 4J9UE 4PWWA 3VTIA 4PQUB 5HP1B 3KJNB 4I64A 4NYPA 3AIIA 1S1VA 4PG5A 2CQDA 4L3NA 2BUNA 2V67A 3TNVA 5A8KA 3MPVA 3DHWC 1NYLA 2JLGA 3CJSA 3BO2A 3RRHA 2FJDB 4CH7A 4GVLA 2ATLA 1CQMA 3H5YA 2MZSA 3OJUA 3MPYA 3W66A 4C7QA 4CYUB 4PUOA 1M5KC 3AD7C 2ZJQS 2CQ1A 1FK9A 3KLIA 1Q81T 1EETA 1RTIB 1JLQB 1CLFA 1WG4A 3BYPA 2VA2A 2MLZA 2KXHA 3LUYA 3OTDA 4JI5F 2AT1B 4RW4B 3HHKA 2AHOB 2RIJA 2HIQA 2YWEA 4A48A 2FLPA 3POTB 3MUMP 2YNIA 3DCAA 4DUYF 3D68A 3BF4A 4RR5A 4U7CA 2V2QA 4FZVA 2MSTA 3KNAA 1V5IB 4USMA 2DPIA 4DL3A 3VQSA 1HQUB 5DQGA 3DOKA 1NXZA 3I6PA 4WFBQ 3VAIA 3KOAA 2IYIA 2UZAA 3HD1A 4NWBA 1HFEL 3JSYA 2KJVA 3ZZ0A 2B8QA 3Q8QB 2I1RA 4IOAQ 3B82A 3OLBA 2UXBF 3MCSA 4OJ1A 2VICA 2V6AA 2OSRA 1SH0A 4OYWA 3NKYA 4FYVB 1SPBP 4IRCA 4WFXA 4TY8A 3OL9A 4L74A 3CCLS 4PG6A 1CULB 1FD8A 2HVEA 3M8QA 2R7VA 2J7UA 1N5VA 3KK2A 4RBTA 1VBYA 1RISA 1VHYA 1JB0C 1EETB 2V50A 1RGVA 1HNIB 1WHYA 3E01A 2DNQA 2J9DE 3VQTA 1X0FA 3MCMA 1B99A 4JI0F 4DLGA 2EGVA 1RAOA 3BSCA 5AE2A 2C1EB 2QIFA 4CYUA 2H5IB 1UFLA 1UVJA 4NLTA 4ZPCA 3TAPA 1HYSB 1FDBA 5GAEU 4LSLA 2VOOA 2KFZA 4X4VA 1RT2A 4LSNA 1UA1A 2CQIA 2B56A 4K2XA 5F0UA 4D3HA 4H4KC 1KQSR 2FB0A 2HK3A 3GCWP 3M8WA 3MAQA 2A1BA 1RHMB 3J7YI 2HGLA 3EPIA 3C14A 1TVRA 4K4WA 1TL1A 2RQCA 1L3SA 1AFJA 3MR7A 3R5CA 1FI4A 2NSBA 3M6WA 1RT3B 5HMYA 1JLCA 1O0BA 2COLA 4JXXA 3TA0A 2BA9A 1Y5IB 3DU6A 2Z2MA 4URGA 3IN5A 2MQOA 2OPQA 3UE2A 1GMVA 1RLCL 2FGOA 2JZ5A 3NLCA 3D6TB 3W61A 4XIUA 5C25A 2DD8S 1O6XA 4J9OA 2XY6A 5E41A 2PGCA 2B43A 2K3KA 3QIPB 5KFIA 4F4YA 3NGRA 3K5LA 3TAMA 1RADB 3KLGB 3H25A 3WHIA 1NZ8A 2N4CA 2ZD1A 4ED5A 4FS2A 2KJWA 1IN0A 1DQ9A 2BOAA 4ZVFA 5A8RB 2L41A 1X4EA 2BQRA 3H8YA 1YJ7A 5HMZA 4GKKF 4P10A 3HT3A 1ZH5A 3TEHB 2ZWPA 2BDPA 1ZYQA 4IYQA 3B8HA 2HG4A 5HROB 3RTVA 2RRNA 4ECSA 4DR4J 4QBUA 2KXFA 4KSEB 2B4OA 2FHOB 2JL9A 3AXKA 4AL6A 3Q8UA 1CJKA 1E6YA 3EVWA 4USJC 4V1Ak 1K1SA 1RA6A 2ROGA 2WOMB 2X51A 3CSKA 5GADI 3HHLC 2DISA 1PJ5A 4J91A 3V4IB 2VA3A 1MW7A 4QW9A 2OPPB 1HNWF 3NGUA 4K4YA 2VHGA 1SJQA 1Q1KA 4I6WA 3GFYA 3KLVA 1TFYA 3W64A 4B3MF 1EB0A 2QX0A 4K2JA 4FXWA 3W5YA 2LQ5A 1OY8A 3Q8PB 3J80U 2HGMA 4K4SA 4ED6A 1HNVB 1Q79A 2H9ZA 2FHKA 1S10A 4ELTA 4JUZA 3GJSB 3J81Y 3K2YA 5H1SV 4UW2A 3JB9k 3MM6A 5G4DA 3EZUA 1WDDA 4USUA 4B9VA 4NXMJ 4OHYA 5IOLA 1KFDA 4AYBD 3GG0A 2CQ0A 3WX4A 5B7WA 4KBIA 2RILA 2XMMA 2ZOGA 4WU2A 4DV7J 1WSVA 1U1LA 3FCVA 3OR1A 1XNQJ 3OXLA 2YH0A 1S1XA 1FJEB 2FY8A 2ZH1A 2Q6BA 5DDQC 2OIHA 4HACB 1Z2LA 1HKAA 2BE2B 3NOGA 1I51B 1CSJA 4BC9A 1RAEB 4CCHA 5GAGW 1Y4ZB 2XZWA 2C28A 3CDWA 1Q8IA 1U1PA 1DFUP 3M8SA 1RT5A 2ZE2B 2XMJA 1VQ9S 3CJQA 4CM2A 2RRAA 1LK5A 3G8TA 1T03B 1RCOB 2B4PA 3V4MA 2OI2A 2LVWA 2OO4A 2OPSA 2CX8A 4WYLA 1ZTWA 3BO3A 1RWMB 1SKUB 1OQ6A 2B5JB 2ZEJA 3DYAA 4L72B 4OZNA 4WXWA 1N34J 3N5FA 3RBXA 3C6TB 1VCTA 1XIQA 5IV4A 1PC5A 3FUYA 4NCGA 3UCGA 2AZ3A 1LWCA 3VWSA 4X4UA 3MMAA 2PMHA 2YWWA 4FF4A 3QJJA 1QTNB 1S4FA 2HBYB 5D0RA 2RQKA 3BGRB 3M32A 1FKAF 3M8ZA 2HW3A 4PQAA 3HLUA 1FKOB 4ZPAA 4CIOA 3JQKA 1R0CB 4LR8A 1XJWB 1H7XA 2LQ8A 3MMBB 2HKEA 3B54A 4C48A 4Y2AA 1NXIA 3KJVA 4QWEA 1RTDB 4FF2A 1CBKA 3LPEA 5KG1A 2Q1LA 4FDFA 4I0WA 4MIAA 1XNRJ 3JSBA 1UVKA 4GO5X 1Q82T 3OBIA 1B0VA 2G6GA 1B3TA 2CPIA 4W4MA 1NZAA 1VJWA 4KQZA 3HHNB 4WCEQ 4AL7A 4RW6A 1VQOS 3FCWA 3GIIA 4OL8A 3H5UA 1QAIA 1URNA 4EBDA 2MGZB 5LM7E 1M5PC 2CDQA 5I42B 3R5DA 4N76A 3KMQA 5KT6A 1VQNS 1ACMB 2YNGB 3RGIA 2AEFA 4MAKA 1D9FA 3KUHA 2HZCA 3AH6A 4OJHA 2ASLA 2GMLA 1URRA 2WVBA 3IRXB 3MGJA 5K8NA 4CZCA 2KVIA 1FA0A 2CQ2A 2F65A 2FHMA 4NLVA 4EBEA 2NS1B 1KBRA 2FJWA 3BGOP 2FJXA 1NLKL 3U1LA 1DTQB 2RE1A 3BPSP 2G2YA 4R5PB 3HSZA 3RJMB 2KFYA 1HNWJ 4WKRA 3ZFVA 1AXQA 3J80Y 2HQGA 1RYSA 2HWHA 3CTRA 1JK9B 1CJKB 3SI8A 2BJDA 2OMOA 3LWMA 5E7OB 1VC5A 3HJFA 2KL8A 3KK3B 3PY8A 5GAHU 4ES2A 2YWHA 3MR3A 3J7AN 2W9AA 3UDEA 1OO0B 3K7RA 1F9EB 4RBVA 4YR3A 3D0IE 3LALA 1V6ZA 1D3WA 2J9CA 1TL5A 1N5QA 1NCLA 3MPDA 4LF4J 1B4SA 4F3OA 1PGZA 4UT4A 2EI5A 4EZ6A 3VALA 1U49A 4IQXA 1R27B 2CQHA 2NUUG 1C0TA 3PACA 3BKFA 4FXDA 1S7IA 2GA7A 2I5JA 2EKYA 2ZITA 1VLYA 3OSNA 4WFZA 3VAGA 4ID5A 2MYFA 4YB1P 4Y6IA 3UQSA 2NXEA 2CXEA 3DM2B 4ATNA 2WVCA 2XULA 1WC1A 2YNGA 5CHCB 1N33J 3ILJA 3NAIA 2MMYA 2YY3A 4RW8A 3HT0A 5KFHA 1NM2A 3AQOA 3H4DA 5KG7A 1FESA 1FXDA 2BMBA 2RDDA 2APOA 3UFCX 3G96A 3KHHA 1N8RT 4F3MA 2M88A 1RTHA 3MHYA 4M5IA 2QSFA 4I6YA 4H4MA 5ETMA 4Q2LA 1QM9A 1UWBA 1SKWA 2H51B 5IXUA 3FBCA 4OYBA 4ECWA 1BC6A 5DQIA 1UKUA 1WOPA 2C2MB 5KFVA 1YG0A 3ENQA 1JLQA 3LP0A 1S59A 1UVMA 5ETVA 4EYIB 3TAQA 4P2XA 2VODA 1WC0A 3MMBA 2GC8A 1G1XA 2AF6A 4LRBA 3R2DJ 1WEZA 2C2RA 2GHVC 9RUBA 4NI2A 3BGRA 3M32B 1S0NA 1XMQJ 4Z7YA 1N5SA 3QAUA 1FDDA 3DNCA 2A3JA 2IJFA 2YNFB 1NDLA 4B9TA 2PN6A 2IDLA 5KT2A 2I0XA 1X4DA 5HL7S 1T11A 4TNOA 2B9EA 5HI7A 3X3UA 1N5YA 3R97A 1IBKF 2R7TA 2CPZA 3D7SB 2DBBA 2JDJA 2RS8A 3N6LA 1RT6A 2R2TA 4RL1A 5B0EA 3G6XA 2XCPA 4ERDA 2HWTA 1KQFB 1F5AA 4F7VA 2IRYA 4DR1F 4QIVA 4B9SA 4IOCQ 2L9NA 2X1GA 1PC4A 3HXMA 3CCQS 2VFRA 3E2EA 1KOOA 3BGFA 3N5BA 2VQEF 1LQ9A 1X4GA 2OH2A 2OFHX 3MZIA 4N7TA 5BXIA 5DZ6A 2E1AA 4C0OC 1WG5A 2EFGA 1U1KA 2VG7B 3V4IA 2VQEJ 3PW7A 3CD6S 1U0HA 4EK2A 4C2MA 5JVHQ 2DXDA 1RWOB 2DNPA 4CRJA 2LA6A 2HNDB 5T7LB 2NXNA 4LF2A 4P7VA 2BKOA 3LP2B 4OI6A 4ZKAA 5CCMA 2ZHBA 3C2PA 4Y34A 1R8AA 4FYYB 4CT8A 3TVKA 2VPZB 1AZSB 1IKVB 3R5GA 3PG9A 3QJPA 4DZ6A 4K5RA 5D4OA 5C24B 1GTSA 3BS9A 3KJFB 4OX8A 4LMZA 1TL3B 1W7WA 3G87A 1XNRF 2EWHA 2E5JA 3FFIA 2YBVA 1HBOA 3MTKA 4WTYA 5HP1A 1NSPA 4KKOA 2QEXS 1S1XB 2OFGX 2IJRA 5L1KA 3NNAA 1JQGA 1WG1A 1WHVA 3RG6A 2XC9A 4WPAA 3SQGB 1T05A 1XMBA 5T41A 3EJMA 1HNZJ 4IH7A 3AJ1A 2RUGA 3R6LB 5DO2A 9ATCB 1KLMB 2R7SA 2EEYA 1CQNA 2H4YB 4NEZA 3G6VA 1VQ5S 3C19A 1KOHA 4ZVUB 5K8MA 5E33A 1SL0A 1YBTA 2HFUA 1UA0A 2DJWA 5EN1A 3IS9A 3PFEA 5IT9U 1PILA 3PEJA 1NHVA 4FNHA 2MKKA 1P9QC 1M1GA 3CULA 1JLBA 2QSWA 5A76A 5DLGA 4YMEA 1JXLA 2GVZA 1V3SA 4P6QA 2AIRB 4ECZA 5E3AA 4U7UK 1EJ7L 2ZZTA 3FJ2A 3HZEA 3OTBA 1NSQA 4OYAA 4LFCJ 4A8KA 3LF0A 1U0HB 1VRTB 3AAWB 2GFFA 3C46A 1U1OA 4DV6J 1PYTA 1R8HA 2EK1A 2KB2A 2SXLA 4KKOB 4C8MA 5CAAA 3MECA 1TV6B 4M63A 4RU9A 4I69A 2MB0B 1NJZA 4DSKA 4LF7F 4W92B 4CNYA 3T41A 3AHPA 2DGVA 2CNKB 2YKOA 3HULA 2BJ9A 3NBPA 2FTRA 2KG0A 1LXJA 5HMWA 3NGKA 4QYRA 2HVZA 4B9MA 3KHGA 1W2IA 1RAFB 1UW9A 3QRRA 4JI2F 4N5SA 2XMWA 3TUIC 3Q23A 1R8CA 3QRPA 2EPIA 3P5TL 5LOQA 5A2QY 1DJ0A 4QW8A 4DLEA 3GYNA 2DR5A 2VIHA 3TANA 4C3LA 1TUWA 2UUBJ 4N56A 4EYHB 2YQ1A 3M8QB 3NRBA 2ALZA 3BDEA 1B0TA 3AFGA 3MOZA 4UZCA 3NGTA 2KDOA 3N0VA 5HVGA 3GIMA 1S9FA 2ZZMA 1X5OA 1VQ6S 1D9DA 2XS2A 2VBWA 2QTWA 5DGBA 4DL6A 4A4JA 4ES3A 5HK4A 5L9XA 1NK9A 4G1QB 2KT2A 1SIZA 4TLRA 4AQYJ 4EO6A 2BE9B 4B3TF 1FFWB 2DR8A 3VHQA 1TUGB 2YKQA 1NMEB 1TMMA 3J81U 3PHEA 2ZBCA 5L8RC 2DXFA 3MMCB 4FKYA 4E98A 2KO1A 4EI2A 4DX7A 5A8WB 1DURA 3W2VA 5ETSA 3J7YU 3L7OA 2MZ1A 3MR5A 1JNRB 4DV4F 1J2VA 3EZOA 4ID8A 3PX4A 4EGLA 3KG4A 1YQHA 1YJVA 3HFKA 2UXBJ 3EX7B 2QJ3A 3R7SB 2Q43A 4KTQA 2XS5A 1TKXA 1J5EF 1SL1A 3ZZUA 4JOUA 2RS2A 2AYMA 2AJ0A 1RAJA 2VKZG 1XTZA 2V2KA 3Q0AA 3ZZYA 1HBUA 3DGPA 3HCXA 5BNZA 1Z2ZA 4NZ6A 1HWKA 5DG8A 1X9SA 5KFNA 3EPGA 5EDWA 1HYSA 3CCTA 5CA5A 4JV5F 3QGGA 3KHRA 4X2BA 4ZK7M 4ECXA 1HI0P 1F9FA 2ZDPA 2I38A 3D67A 4HHUA 3AY0A 4UZBA 3J7ZT 2MZQA 4MFBB 4Y2MA 3EE3A 1YSJA 2W4CA 1KKHA 4USTA 3UO0A 4TLQA 5DGAA 1VBXA 1VQYA 3POTA 2JLEA 3SDEB 1FKPB 2KT3A 5KG2A 2AGPA 2E1RA 2HFOA 1IKXB 4DHVA 5JVGQ 2CWXA 4ALZA 2LKZA 2ZBQA 1V6HA 4KC5A 4OI0A 3EGNA 1RB0A 1T95A 1Z1ZA 4KIAA 3JQJA 3CJKB 1M1HA 4YDXA 4DG1B 5LMNF 1IBLF 1T9YA 1HBNB 3PYGA 3TX0A 1FWPA 2U2FA 1MNEA 2GVZB 3Q22A 4DV1J 3PRBA 4ECVA 1VQ4S 4PUOB 3CJ5A 4B9LA 3OHAA 3PW2A 2J6TA 1S6UA 3FQLA 4F2RA 2M0GB 2RKIA 3DKDA 4U8YA 5B0GA 2GX8A 3MAAB 3O8WA 2DEJA 2CDRB 4PXEA 1U8SA 4MTPA 1Y7PA 4FPRA 2J8SA 1RWPB 1VMBA 1S6QA 2DKOB 3LGHA 2PIIA 3BN4A 5M2RA 5IQ6A 3PIPQ 2PO4A 2JFDA 1QVGR 1CVJA 2JEIA 1VBZA 4PAAA 4U7UD 3S01A 3KYLA 2KVQE 2IA6A 3F73A 3TR5A 3U27A 1KN6A 3SFUA 2P6SA 1HWLA 2XSJA 5KFPA 4RW9A 2CJXB 5K8OA 4FYDA 5A6WA 1O0PA 4ZHRA 4Q0BB 2P9CA 2E66A 1IUJA 1D9AA 5KFOA 1PCAA 4OZJA 2GQCA 2KHCA 1AZSA 1N88A 2NPIA 2FVSA 3V6DB 1YJWS 5GADW 2DT9A 4A8MP 4JXZA 2KYZA 1N4LA 3RRGA 4CI0B 5DRKA 4EEYA 3JS9A 5K8PA 2DTJA 2NZ4A 5KT3A 4KHPF 2F5GA 4DEZA 2IIHA 4RNHA 4YB7A 2M9KA 2QLXA 1G7CB 2IVMA 2O01C 3EM1A 4HR2A 4R0JA 2AGOA 4NLPA 3E8OA 4P75A 4DFKA 1TL7B 1KLNA 4CO1A 1VRUB 1ZJWA 5EHHA 2YX7A 2LU2A 1AW0A 3CDUA 3TJ9A 2IY5B 2B4UA 4UUWA 1S48A 2VF3A 4WYWA 2HURA 5DDOC 5D15A 1U1QA 3MEDA 3TJAA 2KXNB 3ISND 1RABB 5D78A 3TZYA 2VPWB 3GU0A 3D3CJ 1EUYA 3GFXA 5AXLA 5LT5A 3T1HF 3CMQA 2G1HA 1EARA 2NXUA 1N48A 2L9DA 3BKTA 2HGNA 2QC3A 3I0RB 2C3PA 2ZOFA 3MMJA 3UNGC 3TZXA 3LOUA 4X4OA 3UCZP 2XLKA 4CO4A 3IM8A 1FRIA 1FEEA 3I0RA 2ZHAA 1WHXA 2J0SD 3TQ1A 1P6TA 4UY85 2D9PA 1RU2A 4QPXA 2ACYA 1HHTP 2K7KA 1GQEA 1OIAA 3QFHA 2YNHB 2AD9A 5HBMA 3CB4A 1QSSA 4IO9S 1HWJA 2V8HA 3MM9A 5JVGS 4OYPA 2BE2A 2J9DA 3DLBA 1LFPA 2MKJA 4MMOA 7FD1A 1V3ZA 5FLXY 2ZDOA 1SJ1A 2AP6A 2W2OP 1UMJA 4LF8J 4DU8A 4DF8A 3MEKA 5F3ZA 1YZ7A 2UVVA 1FJGJ 4WF9Q 3TVYA 2XMKA 2CQGA 3DYAB 4KE5A 2IM2A 2JVOA 2ZH3A 2NYHA 2Z0YA 2B3TB 1U26A 5HSPA 2V0NA 1TTHB 2KZZA 1Q5VA 2WVEA 2UXDF 5E5NA 1N5TA 3IR6B 2IRXA 1G4CA 3J7A1 3MI7X 1YJUA 4OQJA 2XS7A 1TMJA 3SV4A 2FJEB 1VQMS 1RUSA 4DR7J 1RJJA 3IP0A 3DI6B 4DR6J 2V94A 1JKHB 1S1TA 2W9BB 1WDTA 5IFMA 2RQ4A 2MTLA 2QGFB 3M8PA 2J76E 2AZ1A 4DL2A 1WI8A 1DLOB 4NOHA 2JRSA 5KG6A 4K59A 4DR6F 1JLAB 4AE5A 2VFUA 1QSLA 4KGKA 3ET6B 4NCAA 1S57A 1PYSB 2XEXA 3NAHA 3E3XA 3CIMA 5B0CA 2JEFA 1Q8KA 1S0MA 3UN3A 1Y11A 3IAM9 3CJTA 2YX1A 3EMTA 5KG4A 3LWLA 4DV6F 4PQUA 3FZ2A 3R2CJ 5A6PA 1XBWA 2E5IA 3R1HA 2VASA 3OUYA 1JIHA 2GS8A 2ZWOA 5GAGU 2CJAA 3AB2B 3LP0B 4O0IA 4DS4A 3QYYA 1WNEA 1IXKA 3KUEA 4ZVQB 4DG1A 5F8GA 4X4PA 2XY7A 5JMNA 1K8AT 3V6KA 4NXNJ 5J1EA 4K0KJ 4LREA 4F4AA 1VISA 2DR6A 2J0QD 2J6UA 1O51A 1K44A 5J2PA 2B8PA 3CCSS 1LW0B 2ZD1B 3LAMA 1HI1A 4QIEA 4LR7A 1MMLA 4NZ0A 3R7NB 3ZC4A 1SQFA 4DBQA 4K4VA 3ZNJ1 3PJWA 2XNQA 1FTRA 1Q4RA 2QL7B 1KTQA 1Y00A 5E0OA 3PR5B 3QQCD 1RT2B 2ATCB 4LSNB 4P7TA 3O44A 1IJEB 2ZBPA 3TW0A 1DARA 4QQBA 1QRTA 1C1BA 4UF4A 1NNDA 1K47A 2IPOB 2CPFA 4A8YA 4OI4A 1D8ZA 2J5AA 2YWKA 2WBMA 3KXDA 3S7RA 1KSPA 4NCBA 1R89A 4DR2J 2DO4A 1LXNA 3GIKA 2CG4A 2NSCA 2W1BA 4DFJA 2V4RA 4OYZA 2G2OA 4WZQA 2Z0GA 3TZWA 2QYGA 4LJMA 1J27A 3JSMB 4ZCKA 2CPJA 2Z2ZA 1WD6A 2EVZA 3QT7A 1T7PA 4NI2B 1DFDA 3T5HA 1YBUA 1RZMA 1GXTA 4RW7A 1AT1B 2PSZA 3MM5B 4ZHRB 4Q0BA 1PAEX 1VBKA 1HQUA 2FUG9 2Z30B 4IO9Q 4LRAA 2OPQB 4JI1J 1HNIA 3E01B 2F8HA 2WZ1A 1AA1B 1FRJA 3IFEA 1FE0A 3ENAA 5CYMA 5FD1A 4DSLA 4RLEA 5ETRA 3ZZZA 3A8EA 3OD2A 3IC1A 2X1BA 3QIDA 5J2PB 4IUFA 2KH9A 2PFFB 4CLLA 1FDAA 3AQPA 3WBZA 1U47A 3F0NA 2HZVA 2MY8A 2ASJA 1RBOB 1YJRA 3EGVA 4CDIA 5F8JA 4AD6A 2IMWP 2ASDA 2DGUA 2B5JA 2VBZA 3EZ5A 2N3LA 4O0NA 4J9KA 2ILZA 5IC4B 4W90B 2E29A 3MAAA 2HNYB 2Q3PA 4YQWA 2I6WA 1T3NA 1Q8BA 4LIRA 4NLDA 2DR7A 5B0BA 2RE8A 1Q7LB 1ZM4A 2DGOA 4ZCIA 4DPOA 5KT5A 2AQ4A 3D4JA 3W8PA 5IT4A 1OJ4A 1UCNA 3PRVA 4G1QA 5JVHS 3SEOA 3EWGA 5LSOA 1RWVB 2UXCF 3NNHA 3DHXA 1O5JA 4Y3CA 1NK6A 4LF9J 2H48B 1ZBTA 1IBCB 1SC4B 4USVA 3U02A 1KRPA 1K0VA 1CS4A 3TYTA 3GILA 3TARA 5DS7A 1RT1A 3WIVA 2UVUA 4X4QA 2R7UA 2FIUA 2J7WA 3BM7A 2MZRA 4Q7AA 4JBCA 4DV4J 4ZJQA 1CJUB 4KAIA 2M7SA 4NMXA 3BH6B 3PO5A 3QLHB 3QWUA 5F8HA 1JNZB 2R8JA 1VQ8S 1S1UA 2G2ZA 1F0XA 3GYXB 4MH8A 1S1WB 5GAHI 1HBUB 4X66F 2EBEA 1SVDA 3PR4A 4FVMA 4YOEA 2AWZA 2ROPA 3LH2S 2M52A 4LRDA 5MLCV 1GTEA 2A2CA 5KFCA 2RU9A 4MIBA 2Z2LA 5LXRA 4JI7F 2ZH4A 2F3JA 1REVB 1U2RA 1JLGB 2M2BA 2OGUA 1C4AA 4A8WA 3A12A 4QWCA 2HSEB 4X4SA 1E6YB 1MWYA 4YEAA 5HQMA 3H2VE 4OLPA 2YVSA 3PIPS 1YVFA 3RB6A 1IWGA 1UPMB 2V8VA 4EUVA 6FDRA 2XO6A 2CKWA 3I31A 4YHHJ 3IAS9 1NJYA 2IC3B 3MEEA 1HQEB 1NSAA 5IZHA 2LLZA 3LP2A 3CMAS 3M9MB 3PX0A 1YITS 3ET6A 2LMIA 1U4BA 1SJ4P 4ZCMA 2VPXB 2CVEA 2EC2A 5K14B 3CCJS 4O44B 5CZVA 4ICLB 4P2BA 3MURP 1HMVB 4LVOP 1DLOA 5K5MA 3KHLA 1GAOA 3BBCA 5EX3A 3MM6B 2G0CA 3FKBA 5B0FA 2QE5A 5FDLA 1D09B 1ROFA 4KGXB 3RB3A 1W25A 1P1LA 2U1AA 3GLJA 3TJ8A 1M1KT 2JSXA 5G0RA 1JLBB 4DV2J 3N79A 3SV3A 4LF5J 4MKYA 5B0DA 3SSQA 2NXJA 4TXSA 3D6HB 2CQBA 5I3UB 4DR3J 4AUKA 1QD1A 3BPDA 2HHXA 2D7SA 5C5JA 1LNQA 3BKUA 1WC6A 3BGUA 3DRRA 1IR2A 2B6AA 3Q24A 1UJ4A 3BBFA 4ZN3A 2KZMA 5A2QU 5IWAJ 2N7YA 2FC8A 2ASYA 4C3KA 2V4QA 3A3PB 1TK0A 5M2UA 1S9GB 3V2UC 4N41A 1WWHA 3MM7A 4TU7A 1K9MT 1N32J 3WQPA 4X65J 3T1YJ 1IBLJ 2YNFA 1CJTA 2ZHOA 1UW4A 4CLPA 5AJ3J 4J3CA 4V194 3G6ES 2BVZA 4G3IA 3A8IA 3LPYA 4LVNP 4NRTA 4F02A 3IBFB 3HHLD 1N36J 5HROA 4JV1A 4LF7J 2H3EB 1NRKA 4ZP6A 2HRUA 2KN4A 3DLEA 1FJCA 1F2HA 4F0MA 3K58A 3KW2A 5J2MA 2HQ3A 3QO9B 4GC7A 4LFAF 3OVBA 3CCWA 1S0OA 2HHUA 1F5BA 2RDJA 5SUHA 1SXLA 3T5KA 2VQFJ 1KS2A 1IKWB 2B7CB 3N6NA 4I1TA 2UUCJ 5ETNA 1A6LA 2LXIA 3OSPA 5IZNA 3C15B 1VYAA 1YJ9S 4IG3A 3L9ZA 2IM1A 1UVLA 1NUEA 3DRYA 3I96A 5IM0B 2Y1JA 5L39A 2GIFA 1OPZA 4U96A 5D6GA 2CZ4A 2HFNA 2LDYA 3DOKB 3UI3A 4FYWB 4UOGA 3QZ8A 1JX4A 2E9RX 2NZCA 3TWZA 1CJUA 2HLTA 4M8LA 1ZM9A 4RPFA 4BWJA 3BREA 3S1TA 4DPTA 1K73T 4IKAA 4ETZA 2LECA 2WCXA 3BJYA 4IRKA 2W2PP 1SKSA 3HK2A 3M2VA 2IDEA 2DY9A 1C0TB 1CJVB 3GG1A 3RBZA 1X31C 3UN5A 4L75A 5FJ4A 4MFBA 3NP5A 3D0GE 3TRGA 2UU9J 1RKIA 4B3MJ 2XMUA 3GJTB 3KNGA 4EFAC 4PXBA 4BCAA 4DL0C 3CD0A 4YP3A 1CC7A 1B75A 2OAUA 3M6XA 1MROA 4LQ3A 1NPRA 3R7BB 2ALYB 2M8HA 4V19J 1F2GA 4OZ2A 5K20B 1ZAWA 3L7UA 4AT1B 4XPEA 3M4XA 4JI4F 1YDLA 2AMCB 1Y10A 2IA0A 3VZIA 3ISZA 3GPAA 3LTOA 5CABA 1WOOA 3K17A 1NPKA 3K5MA 4P73A 4CO2A 3CNQP 4BHQA 2VG5A 3LP1A 2XZTB 3L09A 4QR0A 3G86A 4RBUA 5CD4A 1M90T 1R31A 2IBOA 2MY7A 3F56A 3L95X 4C8NA 3RRKA 3OL8A 4HH1A 4E8UA 2IVFB 1L3VA 3MMCA 1S12A 2XHCA 2NREA 3JTPA 3KLEA 3VGUA 3DFEA 1AROP 3LA0A 4WU3A 3UN2A 4DR3F 1KVIA 3G2XA 4J9SA 2OEKA 2YPYA 3W3SA 1FFGB 3FZBA 3NEKA 2EC0A 3I9ZA 1NO8A 3B6BA 4CM0A 2MQLA 1SB6A 2I5JB 4DN0A 2F8MA 5DDPC 3GV5B 1FXRA 3CW2C 2A6MA 2GHWA 5I3PA 1LW2A 1WACA 2K2PA 2CQ4A 4F4KA 1CG2A 3UR3C 2VUGA 4B02A 2VONA 2EFPA 4CH1A 3M2RA 3W2WA 2HZAA 4H4OB 4GKKJ 5DLFA 2MKYA 4PG8A 4LSLB 1Y5LB 1XERA 2DNHA 3KG0A 3L3CA 2HQCA 1MROB 1RI7A 2R8IA 4IOCS 5LJ5Y 2H4WB 3BBBA 1TV6A 3QZ7A 3ZZOA 3WIUA 1EP4A 2W01A 5L46A 2KU7A 5EX0A 2DR9A 4C9DA 2IYGA 5ETTA 2MEWA 1VRTA 2Y1LB 1FRLA 3DDKA 3US5A 4ED4A 5RUBA 1HHQA 2KM8B 3FBFA 1ZPWX 3I32A 4RUHA 5C7PA 1J5EJ 1VQKS 1VQ7S 3C6TA 2MZJA 5KFDA 1ZAVA 2BM1A 4DMZA 1FWLA 3RR8A 4C8KA 4ZOSA 5HL7Q 5KFFA 1NJXA 1KVJA 2D9OA 4X62J 3GCXP 2BJ8A 4ZP9A 4OHWA 3HVWA 2BQUA 4FVCA 3N6MA 5D3GB 1FHTA 2FVCA 4WIIA 5MAOA 2LYVA 3ITHB 2ZM6J 2PT0A 2HHVA 4G1PA 4R25A 2PEBA 2W25A 2NUHA 2WBRA 2POKA 3I4HX 4PCQA 4XTTA 5LXYA 2FHJA 3W9HA 5ADZA 1T05B 5D4PA 1IKXA 2Y9HA 4UOHA 4U8VA 1B7YB 2VZ9A 2RB7A 2IVYA 3FEZA 2AJQA 1TUVA 3Q86A 4HTIA 1SC3B 2CA9A 3T6BA 3UDVA 1RHKB 4C98A 4Q45A 3MUTP 3DLEB 2VFTA 4PEOA 1D0EA 2ZFHA 2XLJA 4OLOA 4HHHA 3OFGA 4CLZA 4DOZA 1H73A 4WXOA 2I2YA 1LOUA 2XWXA 1Y0HA 2H65B 3DLJA 3BSNA 1E6VB 1AYEA 1ZA2B 5F0WA 4IR9A 5HATA 4ZJLA 3R3TA 4B3RJ 3EGZA 1YIJS 2OPPA 4LUBA 4KHRA 2FVRA 1N34F 5AXNA 1NK7A 1FRMA 3TP2A 1TKTA 1HHSA 4QOTA 4QWAA 3FDSA 4GVBA 3ZTOA 3P3DA 3A3OB 2Y1RI 3KLHA 1WORA 3QT6A 2CJ9A 4J5OA 2HHWA 5H9EJ 1HQ2A 1KTVA 5IWAF 5EUHA 2DO0A 3MDFA 5EGYA 2QFJA 2D74B 4PWDA 4KGZB 1IR0A 1EQMA 4DV3F 1DQ8A 2W4PA 2CRLA 3AB4B 4KR0B 1TQLA 1BHNA 5AJ3F 3HO1A 3WZ0A 1C2PA 1E6VA 2CPHA 3BGLA 2PA8D 4MKAA 3QNWB 4ECQA 3K0JA 1C0UB 2GJFA 1FTCA 1SC6A 3HFVA 1WELA 4WFBS 3MF5A 2CJBA 2EW9A 2IC3A 2XYGB 4GO7X 3J81j 3G8SA 3VF0B 2UUCF 1U8WA 1U6ZA 1RT5B 2YKMA 2ZE2A 3IGNA 3ILOA 2DIVA 2HNZB 3M30A 3QIPA 4IDKA 4ZVGA 3RAMA 4DR7F 1L5UA 2ZKTA 3HHLB 5GADU 1LWFA 4Y2CA 3GR1A 2AKWB 3FK4A 3CXCR 4KH1B 2HQIA 3NOCA 3A13A 4OJGA 2DRBA 4LF6F 4C8YA 1Y3JA 3OT9A 1RWNB 2NPFA 1JLCB 3FMBA 3M6UA 5IS2A 3T9NA 4IFVB 2ZJQQ 3L7PA 4WCES 2VG7A 1HW9A 4Q5VA 2BW2A 4WP8A 3NS7B 4LRCA 2BKNA 1S97A 1T9WA 2QO3A 2GAHC 1OS5A 1TAUA 1QRSA 4KHMA 3GSDA 1R0AB 3FCHA 1ZM3A 2P5VA 3A4TA 3AOBA 2B9YA 2OEMA 4RX6A 1MMDA 1S1UB 3UDCA 5B08A 3KLEB 1H0HB 1H2VZ 2D41A 4M1KA 5G0RB 3KLHB 3PRDA 2A6OA 5ETOA 3M9NB 4DFPA 2Y1IA 1ZZNA 1M5VC 1IQTA 3MTJA 3OR2B 2HFVA 1G3OA 3BR8A 3DLGB 2C42A 3LGMA 3CJ3A 3A8JA 1RACB 3MM8A 3PZPA 4MJKA 2UU9F 2ZVSA 4KYZA 4LF5F 2DNRA 5J1NA 2GVDA 4WFYA 4N77A 4CO3A 4ELVA 4N8NA 2WONB 1V9OA 5SZTA 1OPIA 3X1LB 2YWFA 3SZ2A 3VV2B 4ZDNA 1Q53A 1S49A 2V69A 3QMQA 2GCFA 5IQQA 4YB6A 2LQBA 2RKIB 5L1IA 1O0CA 3JTNA 2XNRA 2FYXA 4DPYA 2ZH9A 4YR2A 4H4OA 1XC9A 1O8BA 4LF4F 1UJ5A 1NB7A 2D3O1 5IT9Y 4OV1A 2HZ7A 1YHQS 1HNZF 1LK7A 3FSYA 8ATCB 3BQ2A 1IBMF 1YRXA 4FPIA 2NYIA 4DCPB 1H7WA 1RBAA 4I68A 4KGMA 1RT1B 3H7HB 2MQQA 1VHIA 1BQMB 4USWA 3KTQA 2DB1A 1RSCA 1PKUA 4RW4A 4O3RA 3C14B 3Q2TC 3MWBA 3Q8VA 1QY7A 1GXLA 4WTOB 1FVSA 2DNGA 2LQJA 5A0YB 1Y3KA 1F60B 2P2CB 1MG7A 1MSWD 5KG5A 4L3KA 2V68A 1HPZA 3HHDA 4K7QA 3CDEA 4OYXA 4LFAJ 4PXCA 4ZLLA 4I2PA 2AE0X 4Q8FA 2VL1A 4XK8C 4H3SA 5C25B 2OEJA 2BQ3A 1VLOA 1NK8A 4A8OA 2CQPA 3JTOA 3T6JA 3ZZTA 4EZ9A 2WSEC 3RZAA 5DM6Q 1ULRA 1XN9A 3RU0A 1OY9A 5J2NB 2MLXA 2ZC3A 2DH7A 1MN9A 1KVKA 2BW7A 1D1UA 3DDIA 4K0KF 1KDNA 4E0DA 2DHAA 4Y2IA 3CEDA 4F25A 4C4WA 3MXHP 2NLWA 2V5HG 3TOQA 2DGWA 4IO1A 2J0WA 2B7BB 1UJ6A 2EKNA 1X4HA 4O4GA 4I7FA 4JI3J 3NGDA 2R2UA 4S0MA 4C6AA 3HKWA 4OX9F 3G71S 2G5DA 1IM4A 1Q7YT 2VDHA 2UVWA 1GEHA 5F9LA 4OYMA 2JWNA 4DV5J 1KR4A 1BWVA 2UUWA 3OFHA 2ZNZA 4DCOB 1T9TA 1RT7B 4PWUA 1HPZB 4DDFA 5A8KB 2E7WA 2BEFA 2OPRA 4OZ5A 3LO3A 4ED0A 1VI7A 2ZKUA 1YJNS 1LWCB 1W26A 5D8HB 3O1LA 5J2QA 1X7VA 3SCIE 1YK9A 2FGCA 2QLFB 3D1QA 4DUTA 4RUCA 2BABA 1HIYA 5DG9A 4RWWA 1F3FA 1DQAA 1WC5A 2F7VA 3BO4A 2MZTA 1SJRA 2VBXA 2XYHB 3EUNA 3UVJA 4QCLA 3M05A 2R7QA 1SV5A 3MM5A 4ZPWR 2HMIA 1X4FA 5KFEA 4I2PB 4LSZB 1U1MA 4LFBJ 1MU2B 2CPXA 4FBTA 4OZ0A 5E3CA 4Q8EA 1R0AA 5DJBA 5FDLB 3ZTQA 3HSGA 3UCUP 3H90A 1VQPS 4OYOA 4K8RA 2V8DA 4Q2MA 1C0UA 2XSFA 3R8YA 1EZZB 5KG3A 4UUXA 4DUZJ 1HNXJ 4K4UA 1L3KA 2G0IA 4IOBA 3CC2S 4XDDA 2RAQA 4TYAA 4GKJJ 4ZP7A 4X64J 2E5LF 2W2MP 3NS5A 2HHTA 2HK2A 3D2WA 4CWBA 1BGXT 4XAKA 4Q44A 1R43A 3OR2A 2YH1A 2YKPA 3MD1A 3TA2A 3KJVB 2LFVA 2XTJP 4PXDA 4DZDA 4X64F 4LF8F 2HEKA 1VIXA 2ILYA 1R8BA 4KGVB 2B0GA 2OELA 3HDSA 5U47A 2YKMB 1EIYB 4O3OA 2YQ0A 4HH0A 1RA7A 3PHTA 4HKQA 1RYRA 4FF1A 4J9NA 2V4JA 4MYUA 2HS4A 4I6AA 1BWEA 3TO8A 1JLGA 3GE9A 3LQVA 4NLOA 2ZH2A 4OMFG 2KI2A 1IVZA 2O66A 3NXZA 4R5PA 1EX8A 2AJFE 2XI3A 4ILRA 2O3DA 4LRFA 3K5PA 2N82B 1PBUA 2BYCA 2RH3A 3MPWA 4IH6A 3CDBA 2Q79A 2MDAA 2QL5B 4C0BA 3CJ4A 3IRXA 3FEYB 1EHWA 4PYAA 2C2NA 4DV2F 3C6UB 3MR2A 2JX2A 2UVRA 2DRDA 2YKNA 3BZQA 3MOJB 2FJAB 1X60A 1N0VC 1WC4A 3I9V9 4IOAS 4DN9A 3KLFA 3DMJA 2ZJPQ 4PG7A 4PG4A 1QRUA 2XLIA 2CPEA 2UUTA 1YI2S 3RW6A 1XMQF 3B4MA 3AT1B 1HMVA 4A46A 5KFAA 3QAEA 2RUSA 2ZVIA 1XR7A 1IKWA 3TQEA 4DSEA 1JLEA 2Y0BB 3OR1B 5KFKA 4JI7J 1S72S 1RHUB 4TVAB 2QLBB 2HS0A 5HJYA 2XCAA 1ZETA 4JI3F 2DNYA 4P2MA 1RTDA 2F63A 4XPCA 2V9WA 2AX0A 3DI6A 2WSFC 1RDRA 3HSJA 5KFXA 5J2MB 4NA1A 4WE1B 3HHLA 4YFUA 4ED2A 4A8FA 1FCAA 1EKRA 2MPUA 3GJQB 2D3OR 1VRQC 3JXOA 4F50A 4ZLNA 5IT0A 2HNYA 2BJ7A 3CJRA 1LKZA 3R5JB 5F8LA 3QBCA 3ENVA 3ZZRA 3I87A 4QYZK 3T1HJ 4J9RA 2H5JB 3MM7B 1TL1B 1WI6A 1VGYA 1VJQA 3W9IA 2VFVA 4DX5A 3CCMS 1KFSA 4Z2XA 4I67A 2CZ9A 2OD4A 4OZLA 4X66J 1VR6A 2F9JA 2V34A 3NL0A 2KKHA 3D5MA 3PM9A 4LBIA 4USKA 3IG1B 3ZO7A 4DL5A 5D0EA 4U6PA 3M6VA 4JI5J 3ONQA 4RW7B 1H2TZ 1UTAA 4ZVRB 1QAXA 2YNHA 1SC1B 3U1MA 4WE1A 3M8RA 2JLFA 1GH8A 4DQRA 1VC6A 5D0HA 4HACA 4USIA 4WK1A 4ZITA 2DHGA 4B3SF 2RNEA 1LW2B 4G65A 5LJ3Y 4C0HA 4CP5A 5HLFB 1B70B 5KT7A 1OWXA 2ZC4A 1SKRA 3VAFA 2Z56B 3PW5A 3GSIA 3DLHA 1JWWA 2ABYA 1N33F 4WFNQ 1Q5YA 2RU3A 1PJ6A 1RKJA 2K8GA 4F04B 1A7GE 2MSSA 4ANCA 3ADAC 1IWAA 3G8QA 4F2SA 4K4ZA 3W5XA 4ZLJA 5BYQA 2CUYA 3NNCA 1REGX 4J7CA 2BRKA 4C3MA 3Q2SC 2C2EA 3J7Z5 2FHJD 2MHNA 2L48A 2C3OA 5KT4A 2FVPA 1Z85A 4M5NA 2GNKA 5M2PA 3NCRA 1UP1A 2AV5A 2PMZD 1DTQA 4LFCF 4DXLA 4H4MB 2RQMA 2UXDJ 2FDNA 4JI1F 1RTIA 2MXYA 2F4VJ 2GO9A 3R27A 1EP4B 1NHUA 3CMES 4JB8B 3O6QA 1N32F 3ITHA 4DX6A 1YBAA 2XB2D 4A47A 5KFBA 2EFOA 2DNKA 2PDAA 2YX4A 3H2UB 1IR1A 4RJVA 3W60A 2BX6A 4OHXA 2BE7D 3DC2A 2BANA 2QFIA 2QLWA 3IR7B 8RUCA 4QR2A 2WAQD 3ZTSA 1GTRA 3QLHA 2Y3YA 2WONA 3W1YC 3GR0A 3THTA 1S99A 4ZVTB 3IWNC 1RXOB 3VCDA 4HT5A 2UUBF 2XWYA 1CULA 1WOSA 3MM8B 1WC3A 4F36A 4F0HA 1S6QB 2O1PA 3P4UB 1Y5NB 4WWSA 2DRAA 4HYKA 4DQQA 2P8IA 3GFZA 4WF9S 4NLSA 4DWIA 5CYQA 4LT6A 2G9OA 2CNNB 2GJ2A 3AOCA 4RO0A 3QRQA 1EQ0A 3OTOJ 4KV8A 4EMDA 1FNXH 3H5XA 2HYIB 2J6SA 3CF5S 2HQDA 2VD3A 1C1CB 4P2FA 5CD4H 3AODA 2R42A 3C15A 1GMUA 4DL7A 5BYRA 3H4BA 1IKYA 4WP3A 2ZH8A 5DZ7A 3G6YA 3BQ0A 1H98A 5I4MA 2HHPA 2MJNA 2GO8A 4IFVA 1KEKA 1KQKA 4URSA 4JV2A 1MLAA 3QGHA 5HQ8A 5F9NA 4ZP8A 4TU8A 5F3TA 1TKDA 2IBKA 1BQMA 2P9GA 3N4WA 2LCWA 1QE1B 4NLUA 1VQLS 4PR6A 2OHDA 4OZ3A 1IBMJ 1NSKL 2R4FA 2AJ2A 3GTYX 2M70A 1I94J 3P6YC 4DI6A 1T8EA 5HVFA 3PVXA 3RR7A 4O4RA 1B64A 4A8XA 2HRYA 2OTJS 3C16B 2QL9B 3TUZC 5DM7S 2HBQB 3NWGA 4WIQA 1A0OB 1WEXA 3DRXA 2QRRA 5D4NA 1HWIA 3WDOA 2A18A 1S9GA 2QG9B 3MCOA 3M1VA 3PYFA 5FIIA 4OI2A 3MEGA 4DPWA 4ER8A 2JEJA 1SCJB 2H5EA 1EAYC 4ILMA 4KJIA 3QO9A 3DGVA 4ZA1A 4DCJB 3CC7S 1RWKB 3T19A 5C42A 4L6V3 5D77A 2K1RB 3HFZB 1C1BB 1F1BB 2DGTA 1T03A 2EBGA 2WW8A 1SL2A 1TELA 1NJWA 1Q16B 8AT1B 3K57A 2PI8A 4H4KA 2PMWA 3WC2A 4B17A 2XZDB 1SUQA 2ZH7A 3CCES 1ZAXA 4IG3B 4JI6F 2XG8A 1TKTB 5D4LA 1UPPA 3CWJA 4ZVEA 5JXSA 3ULHA 3CPWR 1BMQB 1X5SA 4QZVB 4NL5A 2YNIB 3SSSA 2BOPA 5H9FK 5F8MA 1RAAB 3H98A 4OI1A 4ENOA 2X3DA 5C2GA 4F4WA 3MR6A 4F4ZA 4ES1A 2XO7A 3GIJA 5E3QA 2A10A 3DRRB 3U1NA 1P1TA 2BBEA 3OXFA 1RT4B 1X4AA 2WB4A 3D1OA 3BH7B 2YKNB 3EVMA 3GMGA 1HW8A 3W63A 2WTFA 5J1PA 4MK8A 4YB5A 1N52B 4AXIA 1NPPA 4F4XA 3IBWA 4DV1F 5GAEI 2IAJA 5E3PA 1GK8A 3V6HA 2DY1A 4WJBA 4TQRA 1NKEA 2DNZA 2XGPA 5A8RA 1WF1A 4DQPA 3SBMA 1REVA 3PDNA 3R1LA 3AA8A 2QN6B 4KHPJ 4N47A 2WHOA 2DNMA 2D3UA 1QDUB 4DR4F 3CIZA 2HHSA 1WJ9A 2DGQA 4MKBA 1JJ2R 2GGPA 4JYZA 4CLUA 4WFAQ 1KWMA 3JSRA 2EFVA 1L3UA 3VVUA 4NYZA 2Z58B 3PEHA 4CLSA 3AJDA 1UVIA 1RCXB 2JH3A 4PPDA 4ECYA 2R8KA 3Q8YA 4ZVHA 1X0PA 3TZZA 4KH0B 1NHKL 2WB1D 3KKFA 1LFWA 2BM0A 1DHMA 2AJ1A 2N3OA 4JYAF 4X62F 3LANA 3G82B 4FYXB 2KHDA 2MKIA 4CO0A 3CUNA 1UAWA 3QWPA 4Y65A 1U48A 1S5ZA 1T3OA 4RNOA 1NK0A 1RBLA 4HL9A 1XNQF 1MN7A 3H42A 1M0SA 2OPRB 1FRHA 5AE1A 2DGSA 1S1WA 4P71A 5KFTA 3ILIA 2EG2A 2BR0A 4C8LA 2EGWA 2HMIB 2ROEA 2QV6A 4U95A 2ZH5A 2M8DB 1FNOA 2K1RA 2EXUA 2IFXA 2RD5C 3C66A 2M4MA 3M2RB 4J90A 4K50A 4DR1J 1JLFB 2G0JA 3OW2R 4F8RA 3IO1A 2C22A 3N9UC 2L08A 3IRWP 4ILLA 4GRSA 2VV5A 5THWA 1OSCA 3D54A 3KWMA 3K5NA 1TL4A 4CLWA 2RF2A 4TY8B 4ELUA 1FRKA 5GAGI 1R8PA 2ERRA 2FLOA 5HN0A 1FDNA 4UY8T 1JJCB 5AT1B 4FXVA 2QA4G 1BLUA 2VC0A 3TEGA 2GMHA 1Z4UA 2FLLA 3KG1A 3R9LA 1UZHA 2BZ2A 4OZ1A 4O3NA 3UW1A 4F26A 1DAXA 4F67A 2J0XA 2AYBA 1KP6A 3B4DA 3GV7B 5L1LA 1K0TA 3IM9A 3J7ZV 1VRUA 4K5SA 4KO0A 2ZUGA 3VR1A 1FJGF 3AD8C 3CJ2A 2LP4A 3OLAA 5J2QB 4UTGA 4B9UA 3FRYA 1X9MA 4K4XA 4KT0C 4UY88 1T94A 2D1CA 3C8YA 3CO9A 3QT8A 1HD0A 1UZDA 6AT1B 4A8QA 1N36F 1DRZA 1UWAA 1RTHB 5EWEA 3ENWA 3V81B 4O3QA 4H54A 5KFMA 3N28A 2RVJA 1I6JA 2PFDA 2I8EA 3NGSA 3W9JA 2R8HA 3OJSA 3P45B 5BR8F 3PKYA 4BS2A 5HMXA 3KK1B 1VK3A 4BBYA 4D3GA 2R7OA 4C8OA 1FFSB 2F9DA 4AFFA 2MHEA 1SBRA 4O4GB 4ID5B 2XHWA 1NDCA 2O67A 2LA4A 1TKZB 1U25A 3KJQB 2BKPA 5KFQA 3KK2B 1XMOJ 4DQIA 1RK8A 2FD2A 4LF6J 2GVDB 2ADCA 4RU2A 4W98A 4XO0A 2PC6A 2DGXA 3KMSA 4QIFA 4RWXA 5H9FJ 3I5BA 3O2IA 2YXLA 4NZ7A 4YN3B 3UNYA 3IWLA 4P74A 4CH0S 2IHR1 4KRWA 2Z4PA 3W2VB 1OQ3A 2GHPA 1T9XA 3R6GB 4OYIA 2GIQA 2L3MA 1FE4A 2ZM6F 3CCZA 1M5OC 1T0TV 3CCVS 1SH2A 1NKCA 5LMUJ 2QT7A 2E1PA 1TFWA 1AB8A 2GQ2A 3P96A 4WK3A 2GGPB 3RW7A 1LV5A 5L9NA 4TU9A 2CPDA 4ANDA 5B0AA 1FD2A 5KFLA 3R5BA 4U67Q 3JQMA 3D6FB 1JLAA 1YKWA 4L69A 4P52A 2QZ8A 3RUBL 4RNFA 1PYOB 3W7BA 5F8NA 4MIWA 1GFWB 3DLLS 4NE9C 2GJIA 3DLGA 4V19X 2FQQB 1JKHA 1S1TB 1KHWA 1GMWA 2VKRA 2CPYA 2W9BA 3CVKA 3VAMA 1QSYA 3OUYB 1KONA 1YJTA 2W7PA 3NY0A 4JI4J 4QIGA 5C24A 1R6YA 4NA3A 2F4FA 3DOMA 5KOWA 3NMRA 2FZKB 1RT4A 3NWRA 1JJ4A 2BXJA 1SQGA 5ETPA 4B3RF 4BDPA 3QATA 4M5GA 4MK9A 1U6FA 2XM3A 2MKHA 3SXLA 1LW0A 1YRTA 4DV7F 3V81A 4YHHF 2QA4S 3D3BJ 3JAMU 1M5SA 1J5OA 3EICA 3VGSA 5HLFA 2C2KB 1U09A 3L4BC 2X1AA 2R7WA 1ZPVA 4M5JA 4FP9A 4IQMA 3MFIA 4DPUA 2RMLA 1B0PA 2VB6A 3CD5A 3EDRB 3EVOA 2EFNA 2PD1A 3BB5A 3DDNA 3H0PA 3LW5C 3M8YA 3I82A 4BWMA 2JEGA 1YLXA 2DHSA 1NK4A 3GIRA 1DBDA 3P5BP 3P49B 2OJ3A 1UDXA 1KD1T 1UFKA 3A3NB 4M5MA 1PAUB 2Q6CA 5KFUA 1WKJA 5KG0A 4DV5F 1VOMA 3OL7A 1X4BA 2DNOA 3PCOB 5T14A 5ETLA 1XQIA 1S6PB 2GIRA 2E1MC 3FVYA 4JP8A 5AXKA 4EO8A 4MYTA 5KTQA 4M5DB 3JYTB 3PNIA 3GONA 1HR0J 2AX1A 2K7JA 2VG6A 4LR9A 3KDNA 3I4PA 1RWWB 1VFJA 1GTHA 2A2DA 1KQGB 2WSCC 4CLFA 3HZGA 1NDKA 3OVAA 4WKYA 4URQU 1R3NA 3QSYB 4M95A 1JLFA 2FY1A 4J9PA 3TVZA 1RWUA 1EXDA 1UEKA 4BC7A 1YWXA 2Q66A 1IKVA 4WP9A 5HBMB 2ADBA 3ELHA 2GQQA 1X9WA 2J7KA 2LU1A 1ZTTA 2HAIA 1D6KA 2C3MA 3MFHA 2VOPA 3NS6A 2HVHA 2GZOA 3HX9A 3LAKA 3HVAA 2BJ1A 5C2CA 3R5AA 2VQFF 4MT1A 1UL3A 4UOFA 2BV3A 1XR5A 3QGIA 2B9WA 4F0KA 1J5OB 3PIOS 1FERA 3OTCA 4NLYA 1S6PA 1NAQA 3BYRA 4HI1A 2WOMA 2RD2A 4N8OA 4B9NA 1S4EA 2B6AB 4ITSA 4I4BA 1NK5A 3GWCA 3SCLE 1SIWB 1ITPA 3DMJB 2HFZA 2GMJA 2WW4A 3F44A 3MEDB 4YDDB 4X4NA 3OTOF 1FNMA 4KV8B 2PEHA 4NLQA 2MQPA 2XQCA 3EDQB 1H38A 1I94F 2HHHJ 1K1QA 4ZPVR 2R2SA 4J9QA 5ETQA 4RKUC 4DR2F 1LWEA 3GYGA 5CXTA 1QVFR 1I3OB 1NEEA 1QAJA 3PYDA 1V3RA 2RT3A 3IXQA 1OYEA 2YKAA 3CD7A 5GMDA 2QYCA 3C3LA 2KG1A 2DPJA 4ECRA 1SJ3P 4M5DA 3IMQJ 3JYTA 5K14A 2I9SA 2HBZB 1UFWA 5LSRA 4DSIA 2V4JB 5I3QA 4G6VB 3FC9A 1GXUA 3DLKB 4OV6A 2E7XA 4U9RA 2BANB 5DDRC 4USHA 5CH7B 5HQLA 1WKLA 4UQTA 4C97A 2W8KA 1QTMA 3SCJE 2CQ3A 2ZJRS 2E5LJ 4ZS6A 2ZJRQ 3W2WB 4FN5A 1QE1A 1TL7A 4J37A 4L73A 1JMTA 2CFXA 2CVIA 3P8BB 4OHZA 3I56S 3CCRS 2OUGA 3AOAA 2R7XA 2HLUA 4NA2A 1BQXA 3O3LA 4KPYA 4PRFA 2QMWA 1RTZA 4RZRA 5E3RA 3M2UA 3V5RA 2DITA 4C11B 4QYZJ 1C1CA 5KFZA 3AJ2A 1U7LA 3K8VA 4R0EA 1U02A 3CJ0A 4GMKA 4P72A 4RW8B 5I3UA 3H2LA 3FQKA 1KNZA 1YZ6A 2JOQA 2R7RA 2V8PA 1NBEB 2EFQA 4BLGA 3PTWA 3EXYA 3ZTRA 2NWAA 1HBNA 1XEZA 2JFKA 1RU1A 2G4BA 3DGPB 2OSQA 4OIXA 1Q86T 2BRLA 2XMTA 1QJHA 1XK8A 1SH3A 2CADA 2PE8A 2WRMA 4ECUA 2R3VA 2F4VF 2PJJA 2VG5B 3LP1B 4HVZA 3HVRA 4ED1A 1S6OA 2K3IA 1OSDA 1TVRB 4DU7A 2VJVA 3PIOQ 3BDPA 2YWGA 4EU0A 2RHSB 2NQPA 2YTCA 1RP5A 1LWXA 1TU0B 1HQEA 3FGVA 4LF9F 5J2NA 2AW0A 4ZJOA 2RSQA 4E2FB 1MMNA 1UETA 2HAFA 2O5DA 2CWKA 2GAEA 4WFAS 1MU2A 2CZVC 1PO6A 1UEVA 2RDIA 2C3UA 2ZNYA 4YUDA 4CLKA 7AT1B 3KK1A 4QIWD 1FKOA 2LEBA 1Q78A 1RAIB 4P9SA 2QLJB 4B3OA 4RW9B 1YGYA 4I7FB 4PABA 1T9VA 4UOCA 3T5JA 2J9EA 2UV8G 3OTEA 2AJ4A 2RRBA 3BEGB 2CAJA 2XMVA 3DRPA 1N6QB 2KT5A 2W2NP 1FT8A 3SSRA 5GAEW 5GAHW 1U1RA 4RUBA 3I5AA 3HI9A 4B3OB 4QWBA 4Y00A 3DRPB 3GJRB 1U1NA 1RHRB 2GW8A 3I55S 3FSIA 2RJZA 2VFSA 1RT7A 2XI2A 1IM6A 3PJXA 1OMSA 2HFSA 2W2QP 2MGZA 4ZIVA 3I5CA 2N4DA 1Q0NA 3DM2A 4FS1A 2PA3A 4HI2A 3IR5B 1NH8A 2DXEA 4O3SA 6FD1A 3PFOA 2CNOB 2KM8C 3HHEA 3RB0A 4F3QA 3IBCB 5AE3A 1TKXB 1VDHA 3Q8SB 1DZ5A 1BXNA 4ECTA 1I5OB 3DXSX 3N01A 4NEYA 1U2CA 5LSLA 1GX6A 4KO0B 3RYLA 1U24A 3GFHA 1APSA 1QLNA 4ZVPB 2E7VA 3IGVA 4AL5A 1NB2A 4ZN1A 3M9OB 1A9NB 4RNNA 2JHEA 4DF4A 3BSAA 1RHJB 3MD3A 3H40A 1WF2A 3AXMA 1P27B 3EXCX 2DNNA 1HWUA 1Q8LA 4ZPDA 1PG5B 3A8KA 1S1VB 3OQ2A 1UVNA 2VDIA 4O23A 2A0FB 3CCUS 4OX9J 3RAQA 5DM7Q 2DIUA 2IMOA 1CJVA 3D0HE 3EYZA 4DQSA 2VJUA 3DLLQ 4HEA9 4R8UA 1FWKA 1N6QA 3OFEA 4OJ3A 4LBHA 3SQGA 1SJFA 5J1EB 3QFWA 1BE4A 1FK9B 4U67S 3KLIB 3SIPB 1B7FA 4NMLA 5A8WA 4UQGA 1S9EB 1AUDA 3OXGA 1DTTB 3QJLA 2R9LA 4DJBA 4CNZA 3F41A 3QT5A 3MAHA 3GP9A 1HBMB 4IFYA 1KC8T 4JI6J 2HVIA 2H54B 2WVFA 4IDKB 4TQSA 3K5OA 4Z7CA 1N0UA 2PNWA 3ISNC 3HMJG 3I0SB 1FEHA 4TY9A 1U2FA 3UD5A 5KFJA 3PX6A 4GC6A 4G1IA 1AFIA 1F5CA 1PJ7A 3BR9A 1PSDA 2DH8A 2HNDA 4FNIA 4ZPBA 4ICLA 3GV8B 4O44A 3RBEA 2NCKL 3FBEA 5E2QA 3VVTA 4NX9A 4PWDB 3HKZD 2DYAA 4DSFA 2UV8A 2R8GA 1TZ0A 3MEEB 3WC0A 1WTFA 1NU4A 3H59A 4KFBB 3VZHA 4Y0FA 4DL4A 2CJKA 1TL3A 2PI4A 4AQYF 1ICEB 2RHQB 1SUQB 5CQGA 3RAXA 3FSXA 1RQ0A 2CG8A 1XR6A 2IJNA 2LQ9A 2NXCA 2ZBRA 3D6MB 3FEXB 3NBPB 1EUQA 1SV5B 1WSRA 3C6UA 5KFYA 5CCLA 2AU0A 5DG7A 3HF5A 3BQ1A 1LEOA 3VAJA 2HVDA 4C11A 1S79A 1W2BR 2V8GA 1R7IA 4R8UB 4Q43A 3PO4A 1YX2A 5BJRA 5EWGA 2KRRA 3KFWX 3UD3P 2X1FA 4E8BA 3TUJC 2LXFA 5GVQA 4KPCA 4MKVA 2AYGA 4M5LA 4JI2J 4FF3A 1NDPA 1FF2A 4NLGA 2M3DA 3FFIB 2W24A 2DK2A 5IC6B 1NKBA 2HHHF 3OV7A 1S7HA 2L9WA 1HBMA 2DHXA 2HWIA 4IFYB 1X4CA 1TAQA 2BJEA 5HVHA 2N7CA 1P9YA 3HM9A 3OL6A 2W9CB 4KFBA 4NLXA 1WF0A 4B3SJ 1RWXB 4WZMA 2V63A 1RAHB 1M5HA 4ZCLA 4DPXA 3BV8A 1ELOA 1OYDA 4M94A 3JAMY 1JXVA 4JV5J 3FNNA 2MKSA 2OLWA 3PXGa 2YQ3A 3QGPA 4EBCA 4ED7A 3OPKA 3ICLA 4RNMA 3M8PB 4CLTA 2HS3A 2LEAA 1KHVA 2F1FA 1SQEA 2G1DA 2VC1A 4QJVA 3TAMB 4DV0F 1SI9A 4DS5A 4OHVA 1TK5A 4ZIWA 4ED8A 2FZGB 3HP6A 4JI8J 1HARA 4ZVSB 1FJ7A 3KLFB 3CT9A 5HANA 3G9CA 2B4VA 3AD9C 3UDLA 4WFNS 1L3TA 1S9EA 2WK4A 3UVJB 5D3GA 3CGIA 2PI5A 3K89A 4MK7A 1BQNB 5KFRA 2F8EX 4JI8F 3PYEA 1F3VA 2H1YA 2GAGC 4OI3A 5T7LA 2W4DA 2E5HA 2XYPB 4HHJA 5AXMA 1RTJA 4X4TA 1Y9OA 2UP1A 2E5GA 2HPUA 3THPA 5KAKA 1WKKA 2LXUA 3FMWA 3PW4A 1N5YB 1H2UX 3M1VB 2HIYA 3SDEA 2DH9A 4OX6A 1U6BA 2CYYA 2KTQA 5LMNJ 3DOLA 4TKTA 5KOXA 1AUSL 2V2VA 2M5YA 4YR0A 1GT8A 1TK8A 1HLWA 2ZUAA 2BACA 1VHFA 4Y2KA 5HO4A 3BSOA 1TP7A 1XMOF 5C42B 2UXCJ 1U45A 1H6KX 2FVQA 3MCNA 4K4TA 3CC4S 2MLYA 1RE1B 4FBUA 5DETA 3OFFA 3Q89A 1CS4B 3TA1A 1QTQA 1VQSA 3ZXWA 2UUAF 4NLWA 2QA2A 2EK6A 5F41A 1UWBB 4B3TJ 1X8DA 4B08A 3C16A 1BUXA 1P8GA 2G13A 1H72C 2C2ZB 2C3YA 5F8IA 2AEMA 3NG8A 3S6EA 4Z37A 3QSIA 4NYOA 1BY9A 2F40A 2W7AA 4JV0A 4ZVOB 3IA0A 2E44A 3D66A 2Y0SD 4I56A 4KY3A 3ZZPA 4NXNF 3NCPA 3JSMA 3PW0A 5A0YA 2KYXA 1MWQA 2QA1A 5L1JA 3M2UB 3GQCA 4RW6B 3DXBA 3THVA 2FJBB 2CJYB 1RLDA 1NJIT 4HT7A 2JNJA 3FRZA 1H3DA 5CYMB 4LFBF 2ZJPS 4M5KA 3W62A 1ZA1B 5DQHA 4ANEA 5K9FA 1UEUA 1WEYA 2NR0A 3HVTB 4IG0A 1GX5A 1LWFB 3SCKE 4J9VA 3RB4A 2P9EA 2HNZA 2DCUB 3KDOA 3M30B 4IH5A 5LL6d 3U7JA 1YRUA 1RAGB 2P6TA 1VK8A 2X3GA 3DLKA 4IG0B 3GZ7A 1FX4A 4IRDA 1WHWA 2ZZNA 1PIEA 4P2SA 2D69A 1HI8A 1RHQB 2MKCA 3FBBA 3HD2A 3SFGA 1HNXF 1R0BG 1X5PA 2HQFA 3UD4P 2YPZA 3EGWB 2IRUA 4WBFA 4PZVA 3G82A 2DNLA 3ETMA 2HBRB 4NCGB
chains in the Genus database with same CATH topology
1ZM2A 1QUPA 4OFZA 5ITHA 2ZH6A 2E9TA 2XBPA 2JC1A 3CE8A 1LWEB 1MWZA 4J9MA 3NMAA 2VPYB 5KFSA 3A1YG 4I2QB 1TR0A 2IM0A 2OMLA 1BQNA 1T02A 1VS3A 2OPSB 3TX8A 3U27A 3K59A 1ZYQA 4LF8F 2IM3A 5L38A 1FJGF 2FJVA 3KK3A 3S8SA 4A8SA 4NPOA 2CQCA 4CTAB 4ED3A 2FC9A 2QMXA 3E51A 5IM0A 2XGQA 4Y28C 5JUMA 1HR0F 1S77D 3CJKA 3VAHA 3AA9A 1YTYA 3DOLB 5KFWA 4TN2A 5BYSA 1CEZA 3QPIA 1FKPA 1RTJB 2MQMA 2AYEA 2B9XA 1GNKA 1TKZA 2IAJB 3UWTA 3CDAA 4IR1A 4DX8H 4KB7A 4XDCA 2ZOMA 3ETOA 5I42A 1C4CA 4QR1A 2LDIA 2JJ4D 2D3ZA 1S76D 4X4RA 3CF5Q 2FLNA 3H5SA 3IG1A 3PKMA 2W8LA 4CQ1A 3RBDA 2LEPA 3IWXA 3MMAB 5KFGA 2GV1A 2Z8QA 3MECB 3T9ZA 4YY3F 2AGQA 3DRSB 2OKQA 3TI0A 2JC0A 4CT9A 2VG6B 2E1CA 1QUVA 3M2VB 1XWLA 4CO5A 3BN7A 4LQ9A 1IQZA 4NRUA 4QPTA 1ZZFA 2R2RA 1FXLA 3MM9B 3O5TB 4NXMF 1FO1A 4C8ZA 4DUZF 2KFNA 1CPZA 1K0TA 2VH7A 3V6JA 2DVIA 1HNVA 7FDRA 5EWFA 3D28A 4AXJA 3T3FA 3IS9B 3K8WA 3LGNA 3HPOA 4ZMMA 2KRBA 2XY5A 1CC8A 4LIWA 2ZBIA 3GB0A 1IJFB 3NCQA 3UR0A 1JJHA 4NLRA 4ZLPA 3H20A 3MEGB 4EWTA 2CJQA 4J9LA 2RF2B 1S0VA 5DM6S 1JLEB 1HL6A 4QU6A 5LMUF 1FVQA 4HLBA 2OD6A 3PV8A 4DSJA 3DU5A 5JJBA 1NH7A 2EG1A 3OVSA 1FEUA 3VAKA 3DN9A 1FRXA 1HBOB 3I0SA 2W9CA 1WTBA 4PKDB 3G4SS 5B09A 4DFMA 1HD1A 4ZPTR 1G2EA 3D1HA 2CIMA 4X84A 4ETXA 3HVTA 4HTJA 1I1GA 2C2DA 5CZXA 3UPFA 2MQNA 2V9KA 2MJUA 1N56A 1N54B 2HHQA 1ZOTA 1IKYB 2JVRA 4RUAA 3MUVP 2DCLA 1VIOA 1X5TA 3T5LA 2FPHX 4QWDA 3KLGA 4CTAA 4X65F 3T1YF 4O3PA 3V6DA 1VC0A 4HDGA 3Q8RB 1QAYA 1G6BA 2J8AA 4I2QA 1DTTA 3B78A 5CYQB 4DR5F 2B51A 1HA1A 3SMZA 4QU7A 2ZHAA 2XSJB 1RT6B 2W7OA 4HDHA 1KLMA 3T1AA 2OTLS 4TYBA 3OHBA 3SYZA 1RT3A 5GMKa 2E9ZA 1JXEA 5CYJA 4PPZA 2VBYA 2OP5A 1BD6A 4OX7A 3DRSA 4PQUB 3VTIA 5HP1B 4I64A 4NYPA 3AIIA 1S1VA 4PG5A 2CQDA 4L3NA 2BUNA 3TNVA 5A8KA 3K5LA 3MPVA 3DHWC 1NYLA 2JLGA 3BO2A 3RRHA 2FJDB 4CH7A 2ATLA 1CQMA 3H5YA 2MZSA 3OJUA 3MPYA 4C7QA 4PUOA 1M5KC 2ZJQS 2CQ1A 1FK9A 3KLIA 1Q81T 1EETA 1RTIB 1JLQB 1CLFA 1WG4A 2VA2A 2KXHA 3LUYA 3OTDA 4JI5F 4RW4B 2FLPA 3HHKA 2RIJA 2HIQA 2YWEA 4A48A 3POTB 3MUMP 2YNIA 3DCAA 4DUYF 3BF4A 4FZVA 2MSTA 3KNAA 2DPIA 4DL3A 3VQSA 1HQUB 5DQGA 3DOKA 3I6PA 4WFBQ 3VAIA 3KOAA 2IYIA 2UZAA 4NWBA 1HFEL 3JSYA 2KJVA 3ZZ0A 2UXBF 3Q8QB 2I1RA 4IOAQ 3B82A 3OLBA 3MCSA 4OJ1A 2OSRA 1SH0A 3NKYA 4IRCA 4WFXA 4TY8A 3OL9A 3CCLS 4PG6A 1FD8A 3M8QA 2R7VA 2J7UA 1N5VA 3KK2A 4RBTA 1VBYA 1RISA 1JB0C 1EETB 1RGVA 1HNIB 1WHYA 3E01A 2DNQA 2J9DE 3VQTA 1X0FA 4JI0F 4DLGA 3BSCA 5AE2A 2QIFA 1UVJA 1UFLA 2VOOA 4NLTA 4ZPCA 3TAPA 1HYSB 1FDBA 5GAEU 4LSLA 2KFZA 1RT2A 4LSNA 1UA1A 2CQIA 2B56A 4K2XA 5F0UA 4D3HA 4H4KC 1KQSR 2FB0A 3MAQA 2A1BA 3J7YI 2HGLA 3EPIA 1TVRA 4K4WA 1TL1A 2RQCA 1L3SA 1AFJA 3R5CA 2NSBA 3M6WA 1RT3B 5HMYA 1JLCA 1O0BA 2COLA 4JXXA 3TA0A 2BA9A 1Y5IB 3DU6A 2Z2MA 4URGA 3IN5A 2MQOA 2OPQA 3UE2A 4XIUA 2FGOA 2JZ5A 3NLCA 5C25A 2DD8S 2XY6A 4J9OA 5E41A 2PGCA 2B43A 2K3KA 3QIPB 5KFIA 4F4YA 3TAMA 3KLGB 2N4CA 2ZD1A 4ED5A 4FS2A 2KJWA 1IN0A 1DQ9A 4ZVFA 5A8RB 2L41A 1X4EA 2BQRA 3H8YA 5HMZA 4GKKF 3HT3A 1ZH5A 2BDPA 4IYQA 3B8HA 2HG4A 5HROB 3RTVA 2RRNA 4ECSA 4QBUA 2KXFA 4KSEB 2B4OA 2FHOB 2JL9A 4AL6A 4USJC 1E6YA 1K1SA 1RA6A 2ROGA 2X51A 2WOMB 3CSKA 5GADI 3HHLC 2DISA 3V4IB 2VA3A 1MW7A 4QW9A 2OPPB 1HNWF 4K4YA 1SJQA 1Q1KA 4I6WA 3GFYA 3KLVA 1TFYA 4B3MF 4FXWA 3Q8PB 2LQ5A 2HGMA 4K4SA 4ED6A 1HNVB 1Q79A 2FHKA 2H9ZA 1S10A 4ELTA 4JUZA 3J81Y 3K2YA 5H1SV 4UW2A 3JB9k 3MM6A 5G4DA 3EZUA 4B9VA 4OHYA 1KFDA 4AYBD 3GG0A 2CQ0A 3WX4A 5B7WA 4KBIA 2RILA 2XMMA 2ZOGA 4WU2A 1U1LA 3OR1A 3OXLA 2YH0A 1S1XA 1FJEB 2ZH1A 2Q6BA 5DDQC 2OIHA 1Z2LA 2BE2B 1CSJA 4BC9A 4CCHA 5GAGW 1Y4ZB 2XZWA 2C28A 3CDWA 1Q8IA 1U1PA 1DFUP 3M8SA 1RT5A 2ZE2B 2XMJA 1VQ9S 2RRAA 1T03B 1LK5A 3G8TA 2B4PA 1ZTWA 3V4MA 2OO4A 2LVWA 2OPSA 4WYLA 3BO3A 1OQ6A 2B5JB 3DYAA 4L72B 4WXWA 4OZNA 3N5FA 3C6TB 1PC5A 4NCGA 3UCGA 1LWCA 3VWSA 4X4UA 3MMAA 2PMHA 4FF4A 3QJJA 1S4FA 2RQKA 3BGRB 3M32A 1FKAF 2HW3A 4PQAA 3HLUA 1FKOB 4ZPAA 4CIOA 1H7XA 3MMBB 4Y2AA 3KJVA 4QWEA 1RTDB 4FF2A 5KG1A 2Q1LA 4I0WA 4MIAA 3JSBA 1UVKA 4GO5X 1Q82T 3OBIA 1B0VA 2CPIA 1NZAA 1VJWA 4KQZA 3HHNB 4WCEQ 4AL7A 4RW6A 1VQOS 3GIIA 4OL8A 3H5UA 1QAIA 1URNA 4EBDA 2MGZB 1M5PC 2CDQA 5I42B 3R5DA 4N76A 3KMQA 5KT6A 1VQNS 2YNGB 4MAKA 2HZCA 3AH6A 4OJHA 2ASLA 2GMLA 1URRA 3IRXB 3MGJA 5K8NA 4CZCA 2KVIA 1FA0A 2CQ2A 2FHMA 4NLVA 4EBEA 2FJWA 2NS1B 2FJXA 3U1LA 1DTQB 2RE1A 4R5PB 2KFYA 4WKRA 3ZFVA 1AXQA 3J80Y 1RYSA 2HWHA 3CTRA 1JK9B 3SI8A 2BJDA 2OMOA 3LWMA 5E7OB 1VC5A 3HJFA 3KK3B 3PY8A 5GAHU 4ES2A 2YWHA 3MR3A 2W9AA 1OO0B 3K7RA 4RBVA 4YR3A 3D0IE 3LALA 1D3WA 2J9CA 1TL5A 1N5QA 4F3OA 1PGZA 2EI5A 4EZ6A 3VALA 1U49A 4IQXA 1R27B 2CQHA 2NUUG 1C0TA 3PACA 4FXDA 2I5JA 2GA7A 2ZITA 2EKYA 3OSNA 1VLYA 4WFZA 3VAGA 4ID5A 2MYFA 4YB1P 4Y6IA 3UQSA 3DM2B 4ATNA 5CHCB 2XULA 2YNGA 3NAIA 2MMYA 2YY3A 4RW8A 5KFHA 3H4DA 3AQOA 5KG7A 1FESA 1FXDA 3UFCX 2APOA 3G96A 3KHHA 1N8RT 4F3MA 2M88A 1RTHA 3MHYA 2QSFA 4I6YA 4H4MA 4Q2LA 1QM9A 1UWBA 1SKWA 5IXUA 4ECWA 1BC6A 5DQIA 1UKUA 5KFVA 1YG0A 3ENQA 1JLQA 3LP0A 1UVMA 4EYIB 3TAQA 2VODA 3MMBA 2GC8A 1G1XA 2AF6A 1WEZA 2C2RA 2GHVC 3BGRA 3M32B 1S0NA 1N5SA 3QAUA 1FDDA 3DNCA 2A3JA 2IJFA 2YNFB 4B9TA 2PN6A 5KT2A 2I0XA 1X4DA 5HL7S 4TNOA 1N5YA 5HI7A 3X3UA 1IBKF 2R7TA 2CPZA 2DBBA 2JDJA 2RS8A 3N6LA 1RT6A 2R2TA 5B0EA 3G6XA 2XCPA 4ERDA 2HWTA 1KQFB 1F5AA 2IRYA 4B9SA 4QIVA 4IOCQ 2L9NA 2X1GA 1PC4A 3HXMA 3CCQS 2VFRA 3E2EA 1KOOA 3BGFA 3N5BA 2VQEF 1LQ9A 1X4GA 2OH2A 2OFHX 3MZIA 2E1AA 4C0OC 1WG5A 2EFGA 1U1KA 2VG7B 3V4IA 3PW7A 3CD6S 5JVHQ 4C2MA 2DNPA 2LA6A 2HNDB 5T7LB 4P7VA 3LP2B 4OI6A 4ZKAA 5CCMA 2ZHBA 3C2PA 4Y34A 1R8AA 4CT8A 3TVKA 2VPZB 1IKVB 3QJPA 4K5RA 5D4OA 5C24B 1GTSA 3BS9A 4LMZA 4OX8A 1TL3B 2EWHA 2E5JA 3FFIA 3MTKA 1HBOA 4WTYA 2QEXS 5HP1A 4KKOA 1S1XB 2OFGX 3NNAA 1WG1A 1WHVA 2XC9A 3SQGB 1T05A 1XMBA 5T41A 4IH7A 3AJ1A 2RUGA 5DO2A 2R7SA 1KLMB 1VQ5S 1CQNA 3G6VA 1KOHA 5K8MA 1SL0A 5E33A 1UA0A 2DJWA 5EN1A 3IS9A 3PFEA 1PILA 3PEJA 1NHVA 4FNHA 2MKKA 1P9QC 3CULA 1JLBA 2QSWA 5DLGA 4YMEA 1JXLA 1V3SA 4P6QA 4ECZA 5E3AA 4U7UK 3FJ2A 3HZEA 3OTBA 4A8KA 3LF0A 1VRTB 3AAWB 2GFFA 3C46A 1U1OA 2EK1A 1R8HA 2KB2A 2SXLA 4KKOB 4C8MA 4RU9A 1XNRF 3MECA 1TV6B 4M63A 4DSKA 4I69A 4LF7F 1NJZA 4W92B 4CNYA 3AHPA 2DGVA 2YKOA 3NBPA 2FTRA 2KG0A 1LXJA 5HMWA 3NGKA 4QYRA 2HVZA 4B9MA 3KHGA 1W2IA 4JI2F 4N5SA 2XMWA 3TUIC 3Q23A 1R8CA 2EPIA 3P5TL 2DR5A 5A2QY 1DJ0A 4QW8A 4DLEA 3GYNA 4E0DA 3TANA 4C3LA 4N56A 4EYHB 3IWNC 3M8QB 3NRBA 2ALZA 3BDEA 1B0TA 3MOZA 2KDOA 3N0VA 3GIMA 1S9FA 2ZZMA 1X5OA 1VQ6S 1D9DA 2XS2A 2VBWA 5DGBA 4DL6A 4A4JA 4ES3A 5L9XA 1NK9A 4G1QB 2KT2A 1SIZA 4TLRA 4EO6A 4B3TF 2DR8A 2YKQA 3PHEA 2ZBCA 5L8RC 3MMCB 4E98A 2KO1A 5A8WB 3J7YU 1DURA 3W2VA 3L7OA 2MZ1A 3MR5A 1JNRB 4DV4F 1J2VA 4ID8A 3PX4A 4EGLA 3KG4A 1YQHA 1YJVA 3HFKA 3EX7B 2Q43A 4KTQA 2XS5A 1TKXA 1J5EF 1SL1A 3ZZUA 4JOUA 2RS2A 2AYMA 2AJ0A 1RAJA 2VKZG 1XTZA 2V2KA 3Q0AA 3ZZYA 1HBUA 3DGPA 5DG8A 5BNZA 1Z2ZA 4NZ6A 1HWKA 1X9SA 5KFNA 3EPGA 5EDWA 1HYSA 3CCTA 5CA5A 4JV5F 3QGGA 3KHRA 4X2BA 4ZK7M 4ECXA 1HI0P 1F9FA 2ZDPA 2I38A 3AY0A 3J7ZT 2MZQA 4MFBB 4Y2MA 5K8OA 1YSJA 2W4CA 5DGAA 4TLQA 1VBXA 1VQYA 3POTA 2JLEA 3SDEB 1FKPB 2KT3A 5KG2A 2AGPA 2E1RA 2HFOA 1IKXB 4DHVA 5JVGQ 4ALZA 2LKZA 4KC5A 1V6HA 4OI0A 3EGNA 1Z1ZA 1T95A 4KIAA 3CJKB 4DG1B 5LMNF 1IBLF 4YDXA 2J0QD 1HBNB 3Q22A 2U2FA 1MNEA 4ECVA 3PRBA 1VQ4S 4PUOB 3CJ5A 4B9LA 3OHAA 3PW2A 2J6TA 1S6UA 3FQLA 4F2RA 2M0GB 2RKIA 5B0GA 2GX8A 3O8WA 4PXEA 1U8SA 4MTPA 1Y7PA 4FPRA 5IQ6A 1VMBA 1S6QA 5M2RA 3PIPQ 2PIIA 3BN4A 1QVGR 2PO4A 2JFDA 1CVJA 2JEIA 1VBZA 3S01A 3KYLA 2IA6A 3F73A 3TR5A 1KN6A 3SFUA 2P6SA 1HWLA 2XSJA 5KFPA 4RW9A 4FYDA 5A6WA 1O0PA 4ZHRA 4Q0BB 2P9CA 2E66A 1IUJA 1D9AA 5KFOA 4OZJA 2GQCA 2KHCA 1N88A 2NPIA 2FVSA 3V6DB 5GADW 2DT9A 4A8MP 4JXZA 2KYZA 1N4LA 3RRGA 4CI0B 5DRKA 4EEYA 5K8PA 2DTJA 2NZ4A 5KT3A 4KHPF 4DEZA 4RNHA 4YB7A 2M9KA 2QLXA 1G7CB 2IVMA 2O01C 4R0JA 2AGOA 4NLPA 3E8OA 4DFKA 1AW0A 1KLNA 4CO1A 1VRUB 1ZJWA 5EHHA 2YX7A 2LU2A 3CDUA 2B4UA 4UUWA 1S48A 4WYWA 5DDOC 1U1QA 3MEDA 2KXNB 3ISND 5D78A 2VPWB 5AXLA 1EUYA 3GFXA 5LT5A 3T1HF 2NXUA 1N48A 2L9DA 2HGNA 3MMJA 3I0RB 2C3PA 2ZOFA 3UNGC 4X4OA 3UCZP 3LOUA 2XLKA 4CO4A 1FRIA 1FEEA 3I0RA 1WHXA 2J0SD 3TQ1A 1P6TA 4UY85 2D9PA 4QPXA 2ACYA 1HHTP 2K7KA 1GQEA 1OIAA 2YNHB 2AD9A 5HBMA 3CB4A 1QSSA 4IO9S 1HWJA 2V8HA