4H4KA

Structure of the cmr2-cmr3 subcomplex of the cmr rna-silencing complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
259
Chain Sequence
b'VTFTPYDVLIPLPQTVAGAIRTLLFYEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRILRIEKIYAWIEDPGCGIKDILSSYEFLTLGSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cmr subunit Cmr3
publication title Structure of the cmr2-cmr3 subcomplex of the cmr RNA silencing complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Rna binding protein
total genus 55
structure length 259
sequence length 318
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4h4kA02
3.30.70.2940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4kA01
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4kA03
3X1LB 3W2WB 3W2VB 4H4KA
chains in the Genus database with same CATH superfamily
3UD4P 2ZOMA 1UJ5A 4KGKA 4DR3J 2ZJQS 2LQ9A 4C2MA 4JV1A 2ALZA 2GV1A 3GONA 3G9CA 4CO3A 3CJRA 4B9MA 4W90B 3I5BA 4OJHA 1Y7PA 1HNIA 2PC6A 3IGNA 1HBUA 3SQOP 5DQGA 2DKOB 3V6DA 1X5PA 4X4UA 5C25B 4P72A 4LRAA 2KT5A 3Q23A 2JFDA 2GMJA 2ZZNA 3DMJA 2CPDA 3JSYA 3UQSA 4ZS6A 1VBKA 3OR1A 4WE1B 1V3SA 2E5GA 3OVSA 2CNLB 1FEUA 3CDAA 3E01B 4ICLB 4H4KC 1EX8A 2DXDA 4Z7CA 5IT0A 1Y00A 4CH0S 3K58A 4DG1A 1F60B 3MDFA 4ATNA 2EXUA 2HNYB 2Z2MA 2FTRA 2AF6A 3LP0A 3ZNUA 1Y9OA 2W7OA 1ZYQA 3DU6A 5J1PA 5B08A 1NCLA 2D3O1 3AD8C 1XN9A 2FB0A 3NKYA 2Z0GA 3JXOA 1Q7LB 1ICEB 1N5QA 2EVZA 4FYWB 4JI8J 3SEOA 3RBEA 1N5YA 3MCMA 3JYTA 2C3YA 2QL5B 1FKAF 5D0GA 1FX4A 4WWSA 4DR4F 6FD1A 4IR9A 4OZ5A 1TUVA 3JQJA 2GAEA 4Q7AA 4RO0A 3RAQA 4NMXA 4ECZA 2P8IA 1WC5A 4Y2CA 3HCXA 4ECUA 5E3RA 2YNGB 3G96A 1DTTB 1GH8A 2GHVC 3IR6B 3QJLA 1Y11A 3EPIA 1IR2A 1M5OC 1JLCB 2D7SA 1NO8A 1TL7A 3W2WB 4FXVA 1NJIT 3FBCA 3W8PA 2H51B 2V0NA 4ZCIA 3GZ7A 1YX2A 1V9OA 4N8NA 2EG2A 3TJ9A 5LMNF 3W5ZA 4ZVQB 4PUOB 5KFZA 1RAOA 1VJWA 1JLBB 3TVZA 1EUYA 3SMZA 3OFGA 3PW7A 3Q8UA 2ZH3A 1KTQA 1Y3JA 4DQRA 1N52B 5A8KB 1FRIA 4X64J 2FVCA 4DV4J 3CD6S 3ENAA 1U24A 3DDIA 2ASYA 2BJ3A 1LWCB 2J9DE 3I5CA 3QLHB 2YQ3A 3D68A 3GFXA 2Y8YA 5GAHW 3CCWA 1D8ZA 1BUXA 3MEGB 4DUYF 2R42A 5CD4A 2J6UA 4XTTA 4LREA 2PA8D 3EZOA 2ZKTA 5A8RA 1SI9A 2ZHBA 4ED3A 2N3OA 2G0JA 2B4VA 3P6YC 1JXEA 2LQBA 2MKSA 4KJIA 4LSZB 4RNNA 3MMBB 2OKQA 4RW4B 1FEEA 5DZ6A 4PPZA 4L74A 2VHGA 3BN4A 2QYCA 1MG7A 3G82B 2DXEA 3V5RA 5D6GA 4PXBA 4HLBA 5B7WA 4DV5F 3NWGA 3PX0A 4F0HA 2VL1A 4OMFG 2LVWA 3KMSA 3HD1A 3M30B 1SKRA 1TKZA 4DFMA 3TAMB 5GAHI 2HQ3A 4OHVA 2UV8A 1CQMA 2V63A 4PQUB 2OI2A 5T7LB 1KQSR 1XERA 3WX8A 4KFBA 1ZZNA 3CNQP 1NDPA 4LF5F 4Y2MA 3OV7A 1AZSA 2DCUB 4G65A 1FJ7A 4YOEA 4OLOA 4MH8A 3AT1B 1RT7B 1S0OA 2YKMB 5KT5A 2W25A 1WSVA 1KRPA 1WC4A 1RHUB 3UN5A 3DOLA 1RT1A 4KQZA 3CJ3A 3M2UB 2ZHAA 1DFUP 2ZBPA 2KL8A 2HW3A 4M5DA 3AQOA 2PDAA 5HQ8A 1WF1A 3PV8A 1RT5B 2NCKL 4ED5A 2M4MA 2BJ8A 1M0SA 1RTDB 1XEZA 3AXMA 1J27A 3N5BA 5ETVA 4AYBD 4M5JA 3C14A 3CUNA 3CC7S 4X65J 5DG9A 3G8SA 3MR7A 5IT4A 4LFBF 2RKIB 5E7OB 3I4PA 2HHQA 4XIUA 1HW9A 4E98A 2RIJA 1RA7A 1N5VA 2AMCB 2CQBA 4I67A 4IDKB 4M63A 4WTYA 1EQMA 1C0TB 4ZP6A 5KFKA 2PFDA 3O44A 3RBZA 1Q4RA 1R0AB 4K4YA 2HAIA 4TU8A 1U6ZA 4M5HA 3HLUA 1ZM3A 1WWHA 2JVRA 5HLFA 4K4TA 2ZBCA 2FD2A 2CAJA 2DNQA 1O51A 3AOCA 4NLSA 4OV1A 2CG8A 4W4MA 5KAKA 4WJBA 4V194 1GT8A 4LF1A 2ZJRS 2UUAF 3NGRA 5M2PA 5HATA 3KLHB 2BOPA 4MIAA 2MB0B 3MMCB 1WKJA 3MAHA 5GAEW 5JVHQ 1RXOB 2EKYA 3DXBA 3QZ8A 1QE1B 3P3DA 3PTWA 3NGUA 4USKA 2BM1A 2BJEA 2JX2A 2EFGA 5MAOA 3CJKB 1RWVB 5L9XA 1FJEB 4P52A 4LFAF 1YG0A 2P9GA 1D9AA 3BH6B 4TY9A 2DGQA 2ZNYA 3TWZA 4N76A 5FD1A 3BH7B 3UN3A 3R2CJ 3C6TA 3KKFA 2W9BB 1UVKA 3M1VB 4ED4A 2M8DB 2F7VA 2C1EB 4LBHA 5GAEI 2PMZD 4DHVA 2MZ1A 2CWXA 4KRWA 4DOZA 3TUIC 4DR3F 1D8YA 1XJWB 3PX4A 3R6LB 1FERA 3UDEA 3P8BB 4FF3A 2X1FA 3PKMA 2NSCA 3BF4A 5JVGS 3CW2C 1IKVB 1RT2B 3R7BB 2L48A 2YH0A 4D3HA 3H2UB 4B3OA 1SJ1A 4QW8A 2AP6A 1TK5A 3CJ2A 2ABYA 2HQGA 4AXIA 3MEKA 1SKUB 3OTCA 3R5DA 5E5NA 2B4OA 1FWLA 1JXLA 2D69A 3MF5A 4P10A 3B4MA 4ECYA 4OI0A 3ITHA 3Q8QB 5I42A 3GB0A 1Q81T 3R27A 4YS2A 2E1MC 4K4VA 2RQMA 3LP1A 4X4TA 1C4CA 4CT8A 3P49B 2HFSA 1JLAA 1R0BG 3HVWA 4ILRA 1LWXA 3CJ0A 3M2VA 4ENOA 2R8IA 2W4PA 3FCVA 3SQGA 5IM0A 1RBLA 2SXLA 3MM5B 5D4OA 3G86A 2XNRA 1MU2B 1JQGA 2B7BB 5KFMA 7AT1B 3FCHA 1U1KA 1HQEB 4PRFA 3GPAA 1YBUA 3P4UB 3QT5A 4BC7A 5HSPA 4JI8F 4RR5A 2W2NP 1TL1A 3D6FB 4GVBA 2HFUA 3DRRB 5HBMB 3ZZOA 3CJTA 3GIMA 3EZ5A 1FD8A 4GKKJ 1P8GA 1N4LA 2VOPA 2G1DA 4LBIA 4ECQA 3HHKA 2QSFA 2XMWA 4FBUA 4UY8T 4NEYA 3JTNA 5J2QB 3FDSA 2DHGA 3KLFA 1R8PA 2XULA 3S1TA 5DQHA 4FYYB 6FDRA 1R6VA 1RJJA 2OTJS 2FC8A 2NYHA 3KK1A 3RG6A 1C1BB 3QQCD 1G6BA 2V50A 1JJ4A 4F3OA 5F8LA 5LOQA 1X0PA 5EWGA 3MZIA 3OL8A 1C0UB 1T9XA 5CYMA 1HW8A 4DJBA 4DV6J 2CJQA 4DUZJ 2B6AA 3QBCA 4DR2F 3N5FA 1S49A 1X4BA 3ZZZA 5K5MA 1QTQA 3VZHA 4ECRA 1HNIB 2EK6A 2KRRA 2Z4PA 1HBUB 1APSA 1U0HA 4X64F 4MK9A 4DV4F 4W92B 4H4OA 5HVFA 1IBKF 4WBFA 1AB8A 3RYLA 3Q22A 3EX7B 3OR1B 4P2SA 1IR0A 1RK8A 3TARA 2YKOA 2Z2ZA 3AOAA 3KYLA 3PIPQ 3M8ZA 3H5YA 4PWDA 3NP5A 1WF0A 2Y1RI 4LQ3A 4RWXA 4AD6A 1IBLJ 4KB7A 5KFYA 4C8LA 1U48A 4N5SA 4NLGA 2V4QA 2V9KA 4DG1B 3ZZPA 4MIBA 3G6VA 2E7XA 3DM2B 2GVZA 3LP0B 2U1AA 2ILYA 1KBRA 2AT1B 4ECWA 2V94A 3DDKA 1IKWA 3N6MA 2NXEA 5CCLA 4X4QA 4B3MJ 1IWGA 2UXCJ 2XMVA 3D67A 4OX9J 2J9DA 4FXDA 3VGUA 1N5YB 1S76D 5LSOA 4Y2IA 2N4CA 2BANA 1IQZA 4GMKA 2MQOA 3KK3A 5A6PA 2EBGA 2W9CB 4U67Q 4JI5J 5E3AA 3VAFA 1F5CA 2IVMA 3AD9C 4CLKA 2AWZA 4C97A 4O3SA 1YJNS 2AGPA 1KQGB 2C42A 2R7XA 1FFSB 1CSJA 4UY85 3GE9A 3OLAA 5GMDA 5DG7A 4DF8A 2DHSA 2CG4A 1CJTB 1QSSA 3V6HA 3DLEB 2HFZA 4PG5A 1WKLA 2PI4A 2ATCB 1RT3A 3RB4A 3A4TA 4ZVSB 4J9KA 4KV8A 1K1QA 2QLFB 4UT4A 2MSTA 1D0EA 4USUA 4RUCA 1TR0A 1ZH5A 1JNRB 5EUHA 1S0MA 5D4NA 2Y0BB 2OUGA 2HFOA 3ET6A 1RZMA 4X65F 1MWZA 4ANDA 2FVPA 2HZAA 2OIHA 1B70B 5J1EB 5F8MA 1U09A 3C15A 3T5KA 4IFYA 2DGXA 3BDEA 4LIRA 4G6VB 2J9EA 4LRDA 2BE2A 2YPZA 2GQ2A 2O3DA 1RKIA 2F9DA 1S9EB 4KHMA 3PNIA 1WDTA 2J7KA 2DR7A 3OTDA 4JV5J 3SDEA 3FEYB 4F02A 2K7KA 4LR7A 4LRCA 1WDDA 5KG0A 1AUDA 3NNAA 1X7VA 2X3GA 5K14A 3KFWX 2GZOA 1Z85A 3UCUP 4B9VA 1KTVA 3PG9A 2VFRA 2ZEJA 2HK2A 1O6XA 1MMDA 2XSFA 1BQMA 2VIHA 4DN0A 5FDLA 4DV3F 1SL2A 4QYZK 4MAKA 2E7WA 2VF3A 2PMWA 4BCAA 1VCTA 2CNNB 1FE0A 2PSZA 1HQ2A 1TKZB 2ZH6A 4U8YA 2GHPA 3ILJA 2JH3A 3SFUA 1EP4A 3HVRA 1HWIA 3FSXA 3GV7B 1FRJA 4IG3A 3O6QA 1ROFA 1WG1A 2CRLA 2DRBA 2K3KA 3I0RB 3JTPA 2JHEA 1DAXA 2KTQA 1RT4B 4C7QA 4WFNQ 1RWXB 2BRLA 4CZCA 3PIOS 4P6QA 2AJ0A 3CMES 3DOLB 3KNAA 1RT1B 3BBCA 4ID5B 4IOAQ 4C8KA 3S8SA 4IOCS 5DGAA 3OXFA 3KHLA 3JSBA 3QT8A 2NR0A 3KLIA 4FN5A 2VG7B 3MHYA 5D15A 1MMNA 1VQ6S 5KTQA 1FEHA 5LXRA 3IWLA 1PO6A 3DLKB 2HYIB 1B4SA 3R5JB 1HPZA 4DR7J 2VODA 3UDCA 3K89A 3CDUA 4RX6A 3BGRB 3LWLA 2I6WA 2GJFA 4RBVA 3QT7A 4A8YA 4J9RA 3PY8A 3A13A 2FHJA 2OEJA 3DLBA 1YRUA 3IWNC 1DLOA 2B51A 5ITHA 1WD6A 1U49A 3PYEA 2DISA 3T1YJ 1QRTA 3CCQS 1EKSA 2M52A 2MKCA 1T11A 3R1LA 3MR3A 5K20B 4I0WA 3EVWA 2DR8A 3FFIA 2QN6B 3C6UB 2XNQA 2N4DA 1BMQB 3GILA 3RJMB 2NSBA 1F1BB 4UOGA 4ILMA 2ZH5A 2XI3A 2BUNA 1BHNA 4FPRA 2KVQE 2UXDJ 2LQJA 1KDNA 4NL5A 1M1GA 2LLZA 2LU1A 3M8PA 3AIIA 2XMTA 3OSNA 5FLXU 2G2YA 5HJXA 5KG7A 3MAAA 2MHNA 1HFEL 2QE5A 1XMOJ 5HVGA 2UUWA 3QGPA 4RLEA 1NK6A 4GKKF 4CO4A 4U9RA 4MK7A 4A47A 4HACB 1CBKA 2UUBF 4TU7A 3QMQA 4C4WA 1VLOA 2B5JA 4PG7A 4IRDA 4DX6A 2RDJA 4J9NA 1F5BA 2J6SA 3F56A 3FQKA 1JWWA 2Y0SD 5GAGW 2BABA 3IMQJ 4WFAQ 4CI0B 4BDPA 5U47A 2ZOGA 2A18A 1V6ZA 2DPIA 2KT3A 4ZPBA 4ZIVA 5DLGA 3BQ0A 4PXDA 1X4HA 3JAMU 1RAAB 2Q66A 1FWKA 1S97A 3GQCA 2NREA 3S7RA 2PD1A 4ETXA 4Q0BA 2GQCA 1NKCA 3C2PA 2F8MA 1K0TA 3TW0A 2R3VA 1Q16B 3QFWA 4DV6F 4DUZF 3RBDA 1SVDA 1X4EA 4YUDA 2AJ1A 3CCJS 4ZCLA 1NK9A 2FY1A 2J9CA 3DI6B 4FNIA 4DL3A 1HNVA 2V2ZA 1LWFA 3NCRA 2D3OR 4LT6A 1RLCL 2AYEA 4R0JA 2CXEA 4DPOA 1MROA 1NDLA 1SJFA 3UPFA 3M8QB 1S1WB 4NLTA 3DXSX 4R5PA 1N0VC 4LF7J 1UJ6A 2RH3A 1VK3A 4JYAF 1ELOA 2HRYA 2QEXS 3ITHB 5I42B 2JJ4D 2IM2A 1KQKA 5BYSA 1YI2S 2EC2A 1IBLF 2LDIA 4ZVRB 2OSRA 3OTOJ 1YJTA 1L3KA 2CFXA 1ZOTA 1RAGB 1UEKA 3VAIA 3DLJA 2YKNA 4JXXA 2XY7A 1Y3KA 2JOQA 3M8WA 3J81U 1P1LA 1VYAA 2HLTA 5HN0A 2JRSA 4NLDA 2Z2LA 5ETNA 4ETZA 2C2KB 1U1OA 4B3MF 4ELUA 4DL5A 2UXCF 3SCLE 4J9PA 2IY5B 2EGVA 1TL1B 4GVBB 4XO0A 4FYXB 4UUXA 3GWCA 2YTCA 2XMUA 2D9OA 1JLQA 3MURP 1HLWA 2LQ5A 2GMHA 4DX7A 1QUPA 4F4ZA 3H0PA 4JI5F 3OTEA 1YJUA 2VBXA 2AGQA 1UA1A 3KLFB 3CCES 3HD2A 2M3DA 1NB2A 3HJFA 1AFJA 4CLLA 5L8RC 1KVIA 3TUZC 1NPPA 2LECA 4CLUA 3BKFA 1SJRA 4DEZA 2ZFHA 2ZJQQ 4NRUA 3IGVA 3KWMA 1YBTA 2E5HA 3SZ2A 2FJBB 4GC7A 4QIVA 2B9YA 4L72B 1AYEA 2IJRA 4IG0A 2FJDB 2ZM6J 3D3CJ 3M32A 1VHIA 4Y2KA 5C7PA 1B3TA 1K0VA 3TZZA 1IN0A 2N7CA 1RWWB 1PAUB 1U0HB 3Q89A 2VPXB 3OUYB 4H4OB 3V4IA 2MQ8A 4LF9J 1GEHA 1WACA 1ZPVA 2YKQA 2B4PA 2ZWPA 4RW7B 3D66A 3ELHA 2QA4G 4ZJLA 1D9FA 3DFEA 3B78A 3MM8A 1NK7A 2WSCC 3PEHA 1X4GA 4PWDB 1N32J 4JV5F 3M8YA 1RTIA 1HHSA 2P6TA 2HEKA 2V2VA 4OI4A 3O5TB 4DSLA 4WU3A 3WX4A 1TL3A 1YIJS 1Q8IA 2GVZB 1FWPA 2V8VA 3BO2A 3HHEA 1GTHA 4P9SA 1M5SA 3CCVS 4F4AA 3RAXA 1SC6A 4EZ9A 3MFIA 1H73A 1V5IB 5ETOA 4NLYA 1VBXA 2BQ3A 2ILZA 2I0XA 3HHNB 4CNZA 2WVEA 4DWIA 3NGSA 3V4MA 5IZHA 4FS1A 4ZVFA 4USWA 2I1RA 2JDJA 2DO0A 3I5AA 4WXWA 3MTKA 4RPFA 2WBMA 3MOJB 5HQMA 1TV6B 4HTJA 3HVAA 2WK4A 2H3EB 3QGGA 3G6XA 1ZPWX 4DSIA 3L4BC 3KUGA 1JJCB 3EGNA 4OYOA 1R8AA 2DEIA 1B99A 5JVHS 2JC1A 4F67A 4O4GB 3TP2A 4J9UE 4DS4A 2EGWA 2B0GA 4EK2A 1DBDA 2MMYA 3PO5A 5KFLA 1TELA 2ATLA 5ETKA 1JLGB 3DYAB 4RBUA 3D6MB 3W2VA 5AE1A 4YR2A 1QRSA 2IMOA 2HNDB 4KV8B 1RI7A 5C24B 3EPGA 2J0WA 5DETA 2EFNA 2NYIA 4JI6J 3SV3A 4DR7F 4I6AA 2DGTA 4ZPDA 4TQSA 1YJVA 3PHTA 2NXUA 5HJYA 3WC0A 3H7HB 2VJUA 3QSIA 2GC8A 4GC6A 5B0BA 2VICA 3OFFA 4HH0A 1FDBA 1GNKA 1SV5A 1EKRA 2OGUA 4NLRA 4QPTA 3C15B 4E8UA 4IFYB 1HYSA 1RT6A 4B9SA 4F4WA 3X3UA 2CJBA 4ZPCA 1R8CA 5AE3A 2RUSA 1ZAXA 1JKHA 3I56S 4ZMMA 4B02A 2N3LA 2X1BA 3TR5A 3PXGa 3CULA 1AFIA 2VA2A 1UPMB 3DLGA 5J2PB 4I2PB 2ZBIA 2H5IB 3H59A 4CQ1A 4HR2A 2BA9A 4EI2A 2XGPA 2IBKA 3ETOA 1Q53A 4AFFA 2DO4A 4B3SF 5FDLB 3VAGA 5J2NB 2UXDF 5K8NA 1HI8A 2YNFB 2QC3A 2R8HA 3EXCX 4F36A 2XO6A 5LSLA 1NK0A 2KH9A 1EP4B 2IC3A 1XMOF 3THVA 4PYAA 1FESA 3RZAA 1L3UA 4IG3B 4J3CA 3KJVA 1S4EA 4OHWA 2IPOB 1YZ6A 3CIZA 3AODA 4ED7A 4ED1A 1MMLA 2QA1A 3IG1A 3MPWA 2YNHB 1YJ7A 2M8HA 3V6JA 3TRGA 1RTJA 3UVJA 3CMQA 3MECB 1T05B 5K8MA 5KFFA 1KFSA 4HI1A 1WOOA 1NK4A 1FNOA 2HGMA 3H8YA 4GO5X 1Q1KA 4TQRA 2FHKA 4DR5J 1HPZB 3PACA 1VQ8S 2KDOA 1WNEA 4DV7J 4DZDA 4DX8H 1HBNA 4ANEA 4H4KA 1H2UX 2HPUA 2DHXA 4DSFA 3C16B 3Q24A 4OZJA 5CYQA 4Z2XA 3NS7B 2DGWA 2A3JA 2WRMA 3H5SA 3SCIE 4LF4J 4J9LA 2W2MP 4LF7F 1H98A 1VBZA 3N79A 3GFHA 3EYZA 1OY6A 2EFPA 4Y3CA 3DRYA 2CYYA 4QU7A 3VV2B 1TZ0A 3GYNA 3BGUA 3DCAA 3FFIB 3OTOF 3T19A 5F0UA 2HWIA 4FXWA 4M8LA 1TQLA 4UOFA 3BO3A 3BSAA 4MKVA 2I2YA 3VALA 1VDHA 2C22A 4G1PA 3ENQA 4DLGA 2UVUA 1QVFR 2R2SA 2HIYA 3M7VA 3M8PB 4AL5A 2FDNA 3NNCA 2DNHA 1RU2A 2DNGA 2HFNA 1G1XA 1K9MT 1WC0A 3MAAB 4DU8A 3PIPS 3M9OB 3CO0P 1QJHA 1REGX 1L3SA 4K2JA 1VJQA 3SBMA 1WC6A 2VG5B 4URGA 3NOGA 5JXSA 3EGWB 3CF5Q 3J7ZV 4TKTA 4C8ZA 3Q86A 3AJ2A 4P7VA 3Q8PB 4YR3A 4F7VA 4KAIA 1U1QA 2XYHB 4HI2A 5HMYA 1XMQJ 1H7XA 1KVKA 3G6YA 4CYUA 4NLVA 3OJSA 1AT1B 1QUVA 3UCZP 3HF5A 3A8JA 4Q0BB 3IP0A 4QWCA 4TY8B 1CULB 4J9VA 4UUWA 1VRTA 4DCOB 3ZC4A 2MHEA 4LVNP 1NSPA 4RNFA 2ZM6F 1OMSA 4ID8A 4U67S 5M2RA 2R7QA 1BGXT 5J2MA 1DURA 3HVTA 2CQ3A 1N0UA 1KLNA 2W01A 5EX0A 1S1VA 4N41A 2Y3YA 1AA1B 2ZD1B 1HL6A 4OI3A 1T03A 1NXZA 1MROB 1S6PA 2YBVA 5ETRA 2R7WA 3SI8A 4I7FA 3RW6A 2WSFC 4C0BA 3OPKA 3O2IA 5D4LA 1Z4UA 3J81j 1ZS6A 2CWKA 4DSKA 1XR6A 4NI2B 2WVBA 3OSPA 4W98A 1RCXB 4C3LA 3PRBA 1TFYA 4NCGB 2FHMA 2ADBA 2E9ZA 3EVOA 4F0MA 2HVEA 1SIWB 1IR1A 4Q45A 2QLXA 2QLWA 4UZBA 3GMGA 5HO4A 5L39A 1U8SA 1CJKB 3M8RA 3GV5B 1UWAA 4ZPWR 1PGZA 4EWTA 4LSNA 1VOMA 2KFYA 1VFJA 3LPEA 4M94A 1MLAA 5KFVA 3BS9A 3V81A 3PVXA 1VQ9S 2ADCA 2ASJA 1FRLA 5L46A 5KG2A 3GP9A 4YQWA 4KPYA 3E2EA 3K5OA 2LKZA 4F4KA 4N7TA 4CH1A 1SB6A 3E3XA 4YP3A 2NXCA 4G1IA 5I3UB 5L1IA 3BGFA 5F3TA 2HNZA 2RQ4A 1GX6A 2EC0A 2X51A 2V8HA 4O44B 3TZYA 1TVRB 3M6WA 4PG4A 4KC5A 5ETMA 2HMIA 2CNOB 2R7OA 2DT9A 5G0RA 2MGZB 1RA6A 2VKZG 2XY6A 4IG0B 1LNQA 3M32B 3MPUB 3AB2B 1WI6A 4X4OA 3RRKA 4ZPVR 2ZZTA 1S72S 1TMMA 2GGPB 4C0OC 4KHPJ 2RU3A 4JI6F 3DGPA 1Q8KA 4O3PA 3FEXB 2K2PA 3O3LA 8ATCB 2C3OA 3MR5A 1WOPA 4RKUC 4WFNS 4LR8A 2WVFA 4DPTA 5LSRA 3D4JA 2BW2A 3K17A 3D2WA 2OP5A 2V69A 4I69A 4ES1A 4KR0B 3SCJE 5HANA 4IOAS 3MM8B 4RW8A 2BKOA 4RUBA 2CZVC 1RWMB 4B9NA 4UTGA 2HBYB 4NLUA 2NXJA 1RTIB 5B0AA 3R5AA 2BRKA 1UZHA 2XWYA 3QIPA 2DY1A 2CQHA 3HO1A 2XC9A 1VQYA 4ZK7M 2OFHX 4RU9A 1CPZA 2I5JB 5KT3A 1HARA 4RU2A 4B3TJ 1F9EB 1RHJB 4ZPAA 3VF0B 2ZDPA 3OLBA 1S6QA 1XR5A 4F2SA 1QLNA 1RYSA 3GG0A 1R27B 4K4SA 3FBBA 1ZJWA 1FFWB 4A8XA 3I4HX 5I3PA 4AL7A 3R7NB 1HNWF 2M9KA 1LW0A 1OPIA 3CJ4A 2QMWA 3MEDB 2IAJA 2RVJA 3B8HA 2KFNA 1WF2A 1VQNS 2OPSA 1RHQB 4MKYA 4P75A 5EX3A 4EO8A 2QV6A 1YJ9S 3TEGA 3FKBA 3DHXA 2HRTA 1RTZA 2CQ0A 3AB4B 4F4XA 4OHXA 2IBOA 3K5PA 1LEOA 3HSJA 1PILA 5LM7E 4NYPA 5F3ZA 3CT9A 3IN5A 2YWHA 2FJAB 2LEAA 1YJWS 4C8MA 4Q5VA 2QRRA 1T9VA 3PYGA 3OBIA 4X4RA 1KLMA 1NRKA 1RTHA 3CPWR 1MN7A 2DR9A 1ULRA 5D0RA 1EETB 3CC2S 5AT1B 1UL3A 2W8LA 3P5BP 3CCLS 4ZN3A 3UWTA 2DY9A 5ETSA 4DR5F 1NJZA 5IC6B 3VAJA 1S1XA 5IV4A 1NZ8A 3QJJA 4DV7F 3KHRA 3SV4A 1QM9A 3TJAA 2K1RA 1H74A 2JLEA 2RF2B 4WFAS 1HKAA 1SV5B 1V5VA 2KYZA 3UR3C 1HYSB 1RT6B 1M5KC 1R0CB 4LSLA 1BQXA 2DK2A 3FBFA 4C3MA 3ZTOA 4EBDA 5KFQA 2AJFE 4LRBA 4LF4F 3KDOA 4LJMA 1OYDA 2R7SA 3DRPA 4TYBA 4C3KA 4JXZA 4WIQA 3A8KA 3RTVA 4Q2LA 1CLFA 1SIZA 1NPKA 1NZAA 3DLGB 2FGCA 2GHWA 3IXQA 1WEZA 1XNQJ 2OFGX 4DQQA 4XAKA 4RNOA 5THWA 1UPPA 1DZ5A 1X8DA 3TX0A 2BJ9A 3R3TA 2UZAA 4JBCA 1U25A 3LA0A 4YB7A 3VAMA 5KG5A 3S01A 4NZ6A 1SH2A 3CZBA 3PYFA 3BR9A 4ANCA 5HMXA 2MLXA 5IS2A 2DXFA 2OSQA 4DL6A 2HHSA 2KRBA 1U47A 3GR0A 1AROP 2YVSA 2CJYB 3LP2B 1FTCA 2XMKA 2K06A 1QSYA 3QPIA 1S6UA 2BOAA 3HFKA 3Q2SC 2HWHA 3KJVB 1I94J 4FBTA 1I51B 2W8KA 5GADW 2AZ1A 3CD7A 1RHKB 4X66J 2GCFA 3IG1B 2HHPA 4IOCQ 3NAIA 5KFBA 4PXEA 3UVJB 1FF2A 2HBQB 2IJFA 4OZNA 3A8IA 3EDQB 4ZVEA 2G6GA 4LFAJ 3IRXB 2HSEB 4HT7A 1N33J 5JUMA 4YEAA 4ZJQA 1X60A 2L9WA 5E3QA 3IFEA 2AV5A 3F73A 2JEIA 1PCAA 4YY3J 3K0JA 4LR9A 1RBAA 2J0XA 1HBNB 4OI1A 4M5GA 3UW1A 3O8WA 3PRVA 1CS4B 2HBRB 1RABB 2J7UA 4O0NA 5D3GA 3CDEA 3NWRA 2ROPA 3BQ2A 1KQFB 1M1HA 5H1SV 4PEOA 5IT9U 1LV5A 2OD6A 5GADI 3R1HA 1N88A 3IBCB 2W4DA 1SPBP 4KY3A 3IR7B 2OHDA 3QJPA 1O0BA 1NYLA 1NMEB 4K50A 3I0SA 3S6EA 5KFHA 2UU9F 4QR0A 1T9UA 1FKPA 2G2OA 3RRGA 1U6FA 4QWAA 4WYWA 2A2CA 5IWAJ 1RWNB 2XLJA 3K57A 1O8BA 2XZTB 3J7YU 2DITA 1X4CA 3W66A 3OFEA 4LFCJ 1RP5A 3W3SA 3I82A 2RRNA 2BJ7A 4I1TA 3UI3A 5KFSA 2MY7A 2ZH9A 2C2MB 2FHOB 1WEYA 1UJ4A 3DDNA 2E1CA 3M2RA 3CXCR 5CH7B 3GCXP 4WFBS 3LUYA 3LTOA 1FXRA 1N34J 5D0EA 4IQXA 1R89A 1FNMA 2WONA 4NOHA 3CCSS 2G5DA 5DGBA 3O1LA 5DM7Q 4XPEA 2KM8B 2E9RX 2DGVA 3POTB 1FDNA 1SC1B 3JB9k 1NH7A 3D6TB 1IKYA 1T02A 4P2MA 2F4VJ 2NUHA 1HI1A 5C42A 4RUAA 2YWFA 2KXHA 1ZM9A 1JLFA 2FVQA 1SKSA 2RMLA 2RS8A 1U1RA 1I1GA 3G87A 3U02A 3RU0A 4P2FA 3PDNA 5CA5A 3IS9B 2OLWA 3W64A 2ZNZA 1I5OB 3MI7X 1LW2A 3PR4A 1VRUA 1VRTB 1JK9B 1VHKA 2KXNB 1GXUA 1UKUA 4RZRA 1L3TA 4OZLA 4YHHJ 2XEXA 5KFPA 3Q8RB 5BXIA 1GTRA 4DUTA 3AD7C 2VZ9A 2HHUA 1TKXA 4WU2A 5IC4B 5K9FA 5J2MB 4KHPF 3HVTB 4HL9A 2ASLA 1KN6A 4A8WA 3EXYA 1S1VB 1S7HA 3N28A 2Z30B 1XR7A 1YLXA 1T03B 4WZMA 2AEJA 1ZZFA 1HBOA 5HROA 4PPDA 4MYTA 2EKNA 4I7FB 1RGVA 3PCOB 4EBCA 4DR2J 2YNIB 4NA3A 1F2HA 4HDGA 2E5JA 1UA0A 2C2EA 1OIAA 3QRPA 4CCHA 3MM7B 2IA0A 5B0CA 4R25A 4NLXA 4TYAA 7FDRA 2I38A 1AW0A 2LQ8A 2XM3A 2D3UA 2W2QP 2OELA 4IH7A 2VFUA 4I2QA 3VAHA 1IBKJ 2DGUA 4DDFA 3HFVA 4B3TF 2H65B 1IKXA 1WC1A 4OZ2A 2U2FA 3MTJA 2FLPA 3AH6A 4F2RA 2D41A 1OYEA 1FRXA 2W4CA 2F4FA 2ZE2A 2HS0A 2AHOB 4ZLJA 4MKBA 4CTAB 1NEEA 3PYDA 1UDXA 3PRDA 2JNJA 5CHCB 4IR1A 3EVMA 2EI5A 2XTJP 3LH2S 3R2DJ 4IRCA 3D0HE 3ONQA 4M95A 4HKQA 4LBPA 4OYPA 1C1CA 1QTNB 2C3PA 1NJXA 3EMTA 4IFVA 4E8BA 2VC0A 3TAPA 1HBMA 2ZUGA 4CLYA 2PNWA 4IYQA 3T9ZA 3AY0A 4Y0FA 1KOOA 4KIAA 2W2OP 3CD5A 1OSDA 2Q43A 2H48B 1ZM2A 1T94A 2HNZB 3LW5C 9RUBA 1GAOA 3W9IA 1RB0A 3M9NB 2XS2A 3I6PA 4OZ0A 4UZCA 3MMAA 2BACA 1LFPA 1LK7A 4C11B 2PIIA 4RW9A 4DPYA 4KH1B 1B0TA 4JUZA 2YX7A 2YX4A 5G0RB 5A8WB 3PZPA 9ATCB 3UR0A 2ERRA 1BY9A 1Q78A 3GTYX 2DEJA 2DNLA 4N47A 4H4MB 4QU6A 1LWEB 3DGPB 1FKOA 3GG1A 3EJMA 2ZKUA 2XZDB 1YTYA 4IUFA 4WE1A 1D1UA 2ZC3A 2OH2A 3MWBA 1GTEA 3PHEA 1LK5A 3W65A 4JI7F 2EG1A 1XMBA 2XI2A 1DTQB 2NUUG 3MM6A 5H9EK 3E01A 1S0NA 4RW8B 1ZAWA 4ICLA 5DLFA 1VI7A 1E6VA 3FC9A 2VFVA 3GJSB 4P2XA 1M90T 1NM2A 2XMAA 3WBZA 2FZGB 2O66A 2M2BA 3MM9A 2VB6A 3ISZA 4Y2AA 3IRWP 3MPVA 3I9ZA 1W7WA 1V3RA 4O0IA 1XNQF 3PW4A 1JMTA 2OAUA 1S6QB 3K5MA 1C2PA 1S77D 2HKEA 2KB2A 2BV3A 2Y9HA 4XDDA 1MW7A 5L1JA 1LFWA 4C8NA 2E1AA 3OXGA 1B0VA 2APOA 2JC0A 2KO1A 1DTTA 1LW0B 2ZBRA 4KHRA 3LF0A 4DPWA 4X2BA 1TL5A 2XO7A 2IAJB 3OTBA 2ZH7A 1W2IA 2F63A 2XS7A 3KHHA 3EGZA 1QRUA 5DDQC 4KGXB 4CWBA 1JLCA 2UUTA 2XY5A 3K8WA 3W2WA 2KJWA 3HHLB 3VGSA 2N82B 1I94F 4NWBA 1VQPS 3A12A 1Z2LA 2D74B 4DV3J 1YK9A 5KT4A 1UWBB 1SL1A 1VQ7S 1QAJA 2VG6B 5F9NA 4X66F 2VPZB 2ZJPS 2OJ3A 5KFAA 2LCWA 4PUOA 8RUCA 2HK3A 4Q2MA 1JLBA 4KPCA 1KLMB 3CD0A 3TOQA 3I31A 3R97A 1J5EJ 4OI2A 3BSCA 4K5RA 2L9NA 2GIRA 4YFUA 1M5HA 5A8KA 1RE1B 2PMHA 1SQEA 1N33F 4AUKA 2ZH8A 2Q6BA 2HVDA 5KFGA 5A2QU 4WZQA 1LWCA 3FRZA 2E44A 5HP1B 4YY3F 3CF5S 2IFXA 2IDLA 2GO9A 2K1RB 5I4MA 3G6ES 2UVWA 3T1HF 4LF6J 2CPIA 3OT9A 1KSPA 1DARA 3H2VE 1FRHA 4JI1J 2FVSA 2JLGA 4LSLB 4P2BA 2PA3A 3EUNA 2BE9B 3PO4A 4I6YA 1F3FA 3QWUA 2HIQA 3Q83A 3RB6A 4PABA 4LVOP 1JNZB 4PR6A 2RRBA 3L7PA 2IVFB 4B9UA 1JIHA 2KYXA 4RW4A 3M6VA 4NX9A 5IWAF 4YR0A 2AJ4A 2QLBB 2RD2A 2XMMA 5RUBA 4V19X 2ZUAA 3DOMB 3KJFB 4LFCF 4DSEA 3PW2A 1HNZJ 4B08A 4UQTA 2V5HG 1HMVB 4K0KJ 2IJNA 3TAMA 1PJ5A 5KT7A 5CYJA 4DCJB 3HX9A 5ETLA 3FRYA 1UTAA 1S9FA 1H38A 5C2CA 2VKRA 4PQUA 3LAKA 4RNMA 3WC2A 3K2YA 4FNHA 1N34F 2UV8G 4DQPA 3GJRB 3TA2A 1UEVA 3WQPA 3GSDA 5IXUA 1K44A 1NHUA 1YZ7A 2E9TA 3OXLA 1UW9A 5KFEA 1SKWA 1RT7A 3VQTA 3NGKA 2QIFA 2JEFA 3W61A 4L76A 3AA8A 1N36F 2F4VF 3UCGA 5CQGA 4ECTA 3AA9A 3RR7A 2MQQA 1V3ZA 3L7OA 1JLEA 2B9WA 2CQ4A 3GIIA 3FK4A 2NS1B 4JI2J 5GAHU 3HZGA 2W9AA 1D09B 2DBBA 1EB0A 4DR1J 4L3NA 2OEKA 2UUBJ 1URRA 4FDFA 3J7A1 2C2DA 1Q79A 3QNWB 2CZ9A 2RKIA 4A8KA 4U95A 4YHHF 3D0GE 3SXLA 5CZVA 1U7LA 2R2RA 1CJUB 4WKRA 4Q43A 5DDRC 4EFAC 1C0TA 5HAOA 2GW8A 2CPFA 2IHR1 2OPPA 5D3GB 1R0AA 3ZTSA 5KFIA 1IBMJ 3BSNA 5HL7Q 3RRHA 1X9WA 1REVA 1BWEA 2PICA 3I55S 4A8MP 3GSIA 4OYXA 3M6UA 4ED2A 1TU0B 4QZVB 5KFCA 1FKPB 3TJ8A 1S12A 1F3VA 1HD0A 4QJVA 3B82A 4QR1A 3KLHA 4A8FA 2VQEJ 4JV2A 1TK0A 3VVUA 5DM6Q 4C98A 3V6DB 5KFJA 5KFWA 1OQ3A 4L3KA 3VQSA 3V6KA 1WTBA 1YWXA 3DMJB 4OJGA 1GMUA 4QWEA 2EFOA 3GFYA 1SUQA 3G2XA 4QIGA 4Y28C 4JYAJ 4FVMA 1XWLA 3THPA 1PG5B 4JYZA 4RWWA 1Y10A 3FZ2A 3E8OA 4O3RA 3WHIA 2MSSA 5H9EJ 1T3NA 4ZP9A 2RQKA 4BWJA 2Y1JA 1DFDA 5B09A 3GR1A 2AYBA 2VU5A 1TAUA 1U45A 3KW2A 4JI4J 1IKYB 2CPXA 3Q0AA 1SBRA 1N8RT 2HBZB 2MYFA 5C42B 2XLIA 1VHFA 4I4BA 4I68A 1U4BA 1T0TV 3BEGB 2HZCA 3JYTB 1SCJB 1TK8A 5DJBA 2E5LJ 4QYRA 1R7IA 1KFDA 4XK8C 4CRJA 4ILLA 3NCPA 2CQCA 2FGOA 2XQCA 2DVIA 2EW9A 3DGVA 1VRUB 4B17A 4DPXA 3M6XA 4TU9A 1IKVA 1RT2A 2IM3A 4IO1A 3CB4A 2KHCA 1HWLA 3D3BJ 3ISND 1TKXB 2KZMA 2OMLA 4WIIA 2ZVSA 2DNYA 2IRUA 2J8AA 3MD1A 1TL7B 3D5MA 4YMEA 4EO6A 1NLKL 3A1YG 1KR4A 1PYTA 5KFNA 5HROB 1K8AT 3GV8B 2R2TA 1FHTA 5GAEU 4PG8A 3EWGA 5HQLA 3ADAC 4CLSA 2G1HA 1KP6A 5ETQA 4KO0A 3D7SB 3A3PB 4NEZA 2BMBA 2OEMA 3M4XA 4DV2F 2W24A 3TUPA 1XQIA 1EIYB 2PGCA 4ZHRA 2DGSA 1VIOA 2HVHA 2O67A 3VR1A 2PE8A 4NYZA 4I2QB 3ICLA 5LJ5Y 3MXHP 5IV3A 1HQEA 2CQDA 1TL4A 4UW2A 3NMRA 2H5JB 2WBRA 2MLZA 3RBXA 3DRRA 4DXLA 4ZP8A 3HHLD 3T3FA 2ZE2B 3US5A 4NA2A 2V9WA 2BEFA 2V6AA 1AXQA 5A8RB 2J5AA 2FLOA 2YWGA 1T7PA 4IFVB 3QGIA 1HBMB 2QYGA 1FT8A 5KFUA 3EDRB 4R0EA 5KG3A 1JB0C 2HRUA 3CJQA 4QIFA 1SJ4P 1XBWA 2PFFB 3JQMA 4BLGA 1C0UA 3MMAB 3GJQB 2KG0A 1I3OB 4KGVB 4RW9B 1NKBA 3NXZA 3MUVP 1RHRB 1WSRA 2MKIA 2GFFA 3ULHA 4DL7A 3BN7A 4ZLPA 1J5EF 2VBYA 1DJ0A 4KFBB 2VV5A 4P71A 3SCKE 3J7ZT 5D78A 1RAEB 4YDDB 5A0YA 1AZSB 4UY88 2R8JA 1FKOB 2A1BA 4BHQA 2E5IA 1IM4A 3ZXWA 1H2VZ 3N4WA 2P9EA 3F44A 5DO2A 4LF6F 3BBBA 2R8GA 4JI1F 1SH0A 4B9LA 3N6NA 4M5DB 4NASA 3MM6B 2VA3A 3ZZYA 2R8KA 1E6VB 3OFHA 1NHKL 4J91A 3MFHA 2XCPA 5HMWA 3DM2A 5L1LA 1VLYA 1JJ2R 5D77A 3C14B 4A4JA 4QQBA 3MM9B 3QATA 2F3JA 4CLWA 2XMJA 2IRXA 4PKDB 1WG5A 3FBEA 2RQCA 2QG9B 4FPIA 5AXNA 1FXLA 2MKYA 3MCOA 4CO1A 4DFJA 1P9QC 3DHWC 3MR6A 1HNZF 2C2ZB 2AU0A 3DU5A 4U96A 4K0KF 3D6HB 3CJ5A 1S5ZA 3Q8VA 4U7UK 2W9CA 5HLFB 1TUWA 1G7CB 4O3OA 3GYXB 2AJ2A 1MWYA 1OO0B 3R7SB 2P9CA 3R6GB 2FJVA 1NSKL 5F8JA 5D4PA 3AJ1A 1RACB 3IAM9 2NZCA 1CJTA 2ACYA 3CJSA 1NJWA 4FKYA 4MKAA 3WZ0A 3DLEA 4B3SJ 1KD1T 2KM8C 4FS2A 4OYMA 2VDHA 1IXKA 4ES2A 2LXUA 4ZDNA 3PKYA 1JX4A 2AGOA 1CQNA 5LT5A 4WFYA 2XS5A 1RISA 2R9LA 2N7YA 3T6JA 4GO7X 2GAGC 4FYDA 4JI2F 3VHQA 3DLHA 4ZP7A 1VC5A 4DR1F 1Q7YT 1NAQA 5KG4A 3L95X 2CPJA 1UW4A 3ZFVA 3DLLS 3I9V9 3C19A 2B8PA 3QYYA 3W9HA 2QZ8A 5FIIA 4NLPA 5DM7S 4KT0C 2JL9A 2XYPB 3PJXA 2DNOA 2V68A 1XK8A 2GIQA 1RKJA 2NQPA 1PBAA 3FZBA 3GU0A 5HVHA 2BZ2A 3P5TL 4E0DA 2RJZA 5J1EA 3BREA 4C9DA 2PI5A 2DB1A 3C6TB 3J7Z5 3UE2A 2QA4S 3N6LA 4F3MA 5AXKA 1S9EA 2XHCA 3KLVA 4AT1B 4NA1A 3OR2A 1OWXA 1IBMF 5KT6A 1RAFB 2HVZA 5HK4A 1JJHA 1ZBTA 3KLGA 2FIUA 3PEJA 2V4RA 2XWXA 1O5JA 1Y5NB 3OVAA 1PKUA 4E2FB 3H4DA 4OI6A 4QWDA 5BYQA 4AXJA 3KUHA 3GFZA 2ZVIA 2NWAA 4ED8A 2VQEF 5CAAA 1S79A 1H3DA 2MZSA 4B3OB 2NLWA 1HHQA 4IO9Q 4NXMJ 2Y1IA 5GAGI 3ENWA 1WG4A 1S6OA 1RWKB 1SJQA 4LIWA 2E7VA 1HNXJ 3NEKA 4J9MA 3KNGA 3BKTA 3PW0A 4Y65A 1S1UA 3VGTA 2F8HA 4J5OA 2UUCJ 2FLNA 1SXLA 2BR0A 2RAQA 2OPQA 1FA0A 2QFIA 3LP1B 4N56A 5CXTA 5KFOA 2YY3A 3I0RA 3BO4A 4OYAA 1JLAB 1RT4A 2DNMA 4KBIA 3JTOA 4ZCMA 2BKPA 3M2VB 4JI4F 3SQGB 5IM0B 3CWJA 3H5XA 4ID5A 1HR0J 1PBUA 5FLXY 4HH1A 4QOTA 4ZLNA 1F9HA 2VG7A 1JLEB 4AQYJ 2RRAA 2HHHJ 1NXIA 1LQ9A 3DLKA 3HULA 2E5LF 2QMXA 3FJ2A 3FNNA 2QL9B 3QFHA 3ETMA 4WKYA 4RW6A 5I3QA 3BGRA 4FF4A 4I56A 4FVCA 1V6HA 4EYIB 5HI7A 1QTMA 3RB0A 5E2QA 3WIVA 5AJ3J 5L9NA 2DIUA 1UFWA 2MLYA 5E3CA 2C3UA 4N8OA 1O0PA 3KK1B 1YKWA 1KS2A 3JAMY 5KFTA 1VC0A 4ALZA 2OPPB 3BPDA 2ZH1A 4QBUA 1PIEA 3L7UA 1L5UA 2WZ1A 1REVB 4OYIA 4NXNJ 5CYMB 1NSQA 4NE9C 2B6AB 2MKHA 1PC5A 2ZOFA 4X4NA 1LXNA 1H6KX 2RDDA 2YX1A 2BKNA 3C6UA 1G4CA 3GJTB 3TZXA 1S1TA 2CDQA 3KJQB 3HM9A 2J0SD 4QPXA 2A10A 3ISNC 5ETPA 1IBCB 5JJBA 2XB2D 4QCLA 4M5NA 4EU0A 4WFBQ 1SUQB 4NCBA 4CLPA 4ZKAA 4DU7A 2F8EX 2LFVA 3RUBL 5KFXA 1TP7A 2VDIA 1J5OA 1UAWA 4HACA 1NB7A 5IQQA 3W63A 4NCAA 1H0HB 3QAUA 2MQNA 1YRTA 4OIXA 2WTFA 5EHHA 3NGDA 4L73A 3QT6A 3TAQA 2B7CB 1ZA2B 2XHWA 5EGYA 3J81Y 1X4DA 1VQOS 1M1KT 2W7PA 2NPIA 1IJEB 3CIMA 2KXFA 3HSZA 1IKWB 1PYOB 4F04B 1MNEA 5CCMA 2LEBA 5LMUJ 4ZVTB 4ELTA 3CSKA 1FK9A 4EYHB 2F1FA 3KK2A 3HHLC 1S10A 4PWWA 2YKPA 4CLZA 2OO4A 2QMUB 2BANB 3KK3B 3OD2A 3EE3A 3AXKA 2IYIA 1VS3A 1BLUA 5H9FK 2CPYA 2MY8A 5F8NA 1G3OA 1D9DA 3DI6A 4K8RA 1EJ7L 4M5LA 3CTRA 4LF2A 2NXNA 2I8EA 4BS2A 3MEEA 5F8IA 3TVKA 4OZ1A 5T41A 1RCOB 3B4DA 3M8QA 2Z56B 1S1WA 3PX6A 2M0GB 3ZNJ1 4USMA 2M5YA 3R8YA 5HMZA 1NKEA 2R4FA 1TTHB 4F3QA 1RT3B 4EMDA 3J80U 3VVTA 1P1TA 1U1NA 3TI0A 1FTRA 2GMLA 1UZDA 1WKKA 1ZM4A 4KO0B 2BE7D 1M5VC 1IQTA 4WPAA 3HP6A 1SC3B 4ZHRB 2CQ2A 1X9MA 2H54B 3HDSA 1NJYA 3H5UA 3C46A 2FC9A 2HS4A 2EPIA 3ET6B 1ITPA 2I9SA 5B0FA 4ELVA 4U7UD 2VOOA 1FD2A 2VBWA 5GAGU 4K7QA 2H9ZA 1B7FA 2BE2B 4OHYA 3CC4S 3TQEA 2YQ1A 4PG6A 1U2RA 2FJXA 5LXYA 4JI3J 3IR5B 3SDEB 5AE2A 1FNXH 2O1PA 2IM0A 3ZTRA 1E6YA 5B0EA 1N6QA 1RHMB 2DH9A 3MMJA 4KGMA 5K14B 3K59A 4K2XA 2RHQB 2M70A 2AW0A 1FXDA 2VC1A 1W25A 1VISA 1BQMB 4TVAB 3A3OB 1DY3A 3LGMA 4WFZA 2WVDA 1F5AA 4DI6A 1YRXA 4MK8A 1HNWJ 2A0FB 3CCMS 4A8SA 3NRBA 1UETA 2F65A 1VQLS 4CNYA 2AEFA 4RUHA 2RHSB 5K8PA 1X9SA 3HK2A 1X5SA 1LKZA 3JSRA 1D3WA 3A8EA 4LMZA 3OUYA 1NUEA 4F8RA 3AFGA 3TA0A 5A0YB 2C3MA 2O01C 2O5DA 3T1AA 4PAAA 1Q8BA 4RW7A 4DL0C 3J80Y 2VPYB 4G1QA 4WF9Q 2XBPA 4HYKA 2D1CA 3NOCA 3QRQA 1N5TA 1VQ4S 2RUGA 4A46A 2LA4A 4CT9A 3KLIB 1P6TA 5JMNA 1NNDA 3LWMA 5BYRA 2MDAA 5G4DA 1WOSA 4WP3A 1PSDA 4ED0A 3RAMA 3OHAA 1PYSB 3W7BA 2HVIA 2FY8A 2JLFA 1YQHA 4ECSA 1U8WA 4L6V3 1TKTA 3ILIA 2QSWA 3EM1A 4OYWA 2MJUA 3ZZRA 3DKDA 4O3NA 4NZ7A 2DNKA 2B4UA 4DL2A 3L9ZA 4PQAA 1SQGA 3ZO7A 3HT0A 4NXMF 4ZVHA 4CLTA 1HNXF 1DLOB 5HL7S 2EEYA 2ROEA 1VHYA 2RE8A 5MLCV 2V67A 2CPEA 2UUCF 5A6WA 2V2QA 3KLEA 1TV6A 4H54A 4Z7YA 2HHTA 1R43A 4LQ9A 1RYRA 3THTA 4WFXA 3PR5B 3IM9A 5DM6S 3UD3P 3HT3A 3AQPA 2OMOA 4O4GA 5IOLA 4L75A 3FMBA 2ZJPQ 3CDBA 1HWJA 1Y5LB 4UQGA 1HR0F 3FSIA 1WEXA 5EWEA 4FF1A 2NPFA 1JLGA 4ECXA 5GMEA 3DYAA 2D3ZA 3HHDA 4DMZA 3TQ1A 5F9LA 1FVSA 2DNPA 4WCES 4AQYF 2HHHF 2HNDA 5C24A 4CM2A 1FDAA 2XYGB 1VBYA 1EZZB 5L1KA 3UDVA 1UP1A 4K59A 2LYVA 3GIJA 3NBPA 1HWKA 2BYCA 5D8HB 1MSWD 3H20A 3JS9A 2B5JB 4WK3A 1N54B 4DR6J 1HQUA 2IDEA 2AIRB 2DIVA 3RGIA 2FVRA 1FCAA 5AJ3F 2BDPA 3R5GA 2ZZMA 2BXJA 3BYRA 3M05A 4MMOA 2RD5C 2HHXA 4ZJOA 3OR2B 3KDNA 3SSQA 3VCDA 2B56A 2QO3A 2V4JA 4PCQA 2J7WA 8AT1B 2CIMA 2KFZA 1WC3A 3WDOA 4NXNF 5E3PA 1CEZA 4ECVA 3DN9A 3KLGB 3IM8A 3HFZB 5J2PA 4I2PA 1URNA 1ZETA 4OYZA 1R3NA 3KTQA 3LO3A 2AQ4A 1OPZA 1QAYA 3D1QA 1QVGR 4TLQA 5H9FJ 3B54A 1T95A 2P5VA 2HWTA 1HNVB 1LWFB 2X1GA 4KH0B 2LMIA 2PN6A 1U0SA 3TUJC 3RR8A 4WP8A 5J2NA 5F8HA 1IUJA 2GS8A 2M7SA 3R9LA 2YNFA 2JSXA 4R5PB 1KC8T 4FKXA 1S1UB 4USVA 2UU9J 2LDYA 3NCQA 2HAFA 4MJKA 1B75A 2BQRA 2WVCA 1F2GA 4NPOA 2Q6CA 1HWUA 2OPQB 4HHJA 3H40A 1Q8LA 2WW8A 1NDCA 4OHZA 2G9OA 3BPSP 1WTFA 2EWHA 3V2UC 4X62J 2JVOA 1F9FA 1QY7A 4LUBA 2YKNB 2YNHA 4KKOA 2QFJA 1TUGB 2H1YA 2HZVA 3KG4A 2CUYA 4YN3B 1S99A 3MECA 1T05A 3Q2TC 4OYBA 1RQ0A 3CCRS 2MZTA 2HGNA 1DQAA 5LMUF 4UF4A 2FZKB 2XSJA 1I6JA 2F40A 1OY8A 3N0VA 2X7IA 1JLQB 1LXJA 3QWPA 4XDCA 1X4AA 4JP8A 2CNKB 4RW6B 4ES3A 4CLFA 3MCNA 4OJ1A 3TVYA 4BC9A 3QSYB 2XZWA 3UNYA 3QO9A 5E41A 4B9TA 3SFGA 3NS5A 5FJ4A 2A6OA 3C16A 2CVIA 4OL8A 3NMAA 3SSRA 4BWMA 2QJ3A 3T5LA 4OV6A 2ASDA 5C2GA 1RADB 3D0IE 3NGTA 5AXLA 3ENVA 2CX8A 5CD4H 3NY0A 4JI0J 1DQ9A 3DC2A 2GQQA 1D6KA 2W7AA 1S1TB 1WHWA 2X3DA 2J76E 2IM1A 5EN1A 4DS5A 2CKWA 4QIWD 4PXCA 3V4IB 3D1HA 1UFKA 1WHXA 5DDPC 4MYUA 4MFBA 2CQPA 1UVMA 1S7IA 4CO2A 2V8GA 4K4XA 3UFCX 1MWQA 1EAYC 2Y8WA 4CO0A 3L3CA 4QWBA 1J5OB 3K7RA 2VBZA 2MZRA 4JI3F 2DPJA 3KOAA 3NS6A 3J7AN 2CQIA 2VG5A 2IA6A 5KOXA 5EDWA 4HDHA 2ACMA 1OSCA 3H90A 1TL3B 2OD4A 2XGQA 3VGVA 1YHQS 2QT7A 1S4FA 2L3MA 4R8UA 4QR2A 2PJJA 1EARA 1UMJA 4AE5A 3PW5A 2EK1A 3K8VA 4QIEA 4YB6A 5KOWA 3LGNA 2KJVA 1U6BA 3NNHA 4J90A 2HQFA 2HQDA 3C66A 3PM9A 2QL7B 4TY8A 1FK9B 1CULA 3NLCA 3KK2B 1BXNA 1N56A 3R5CA 1BD6A 2KG1A 2CJXB 1B7YB 1RWUA 1CC7A 2WHOA 1NSAA 3LOUA 4O4RA 4Q44A 2R7UA 2K8GA 5EWFA 3I87A 3W60A 2PT0A 4TNOA 3U7JA 2AEMA 2FJWA 3MEEB 7FD1A 2ZD1A 3DRSA 2VONA 4LRFA 3IO1A 5KG6A 4KTQA 3BYPA 4NMLA 4F0KA 2EFVA 4EBEA 5GVQA 2C2OB 1EQ0A 2H4YB 1CJVA 2W1BA 2XLKA 3M8SA 2UVVA 5KG1A 4X4VA 1RUSA 1RAHB 1KVJA 3IAS9 4HT5A 1W2BR 2ZITA 3EGVA 4NI2A 3W2VB 4JB8B 4FF2A 3CDWA 2FHJD 3OJUA 1EHWA 4NCGA 3BM7A 3D28A 3AHPA 3H25A 2FPHX 2Y1LB 3T5HA 2Q79A 1CJKA 3NAHA 3BKUA 4JI7J 3BSOA 2GVDA 2WCXA 5LL6d 3MPYA 4ERDA 2A2DA 5DS7A 1YDLA 1U02A 2G0CA 4OX9F 2MXYA 3PJWA 3IBFB 2G2ZA 2UVRA 1YGYA 3FGVA 1UVLA 4WTOB 3CJ8A 2FLLA 2AZ3A 2LP4A 1JKHB 2JEJA 1SQFA 1CG2A 1DHMA 2QLJB 1WHVA 4DCPB 2B3TB 1UEUA 1P9YA 4FP9A 1E6YB 4ZN1A 2RB7A 1N6QB 2X1AA 1C4AA 2OTLS 3OVBA 4XPCA 2Q3PA 4ED6A 4PYDA 5I3UA 2LEPA 2RE1A 5F0WA 2J0QD 2YWEA 5DZ7A 4O44A 1TVRA 4P73A 3C3LA 4GKJJ 4IO9S 3UD5A 2DRAA 3BB5A 4F25A 1RDRA 1K47A 4YB1P 1KOHA 1VQKS 1X5OA 4QYZJ 3NG8A 2FZCB 3UNGC 4CDIA 2WB4A 5D0HA 3GIKA 3T6BA 2MGZA 1NH8A 1NU4A 1Y0HA 5DQIA 3K5NA 4CP5A 4QW9A 2IC3B 2GGPA 4FYVB 3FUYA 2XCAA 2WB1D 4GVLA 1H7WA 1A6LA 2ZH2A 4Q8FA 2QA2A 4NLQA 2G13A 1ZTTA 4DR6F 1UVJA 2YXLA 3GCWP 2CA9A 1Y4ZB 4S0MA 4G1QB 1YSJA 3JSMA 1RTJB 2POKA 5KFDA 1WJ9A 4HEA9 1FJGJ 2P2CB 3OW2R 3MUTP 4C8OA 3U1NA 2RDIA 3Q8SB 2GAHC 1Q5VA 2M88A 2WW4A 4M5MA 1FO1A 3RW7A 2I5JA 2BQUA 1EUQA 2R2UA 3MD3A 2IMWP 4X4SA 1TKTB 1OS5A 3TEHB 3CCZA 4U8VA 3T1HJ 2Z58B 3EZUA 2HG4A 3B6BA 2KKHA 4K4UA 3OL9A 4EGLA 1S48A 5CYQB 4ZCKA 2KZZA 4OQJA 3L09A 2J6TA 2V8DA 2VFTA 3FEZA 4TN2A 3JQKA 4Q8EA 4Y00A 4KYZA 3MEDA 1OJ4A 3DOKA 5AXMA 4OX6A 3FVYA 2VH7A 3KLEB 4K4ZA 2ZH4A 4CM0A 1KHWA 3IA0A 4B3RJ 3QZ7A 2E29A 3CE8A 1S59A 1HI0P 2GO8A 2P6SA 1RWOB 2YWWA 2MTLA 4Z37A 4X62F 2B8QA 1RAIB 2Z57B 2FQQB 2HURA 4MT1A 1VMBA 1XNRJ 1Q82T 4N77A 2YWKA 1SJ3P 1HA1A 3U27A 1Z1ZA 2V34A 3KJNB 2DJWA 1EETA 2CPZA 2HHVA 2LXIA 3DLLQ 1RBOB 1FI4A 3BDPA 2ZDOA 3NBPB 4BBYA 2FYXA 3PFEA 2VQFJ 4OZ3A 2VD3A 2CPHA 1GMVA 1N36J 1DQ8A 3ILLA 2RF2A 1HQUB 3HSDA 5E33A 3SYZA 2DH8A 1ZTWA 2CVEA 2GX8A 3UDLA 1GXLA 1TFWA 2MPUA 5BR8J 4DQIA 1FX2A 1XC9A 2W2PP 1XTZA 2BM0A 4RBTA 4USTA 1G2EA 3H4BA 2ZBQA 2DGOA 4CYUB 4K5SA 1WELA 3EICA 2V4JB 1X31C 5SZTA 1KWMA 1FRMA 3KXDA 3W8GA 2YKAA 2RS2A 5CZXA 3T1YF 5C5JA 1AUSL 2E1RA 4IH5A 3HXMA 2WOMA 1PJ7A 4DV0J 4OJ3A 4JI0F 1EXDA 1Y5IB 2HLUA 2IYGA 2PEBA 2MEWA 2DTJA 4ITSA 5IT9Y 4DQSA 2DR5A 1X5TA 2C2RA 2YH1A 1S6PB 5J1NA 1K1SA 2VASA 5BJRA 2AD9A 1GMWA 1A7GE 1VQ5S 1U2FA 3FMWA 5A76A 3LP2A 4ZIWA 2MZQA 1H2TZ 1U2CA 3CCUS 3T41A 4EUVA 2OPRA 4EZ6A 1J2VA 4NRTA 3HMJG 2F5GA 3ILOA 4EEYA 1IJFB 4C48A 3G8TA 1GX5A 4V19J 3H2LA 1NPRA 5F41A 4C0HA 3LQVA 4HHUA 1U1PA 2CQGA 3R5BA 1WHYA 1WORA 4IRKA 4KKOB 3NL0A 1S9GA 2K3IA 4I64A 4KSEB 4P74A 1TAQA 2JFKA 4LSNB 2AX0A 4MTPA 3TNVA 4OX8A 5B0DA 1U1LA 1B64A 4RNHA 4U7CA 2DR6A 2XSJB 4CH7A 2VUGA 3UO0A 1TMJA 3IRXA 1BQNA 3WIUA 3V81B 2UXBJ 1RWPB 4WYLA 3OL7A 1B0PA 2IRYA 3RB3A 3MCSA 1YVFA 1NK8A 1IM6A 2KT2A 2HHWA 2FUG9 3G71S 1CS4A 4KE5A 3QO9B 4Y6IA 3A3NB 1SH3A 2PI8A 1XIQA 1PJ6A 1ZA1B 2RT3A 2B9EA 4OLPA 3HZEA 1F6TA 4O3QA 4CIOA 1VC6A 4JOUA 2B9XA 4RJVA 2CJ9A 1RAJA 4V1Ak 1SL0A 1VR6A 1Q0NA 2HMIB 1KKHA 3W1YC 5L38A 3H98A 1IVZA 4NZ0A 3W5YA 2ZJRQ 2UP1A 1PC4A 4KGZB 2DHHA 1YITS 2CADA 2GJIA 5C25A 1S57A 1GFWB 1N5SA 4A8QA 1HHTP 3ZZUA 3G4SS 2GA7A 2RILA 3TZWA 4FZVA 1NK5A 4M5IA 3D54A 2MQLA 2WAQD 1TKDA 4WF9S 3TO8A 1OY9A 5GADU 1X0FA 4MFBB 2R7TA 4A48A 1VK8A 3BZQA 2E1PA 3BGOP 3AAWB 5IZNA 3N01A 4ZVPB 2L08A 3H42A 4DV2J 2GNKA 5SUHA 3AJDA 3QRRA 3OL6A 2HNYA 1RSCA 3POTA 4NYOA 3QIPB 1KHVA 1GMWD 1CC8A 1A9NB 1HIYA 4LF8J 2YQ0A 2YPYA 1L3VA 4ZA1A 3LPYA 2LU2A 2BJ1A 4R8UB 1KEKA 3QGHA 3TA1A 3TYTA 1BC6A 4P7TA 3IC1A 3IS9A 1FDDA 3W62A 1T9TA 2RSQA 2EFQA 4ZPTR 4GKJF 3MPDA 3PJ9A 3Q8YA 2MKJA 1UVIA 4DL4A 3CVKA 2H5EA 2YNGA 5JVGQ 3OHBA 2KI2A 1ACMB 5GMKa 2RNEA 5DRKA 3QAEA 2OPSB 4DV1J 1Q86T 4LF9F 3DRSB 5KT2A 1T9WA 3GYGA 1T3OA 3VZIA 3HPOA 1QD1A 1UCNA 1CJVB 2YNIA 1YBAA 1R31A 4AL6A 3MAQA 5CABA 3MM7A 6AT1B 3D9BA 4URSA 4J9QA 3SSSA 1VGYA 1N32F 1RTHB 1UVNA 1FJGF 2L41A 1HD1A 4DZ6A 1H72C 1DRZA 2HGLA 1FJCA 5B0GA 4UOCA 1A0OB 2LXFA 1S1XB 2HQCA 4M1KA 1R6YA 2DNRA 3QLHA 2CJKA 2KN4A 5K8OA 2QGFB 5T14A 1GXTA 4ZVUB 2GVDB 5KFRA 2HFVA 1WI8A 3MEGA 4IQMA 1UFLA 3GLJA 4CTAA 4YB5A 4OFZA 3E51A 2D9PA 3KHGA 3KUEA 3MOZA 1BWVA 3TX8A 2IVYA 4X84A 2DCLA 3DRPB 4PZVA 4WP9A 3TANA 1VQSA 1X4FA 4X4PA 2DNNA 3MMBA 4DFKA 3QIDA 1F0XA 4J7CA 3M9MB 3G82A 4B3RF 3BQ1A 1VIXA 1LOUA 2CZ4A 4IH6A 3OQ2A 1NDKA 4HHHA 2WSEC 2AJQA 2NZ4A 3BJYA 4ZVOB 1NBEB 2B43A 3M30A 4DR4J 2G4BA 3HI9A 2JEGA 4C11A 4DX5A 4K4WA 4F4YA 2RU9A 1XNRF 5T7LA 5A8WA 2JZ5A 1QDUB 4UOHA 3CEDA 4J37A 4ZOSA 2KU7A 1T8EA 2KHDA 4DPUA 2BX6A 1CVJA 2R7RA 4F50A 1P27B 3AOBA 4H4MA 1LWEA 2YKMA 3G8QA 2QX0A 2VQFF 1GK8A 2EBEA 2AYMA 1W26A 3CGIA 4D3GA 2J8SA 2AKWB 3HSGA 4G3IA 3M2UA 4J9OA 1M5PC 1DTQA 2BJDA 3F41A 4ZVGA 3K5LA 5BR8F 3CCTA 5LMNJ 4OX7A 3JSMB 4DFPA 1RT5A 1RTDA 4HTIA 3F0NA 2F9JA 5A2QY 3ZZ0A 1T9YA 3J7YI 2DH7A 3UN2A 2MQPA 4DV0F 1NHVA 3FCWA 3LGHA 5IQ6A 4IDKA 2V8PA 4ZITA 3W9JA 4J9SA 1PAEX 3BBFA 4DUYJ 2BW7A 2PO4A 4USHA 2HQIA 3KG0A 2ZC4A 3DRXA 5DDOC 3LANA 4O23A 3U1MA 3I0SB 4YDXA 1VRQC 3MR2A 5M2UA 1GQEA 3DOKB 2KVIA 4DSJA 3VTIA 3BGLA 4URQU 5LJ3Y 2E66A 4H3SA 2QTWA 3P45B 2DRDA 4NLWA 3FSYA 3MMCA 2MKKA 3LALA 2C28A 4MIWA 3HHLA 3IBWA 3LAMA 3X1LB 2CDRB 1U1MA 4DV5J 2Z8QA 4ZLLA 2DHAA 1UWBA 1MN9A 4M5KA 3KG1A 3CMAS 2VG6A 2L9DA 1QE1A 3C8YA 4PWUA 1KONA 3ZZTA 1O0CA 2HS3A 3CJKA 4DLEA 3M2RB 1S0VA 1FE4A 4WCEQ 4CO5A 3PFOA 1GTSA 1FRKA 3KMQA 2IIHA 2WONB 5E0OA 1K73T 1U26A 1QAIA 5ETTA 2UXBF 3N9UC 4LF5J 2VJVA 1Q5YA 1FFGB 3U1LA 4L69A 5HP1A 2G0IA 2AE0X 2COLA 3I96A 3BR8A 1KNZA 2W9BA 4JV0A 4U6PA 3M1VA 4GRSA 3ZTQA 2XG8A 2JWNA 4IOBA 1JLFB 1IWAA 3D1OA 5ADZA 2ROGA 2DYAA 2AYGA 2LA6A 4NLOA 2Z0YA 2PEHA 5BNZA 3VWSA 1LW2B 3ZTPA 2CJAA 2BVZA 1JXVA 4LFBJ 2DD8S 3GIRA 3DNCA 1SC4B 2WOMB 3VAKA 2HZ7A 3DOMA 4Y34A 4A8OA 4ER8A 2BBEA 3FQLA 2C2NA 1HMVA 4F26A 4TLRA 2ZWOA 1HBOB 2A6MA 4IKAA 1QAXA 2MZJA 2R7VA 4TXSA 1YJRA 4DBQA 4HVZA 3HJVA 4WK1A 3T9NA 2OPRB 2UUAJ 1R8BA 2H4WB 2GIFA 1Q95G 2FJEB 2VPWB 1RLDA 3PIOQ 3SIPB 3HKZD 3HKWA 3MM5A 4C6AA 1MU2A 4LF8F 1Z2ZA 2Z2YB 3T5JA 2DNZA 1S9GB 4I6WA 2V2KA 2ALYB 1BE4A 1XMQF 1IKXB 3BV8A 5HBMA 4C8YA 3MUMP 4USIA 1ZAVA 3CO9A 2MJNA 1RU1A 1WUUA 4RL1A 1N48A 5IFMA 2Q1LA 1BQNB 4DN9A 1VQMS 5J2QA 2VFSA 4WXOA 3I32A 1R8HA 2K7JA 5F8GA 3W5XA 2AX1A 2ZHOA 1C1CB 1CJUA 1QSLA 2GJ2A 2CQ1A 5DG8A 4DF4A 1C1BA 1OQ6A 2MQMA 4DV1F 3P96A 3IWXA 1FVQA 4USJC 3MGJA
chains in the Genus database with same CATH topology
2PMHA 2LDYA 3UD4P 1SQEA 3RAXA 3NCQA 1N33F 1SC6A 2ZOMA 4AUKA 3MFIA 2ZH8A 4EZ9A 4MJKA 1UJ5A 2Q6BA 1B75A 4KGKA 5KFGA 4WZQA 2ZJQS 2LQ9A 4C2MA 2BQRA 4JV1A 2ALZA 1F2GA 2GV1A 4NPOA 1LWCA 3FRZA 4NLYA 2E44A 1HWUA 2Q6CA 1VBXA 2OPQB 5HP1B 2ILZA 4HHJA 3H40A 2BQ3A 4YY3F 2I0XA 3G9CA 3CF5S 1Q8LA 2WW8A 4CO3A 3HHNB 4OHZA 4CNZA 2IFXA 4B9MA 4DWIA 3V4MA 4W90B 2G9OA 2GO9A 3I5BA 1WTFA 2K1RB 5I4MA 3G6ES 4OJHA 5IZHA 4FS1A 3T1HF 2EWHA 2UVWA 1Y7PA 2CPIA 4ZVFA 3V2UC 1HNIA 2PC6A 1KSPA 1DARA 3IGNA 3H2VE 1FRHA 2I1RA 2JDJA 2JVOA 1F9FA 1QY7A 2FVSA 2JLGA 4LUBA 2DO0A 1HBUA 2YKNB 5DQGA 3I5AA 4WXWA 2YNHA 4KKOA 4LSLB 2QFJA 3V6DA 3MTKA 4P2BA 2PA3A 1X5PA 3EUNA 4X4UA 5C25B 3KG4A 2KT5A 3PO4A 2WBMA 4I6YA 3MOJB 3Q23A 1S99A 3MECA 2HIQA 2JFDA 2GMJA 3QWUA 1T05A 3DMJA 2CPDA 2ZZNA 3Q2TC 3JSYA 3UQSA 3RB6A 1TV6B 4HTJA 4ZS6A 3HVAA 1RQ0A 2WK4A 3CCRS 4LVOP 3OR1A 1JNZB 2MZTA 4WE1B 2HGNA 4PR6A 2RRBA 1DQAA 3L7PA 3QGGA 2IVFB 5LMUF 2XSJA 1V3SA 3G6XA 4B9UA 1ZPWX 4DSIA 1JIHA 1I6JA 2F40A 2KYXA 2E5GA 3OVSA 4RW4A 3N0VA 3M6VA 1FEUA 1JLQB 1LXJA 4NX9A 5IWAF 3CDAA 3EGNA 2AJ4A 4YR0A 1R8AA 2RD2A 3E01B 3QWPA 5JVHS 4XDCA 1X4AA 2JC1A 4F67A 4ICLB 4O4GB 2XMMA 3TP2A 4H4KC 4RW6B 4V19X 4ES3A 4DS4A 2B0GA 1DBDA 5IT0A 4LFCF 4DSEA 3PW2A 1Y00A 4OJ1A 3TVYA 2MMYA 4BC9A 4CH0S 3PO5A 2XZWA 5KFLA 3K58A 4DG1A 3QO9A 4B08A 4UQTA 1F60B 5E41A 3MDFA 2ATLA 3SFGA 1JLGB 4ATNA 4B9TA 2V5HG 1HMVB 3NS5A 2HNYB 2Z2MA 3DYAB 2FTRA 2AF6A 2IJNA 3LP0A 4RBUA 3W2VA 5FJ4A 3TAMA 1Y9OA 2W7OA 5AE1A 3DU6A 5J1PA 1QRSA 4YR2A 2IMOA 1ZYQA 5KT7A 2CVIA 5CYJA 4OL8A 2HNDB 4KV8B 1RI7A 3HX9A 5B08A 5C24B 3FRYA 1S9FA 3NMAA 3SSRA 1H38A 2VKRA 4BWMA 3EPGA 4PQUA 2J0WA 3LAKA 4RNMA 5DETA 2EFNA 2NYIA 3WC2A 3K2YA 4FNHA 1XN9A 1N34F 2UV8G 3SV3A 4DQPA 2FB0A 4DR7F 4I6AA 3NKYA 2Z0GA 2DGTA 4ZPDA 3T5LA 3TA2A 4TQSA 1Q7LB 1UEVA 1YJVA 3GSDA 1N5QA 2NXUA 2EVZA 3WC0A 5IXUA 3SEOA 3RBEA 1NHUA 1N5YA 2E9TA 3JYTA 2GC8A 2ASDA 2C3YA 4GC6A 5B0BA 3OXLA 1FKAF 3OFFA 5KFEA 4HH0A 1FDBA 1GNKA 1RT7A 1SV5A 1SKWA 3D0IE 4NLRA 3VQTA 4QPTA 4E8UA 4DR4F 5AXLA 3ENVA 3NGKA 4IFYB 2QIFA 6FD1A 1HYSA 2JEFA 4IR9A 1RT6A 4OZ5A 4B9SA 1TUVA 3AA8A 4F4WA 3X3UA 5CD4H 4Q7AA 3RAQA 1DQ9A 1N36F 3DC2A 2CJBA 4ECZA 3UCGA 2F4VF 4ZPCA 2GQQA 5CQGA 1D6KA 4Y2CA 4ECUA 5E3RA 2W7AA 1S1TB 1WHWA 4ECTA 1R8CA 2J76E 2YNGB 3G96A 1DTTB 3AA9A 5AE3A 2IM1A 3RR7A 5EN1A 1GH8A 2MQQA 1ZAXA 2GHVC 3IR6B 4DS5A 1V3ZA 1JKHA 3L7OA 3I56S 3QJLA 1JLEA 2CKWA 4ZMMA 4QIWD 4B02A 2B9WA 2CQ4A 4PXCA 3V4IB 3GIIA 2N3LA 2X1BA 2NS1B 3D1HA 3TR5A 3EPIA 3PXGa 1M5OC 3CULA 5GAHU 3HZGA 1AFIA 2W9AA 1JLCB 2D7SA 1NO8A 2DBBA 2VA2A 1WHXA 3DLGA 3W2WB 5J2PB 4I2PB 4FXVA 5DDPC 1NJIT 2ZBIA 4L3NA 4MYUA 4MFBA 3H59A 4CQ1A 2CQPA 1UVMA 1URRA 4CO2A 2V8GA 3J7A1 2V0NA 4K4XA 3UFCX 2C2DA 1Q79A 4ZCIA 2BA9A 3GZ7A 2RKIA 4CO0A 3L3CA 4QWBA 2XGPA 4A8KA 1V9OA 1J5OB 2IBKA 4YHHF 3K7RA 2VBZA 1Q53A 2MZRA 3D0GE 3ETOA 4N8NA 3SXLA 2DPJA 4JI3F 3KOAA 4AFFA 5CZVA 2EG2A 5LMNF 1U7LA 3NS6A 2DO4A 2CQIA 2VG5A 4B3SF 4PUOB 5FDLB 3VAGA 2IA6A 5KOXA 5J2NB 5EDWA 4HDHA 2R2RA 5KFZA 2UXDF 4WKRA 5K8NA 4Q43A 1VJWA 5DDRC 4EFAC 1OSCA 1C0TA 1HI8A 1JLBB 2YNFB 3TVZA 2GW8A 1TL3B 1EUYA 2CPFA 2IHR1 2OD4A 3OFGA 3SMZA 2XGQA 2R8HA 3PW7A 2OPPA 3EXCX 5D3GB 1YHQS 2ZH3A 1R0AA 1KTQA 1Y3JA 5LSLA 4DQRA 5KFIA 1NK0A 1N52B 1S4FA 2QT7A 2L3MA 5A8KB 4R8UA 4QR2A 2KH9A 3BSNA 1UMJA 1FRIA 1EP4B 2FVCA 5HL7Q 3RRHA 1X9WA 1REVA 2IC3A 1XMOF 3CD6S 3THVA 1BWEA 3I55S 4AE5A 4A8MP 3PW5A 1U24A 2EK1A 1FESA 2ASYA 3K8VA 4QIEA 4YB6A 3RZAA 5KOWA 1L3UA 3LGNA 1LWCB 4IG3B 3M6UA 2KJVA 4ED2A 3KJVA 1U6BA 3NNHA 2J9DE 3I5CA 4OHWA 4QZVB 3QLHB 5KFCA 3C66A 2YQ3A 3PM9A 1FKPB 3GFXA 4TY8A 1FK9B 5GAHW 3CCWA 3NLCA 3KK2B 1N56A 3R5CA 1D8ZA 1BD6A 2KG1A 1HD0A 4QJVA 3B82A 3CIZA 4QR1A 3KLHA 4ED7A 3MEGB 4ED1A 4A8FA 1MMLA 4DUYF 2QA1A 2J6UA 4JV2A 3IG1A 1TK0A 3MPWA 2YNHB 4C98A 5DM6Q 1RWUA 3V6DB 1CC7A 2PA8D 5KFJA 2M8HA 3V6JA 2ZKTA 3TRGA 2WHOA 3LOUA 4O4RA 5KFWA 1RTJA 1OQ3A 5A8RA 4Q44A 2R7UA 3VQSA 3V6KA 1SI9A 1YWXA 1WTBA 2K8GA 5EWFA 3MECB 1T05B 3I87A 3DMJB 4OJGA 2ZHBA 5K8MA 4ED3A 2PT0A 4TNOA 3U7JA 2N3OA 5KFFA 2B4VA 3P6YC 1JXEA 1KFSA 2MKSA 2LQBA 4QWEA 2FJWA 4KJIA 2EFOA 3GFYA 1SUQA 4HI1A 4RNNA 3MEEB 4QIGA 4Y28C 7FD1A 2ZD1A 3MMBB 4FVMA 2OKQA 1NK4A 1FNOA 1XWLA 2HGMA 3DRSA 3H8YA 4GO5X 1Q1KA 4RW4B 3THPA 2VONA 1FEEA 4TQRA 4PPZA 4JYZA 3IO1A 5KG6A 4KTQA 2FHKA 3BN4A 2QYCA 4RWWA 3FZ2A 3E8OA 4NMLA 1HPZB 2EFVA 4EBEA 4O3RA 5GVQA 3PACA 3V5RA 1VQ8S 5D6GA 5H9EJ 2MSSA 2KDOA 1WNEA 4PXBA 1T3NA 4HLBA 5B7WA 4ZP9A 4DX8H 4DV5F 2XLKA 1HBNA 2RQKA 3NWGA 3M8SA 2UVVA 5KG1A 4X4VA 4BWJA 1KVJA 3IAS9 4HT5A 2Y1JA 3PX0A 4H4KA 2VL1A 1DFDA 4OMFG 1W2BR 2LVWA 1H2UX 2ZITA 5B09A 3KMSA 2HPUA 3GR1A 3M30B 1SKRA 2AYBA 2DHXA 1TKZA 4DFMA 3W2VB 1TAUA 4DSFA 4FF2A 3CDWA 2FHJD 3TAMB 5GAHI 3OJUA 1U45A 2HQ3A 4OHVA 4OZJA 3Q24A 4NCGA 3BM7A 1IKYB 2CPXA 2UV8A 3D28A 5CYQA 3AHPA 4Z2XA 3Q0AA 2DGWA 1SBRA 1CQMA 1N8RT 2A3JA 3H25A 2FPHX 2MYFA 2WRMA 4PQUB 3H5SA 5C42B 2XLIA 3SCIE 1VHFA 4I4BA 5T7LB 4I68A 3T5HA 4J9LA 4LF7F 1KQSR 1H98A 2Q79A 1VBZA 1U4BA 1XERA 3BEGB 3NAHA 1ZZNA 4KFBA 3N79A 3GFHA 3EYZA 2HZCA 5A0YB 2EFPA 3JYTB 4Y3CA 3BSOA 2WCXA 3DRYA 5LL6d 4LF5F 4Y2MA 3OV7A 1TK8A 2DCUB 5DJBA 1FJ7A 4YOEA 4OLOA 4MH8A 1S0OA 1RT7B 2YKMB 2CYYA 4QYRA 1R7IA 5KT5A 1KFDA 2W25A 4XK8C 4QU7A 3MPYA 4ERDA 4ILLA 2A2DA 3NCPA 5DS7A 1KRPA 1TZ0A 2CQCA 2FGOA 2G0CA 4OX9F 2MXYA 3DOLA 3GYNA 3PJWA 2DVIA 1RT1A 3BGUA 2EW9A 3DCAA 3FFIB 4KQZA 3CJ3A 3OTOF 3M2UB 3T19A 2ZHAA 1VRUB 2UVRA 4B17A 1DFUP 1YGYA 5F0UA 2HWIA 4FXWA 3FGVA 1UVLA 3M6XA 4TU9A 1IKVA 4M8LA 1RT2A 2IM3A 2FLLA 2HW3A 4M5DA 1TQLA 4IO1A 3CB4A 3AQOA 3BO3A 1JKHB 2PDAA 2KHCA 3BSAA 2I2YA 5HQ8A 3VALA 1HWLA 2JEJA 1WF1A 3PV8A 2C22A 3ISND 1TKXB 1RT5B 1CG2A 2KZMA 4G1PA 2OMLA 4ED5A 2M4MA 1DHMA 1WHVA 4WIIA 3ENQA 4DLGA 1M0SA 2B3TB 1UEUA 1RTDB 2ZVSA 2DNYA 2IRUA 2UVUA 1QVFR 2J8AA 4FP9A 1E6YB 3MD1A 1XEZA 2R2SA 2RB7A 3D5MA 1N6QB 4YMEA 3N5BA 4EO6A 1C4AA 2X1AA 3M8PB 2OTLS 4AL5A 2FDNA 3OVBA 4XPCA 3NNCA 2DNHA 2Q3PA 4AYBD 2DNGA 2HFNA 3A1YG 4ED6A 3CUNA 1KR4A 5I3UA 1K9MT 3CC7S 1G1XA 5KFNA 2LEPA 2RE1A 5HROB 3PIPS 3GV8B 1K8AT 5DG9A 5F0WA 2R2TA 1FHTA 3G8SA 5GAEU 5IT4A 4PG8A 3M9OB 2J0QD 4LFBF 1QJHA 2RKIB 5E7OB 3I4PA 2YWEA 2HHQA 1L3SA 4XIUA 1HW9A 4O44A 4E98A 2RIJA 1TVRA 3C3LA 4IO9S 2DRAA 1RA7A 2VG5B 4URGA 3BB5A 4F25A 1RDRA 1N5VA 5JXSA 4YB1P 1KOHA 2CQBA 1VQKS 4KO0A 4I67A 3EGWB 1X5OA 4IDKB 4M63A 4WTYA 3CF5Q 4QYZJ 3NG8A 1C0TB 3J7ZV 3M4XA 4TKTA 2WB4A 4ZP6A 3UNGC 3T6BA 2MGZA 3GIKA 4DV2F 5KFKA 4C8ZA 1NH8A 2W24A 3AJ2A 4P7VA 3O44A 1NU4A 2PGCA 1Q4RA 4ZHRA 3Q8PB 4YR3A 1R0AB 4K4YA 2DGSA 2HAIA 1VIOA 4KAIA 1Y0HA 1U1QA 5DQIA 3K5NA 4TU8A 1U6ZA 2HVHA 2O67A 3HLUA 4HI2A 3VR1A 1ZM3A 5HMYA 4QW9A 2PE8A 4NYZA 2IC3B 1WWHA 4I2QB 3ICLA 1H7XA 2JVRA 5LJ5Y 5HLFA 2GGPA 3G6YA 4K4TA 2ZBCA 3MXHP 2FD2A 2XCAA 2DNQA 1O51A 2WB1D 4NLVA 1HQEA 3OJSA 4NLSA 2CQDA 4OV1A 1QUVA 1TL4A 3UCZP 4UW2A 1H7WA 3HF5A 2WBRA 3NMRA 4Q0BB 1A6LA 5KAKA 4QWCA 4WJBA 4V194 2ZH2A 4TY8B 1GT8A 4Q8FA 2QA2A 4NLQA 4UUWA 2ZJRS 2G13A 1ZTTA 1VRTA 3DRRA 2UUAF 4DR6F 3ZC4A 2MHEA 4ZP8A 4LVNP 1UVJA 5M2PA 3HHLD 3KLHB 2BOPA 4RNFA 4MIAA 2MB0B 1Y4ZB 2ZM6F 3T3FA 2ZE2B 3MMCB 3US5A 4ID8A 4U67S 4NA2A 5M2RA 4G1QB 2V9WA 1YSJA 3MAHA 3JSMA 5GAEW 1RTJB 5JVHQ 2R7QA 1AXQA 5A8RB 2POKA 1BGXT 5KFDA 5J2MA 1DURA 3HVTA 2J5AA 2FLOA 2EKYA 3DXBA 3QZ8A 4HEA9 1QE1B 2CQ3A 1N0UA 3P3DA 1KLNA 5EX0A 1S1VA 3OW2R 3MUTP 4C8OA 3U1NA 2RDIA 4N41A 2ZD1B 2BM1A 2BJEA 3Q8SB 1HL6A 2JX2A 2EFGA 2YWGA 4OI3A 3CJKB 1MROB 1S6PA 2M88A 5MAOA 1T03A 1T7PA 4IFVB 5L9XA 3QGIA 2R7WA 1HBMB 3SI8A 1FJEB 1FO1A 4I7FA 3RW7A 3RW6A 1FT8A 2I5JA 5KFUA 2WSFC 2BQUA 1EUQA 2R2UA 3MD3A 4C0BA 3OPKA 2IMWP 4LFAF 1YG0A 3O2IA 4R0EA 5KG3A 5D4LA 4X4SA 1TKTB 1JB0C 1Z4UA 1OS5A 2P9GA 2HRUA 3CCZA 1D9AA 4QIFA 1SJ4P 1XBWA 2PFFB 4DSKA 4TY9A 1XR6A 2DGQA 2ZNYA 1C0UA 3EZUA 2HG4A 3OSPA 2KKHA 3MMAB 4K4UA 2KG0A 3OL9A 4N76A 4C3LA 5FD1A 4RW9B 3PRBA 4EGLA 4NCGB 1NKBA 1TFYA 3MUVP 1S48A 5CYQB 2FHMA 3C6TA 2ADBA 2E9ZA 3KKFA 2MKIA 1SIWB 2GFFA 2W9BB 4ZCKA 4Q45A 2QLXA 2KZZA 4OQJA 2QLWA 3ULHA 1UVKA 3L09A 3GMGA 3M1VB 4DL7A 2J6TA 2M8DB 5HO4A 2V8DA 3BN7A 2F7VA 5L39A 4ZLPA 1J5EF 2VBYA 1DJ0A 2VFTA 3FEZA 4TN2A 5GAEI 1U8SA 2PMZD 3M8RA 4Q8EA 4KFBB 2VV5A 3GV5B 3SCKE 4Y00A</