4H4KA

Structure of the cmr2-cmr3 subcomplex of the cmr rna-silencing complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
259
Chain Sequence
VTFTPYDVLIPLPQTVAGAIRTLLFYEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRILRIEKIYAWIEDPGCGIKDILSSYEFLTLGSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cmr2-cmr3 subcomplex of the cmr RNA silencing complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Rna binding protein
molecule keywords CRISPR system Cmr subunit Cmr3
total genus 55
structure length 259
sequence length 318
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4h4kA02
3.30.70.2940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4kA01
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4kA03
3W2WB 3W2VB 3X1LB 4H4KA
chains in the Genus database with same CATH superfamily
1DZ5A 3GTYX 1R8PA 3B8HA 2XLIA 2VQFF 3KMQA 2MJUA 3B4MA 1RAOA 5CYMB 3HSJA 1T9XA 2HFUA 2CADA 5ETMA 1WF1A 4JI2F 1RABB 3OL6A 5I3UA 4MIWA 4O4GA 2EFQA 4MFBB 1YJVA 4ETXA 2GX8A 3HSZA 4FXWA 3MECA 4JI1F 4DPOA 5BR8F 1D9AA 2XCPA 3CJ3A 3CJ0A 1EP4B 4CLYA 2VPYB 3KK3B 2OPQA 3D1OA 1NJZA 4A8FA 3MM9A 4U8VA 4Y00A 1J5EF 4ZVOB 1FRXA 2K3KA 4AFFA 2DXFA 5CA5A 4A8QA 2FVCA 1RSCA 3PJXA 1DQ9A 5AXMA 2FC8A 4TYAA 1VRUA 2EBEA 3M2UA 4TKTA 2OIHA 3T9NA 4OYBA 1UZHA 3J80Y 4JI2J 4JI3F 2ZHOA 3TJ9A 1RT1B 2OSQA 2CNKB 4TY9A 4YDXA 5M2PA 1Q8KA 1YDLA 4WFNS 4Z2XA 2Y0BB 3HJVA 4HT7A 2C28A 1JJ2R 4OZ5A 1EAYC 2MQ8A 2VICA 3JAMY 1NDLA 1HWLA 2HMIB 2VG6B 4DUYJ 3A1YG 2FTRA 2YXLA 1HBUB 4FF4A 2DISA 5E3QA 4OI1A 3QJPA 3QRPA 3JSRA 3PYEA 2IRYA 6AT1B 3AA9A 2GAEA 5KG3A 1VQ6S 3D6FB 2W4DA 2G2YA 3DOLB 1KR4A 3M6WA 3NOGA 4NMXA 4CRJA 3NNHA 2CPIA 2Z2MA 1S9EB 2JVOA 2BJ1A 2BANA 3S01A 2F8EX 2VODA 1H7WA 4V1Ak 4ZS6A 3TEHB 1LFPA 2V8GA 3ZTQA 1S6UA 4DCPB 5A8WB 5EWGA 3CNQP 2UXBF 4Q5VA 3ZFVA 1NUEA 2VL1A 5D0RA 4EYHB 3UI3A 4IFVB 4KH1B 1DAXA 2ZM6F 2EC2A 2HVDA 2R8GA 4C8YA 4OZ2A 4J7CA 2BV3A 4KH0B 3IS9B 3UNGC 3BGRA 2AEMA 1XQIA 4EWTA 4FS1A 4WKRA 2FQQB 4NYPA 3G8QA 2WB1D 2VDIA 4G1IA 4LR9A 2VA3A 4N41A 2HS0A 2JL9A 4F0MA 2GHWA 1VI7A 2W01A 2KT5A 4KHPF 2AYGA 4A4JA 5IT0A 4PXDA 5J2MA 3H5XA 4TLQA 2BJDA 3AQPA 3L7UA 3NS6A 1ZTWA 2ROEA 4TYBA 2IY5B 2DPJA 5KFXA 3D6HB 1O6XA 2EK6A 1WF0A 3H20A 3QIPB 5CXTA 2V8HA 4HHJA 1C0UA 4CCHA 4BCAA 1DQ8A 2QLBB 3HHLC 4ZLNA 4F25A 3TQ1A 1HWJA 4A8WA 4PAAA 3BQ2A 3BKTA 3MR5A 2N3OA 3W2VB 1EB0A 3ET6A 3RBZA 2WTFA 2J0WA 1S97A 3RZAA 1HR0J 4LF4J 3ELHA 2EWHA 4NZ6A 3CJ4A 3CC2S 1D9DA 1NSAA 3A3NB 4ZPVR 4ZP9A 5A0YB 4DCOB 2GQCA 2PNWA 1IKYA 1TK5A 4CLWA 2QYCA 4QPTA 3MR2A 3JAMU 3MGJA 2DGQA 2E5JA 5EWFA 2EXUA 5GAHU 1PBAA 2DO0A 2HNZB 3JSMA 2G0IA 3HF5A 3K5MA 2WONA 2MSTA 4J9OA 4G1QB 3M8PB 4DBQA 3DMJB 2OPPB 3I5BA 3TP2A 5IWAF 3DDIA 3M8PA 4C3MA 5KFOA 3BQ0A 3IWNC 2AKWB 3EGNA 1W2BR 1TKDA 3KW2A 2OPRA 2HVIA 1RTJB 5F8JA 4ZLJA 2XY6A 1PAEX 3QO9A 1XIQA 2JJ4D 4K2JA 1LWCA 3R5GA 2XYPB 3BN4A 4NOHA 5LXYA 3FFIB 4DLEA 2PI4A 2RRNA 2FJDB 2JX2A 2GZOA 1FDBA 2W24A 3M8RA 3NNCA 2B4OA 4DU7A 5KFYA 4DN9A 2NSBA 3AODA 2MZRA 3DU5A 4DF4A 1VRTA 1X9MA 4DL5A 4M63A 3MDFA 4K4VA 2ZJRQ 4G6VB 2OAUA 2V4JB 2BW2A 5L39A 3VR1A 1HW8A 2LEAA 4RWWA 3V6DA 2L9WA 1F3VA 2PC6A 3HHLA 3SSSA 1BC6A 2RUSA 2ZH7A 1H72C 4TY8B 1T9WA 2VU5A 1B0VA 3SCLE 5EWEA 1J5EJ 2YKMA 1YRXA 5E5NA 4NLVA 3QJJA 4RR5A 1WSVA 1MN7A 4I68A 4OJ3A 2CVEA 1VR6A 3KLHB 4K4XA 3RAXA 3A4TA 1VHYA 4JI7F 4TU8A 1S0MA 5C2GA 2ADBA 2AX1A 5T7LB 3K17A 5CYQB 2Q3PA 3DI6A 1VCTA 5B0GA 2ZC4A 2DGSA 3W62A 5AE3A 4F2SA 4ILMA 1HMVA 2I2YA 2CQHA 3BO4A 2VC1A 3DLJA 4WK1A 3KHHA 3CMAS 5IV4A 1CPZA 2CJYB 1N6QA 1RA6A 2HBZB 1RWNB 5KFLA 2IC3A 2YBVA 1ZA1B 2KXNB 3CCQS 3V6DB 4L73A 1U47A 4B9SA 2CQPA 4ZVPB 2Z0YA 2ILYA 2ASLA 2WCXA 4BWJA 2LQJA 2MLZA 3OJSA 5GAGW 4J9UE 2KM8C 1TK8A 5GADU 2B4UA 1XERA 4NLYA 2NZCA 3M2VB 1KQKA 1BQNA 1RHKB 2B8QA 4B9MA 4JV1A 3FQKA 3Q22A 2VJUA 1WSRA 4O3NA 2DR5A 2EBGA 1KEKA 4X66J 4NMLA 2RS8A 3I31A 2AJFE 2PSZA 4H4MA 3M9NB 4QU7A 3AB2B 4KFBB 3FBEA 4FP9A 4K4WA 1FEUA 4H54A 2IYIA 4ZCIA 4Y2IA 1LWFA 3QT5A 2ZWPA 5A8RA 2ZJPS 2KRRA 3ZZ0A 4CT8A 4RW9A 4Y2CA 1NJYA 3PYDA 1MSWD 2BQ3A 1E6YA 2WW4A 3PR5B 5LOQA 3G6ES 3VHQA 1VHKA 1I1GA 2FHMA 1V5VA 3NL0A 5ETLA 1HBOB 2FZKB 3EUNA 3GR1A 3OD2A 5HVGA 1X9WA 4WZQA 1AFJA 2HHSA 2DNLA 1F2GA 2G4BA 3W64A 1KLMA 4H3SA 1XBWA 1MMDA 2COLA 1M1HA 5L1KA 2E1AA 1X4BA 1JJ4A 4XDDA 4URSA 1GX5A 2OTLS 1S12A 2C1EB 1UVIA 4ILLA 1LWXA 4N8NA 2B43A 4AYBD 4ER8A 2W8KA 4B9LA 3W61A 1IBLF 3MCSA 1S6QA 3K7RA 2G13A 5EGYA 2CNOB 3KJQB 3KLFB 2CA9A 2ZKTA 2C2ZB 4MYTA 3H5YA 2GW8A 2XSFA 3H8YA 1SL0A 2DNKA 1S5ZA 2B51A 4EMDA 2HWTA 1RT6A 2FVQA 5KFZA 4DR1F 2CX8A 3NMAA 4ZP7A 3LP2B 4WF9S 3FKBA 4FYYB 3N01A 1PG5B 4GVLA 4JV0A 5GAEI 2JWNA 1HBOA 2IPOB 2I0XA 2PIIA 2V5HG 4IG0B 3QGHA 1X5TA 4W98A 4LBIA 4YP3A 2V2KA 3Q8QB 4EBCA 2XS2A 2N3LA 3DCAA 1MU2A 3NGDA 1YGYA 1RWOB 3B54A 4JI4F 2PO4A 1FRIA 2IM0A 1T02A 1RI7A 3JTPA 3P5TL 4LRBA 5D4OA 3G8SA 3EZ5A 1MU2B 4PYDA 5F8GA 2R8JA 4WFXA 1H7XA 2DR9A 1SUQB 3HD1A 1U1RA 4I2QA 4Y3CA 1FJGF 4RNHA 4OYXA 1NBEB 1W2IA 2EW9A 2PT0A 4ENOA 2RB7A 1R7IA 5CCMA 4OHVA 2C2OB 1FWPA 3HSGA 4QWEA 3CMES 4UY88 3TUJC 2XMKA 4X66F 2Z58B 2BUNA 3FSIA 3T41A 1HD0A 1M5KC 3NNAA 1PBUA 3KUGA 4ZHRB 1NSKL 4QR1A 3BQ1A 3CE8A 4BBYA 3D4JA 1B0TA 4ANEA 2HWIA 4UZCA 4KC5A 3DLEA 2HGMA 1FESA 2DIUA 2ZUAA 3LF0A 4HI2A 3PIPS 1DTTA 4RWXA 3U1LA 3TWZA 1SH0A 4YDDB 1MN9A 4FF1A 2LCWA 5I42A 3KJVA 2R8KA 2HRUA 2MSSA 2ZVIA 1EUQA 1GT8A 4LF1A 4UTGA 2YX4A 1J5OB 2DR7A 3G6VA 4ZPBA 3PIOQ 2I38A 2HNYA 2NCKL 4HHHA 2HHWA 3MMJA 3MM8B 1IJFB 3CDEA 1SCJB 1TKTA 4RNOA 4B02A 4DQIA 2E7XA 2ZDPA 1RYSA 2UVUA 3HSDA 1QLNA 1BHNA 1FWLA 2YWWA 2JNJA 4KO0B 1ZA2B 3PEJA 3FRYA 5FIIA 2H5JB 4DSJA 4WFBS 3KKFA 3MXHP 2B7CB 2GJIA 2WBRA 2VKZG 1Q1KA 1FNMA 2XI3A 4KO0A 3OTDA 1L3UA 3DLHA 2FVRA 1LW2A 2NXNA 2Z57B 1NJWA 1N5TA 2YH0A 2CQGA 2DRAA 3CCMS 1N52B 5DETA 1EZZB 1FO1A 4P2MA 4H4KC 3WHIA 4IH6A 5DLGA 2ZOMA 3B78A 3JYTB 4Z7CA 3GZ7A 1VK8A 4WWSA 5K20B 2AQ4A 2YKAA 2F63A 1TVRB 2FZGB 1WTFA 3JTNA 3TAMA 4IOAS 2JC1A 3T6BA 1Y10A 1SV5A 4M5GA 3BZQA 2QLFB 4MKAA 1IN0A 1H98A 1S9FA 1SV5B 5DDRC 2RT3A 5KFPA 1X0FA 1IBKJ 2R2UA 1YQHA 4DR2F 4DV6J 4E0DA 3DRYA 3L9ZA 3FBCA 3MCMA 3QIDA 2A3JA 4DR4J 1HQEA 2VZ9A 1REVB 2K7JA 3RGIA 3QO9B 2BR0A 2EFNA 3LAKA 3RRKA 3HFZB 3DXBA 1PYSB 2OEMA 2GMHA 1SC4B 2JVRA 3FFIA 3ZZUA 5T14A 2UUCJ 5J2PB 1LFWA 1Z2ZA 2M7SA 2MQMA 1H2TZ 2LU1A 3HVWA 2ZJPQ 1UETA 1WD6A 3TYTA 5B0EA 2N82B 4QYZJ 4ZVGA 2XYGB 2ZZNA 5F41A 2XO6A 5DM6Q 1WDDA 2GFFA 2HG4A 2XI2A 3R6GB 4J9PA 1U1OA 1N33J 4V194 3UDVA 1Q8IA 3HFVA 1IKXB 1TQLA 4FXVA 4ZVHA 3KK1B 2ZHAA 2XTJP 3GFHA 2B4PA 1ZS6A 4C8LA 3MPUB 3CCUS 1K73T 4JYAJ 1U1MA 2DNRA 1HWUA 3CD0A 2RQ4A 3L09A 5BYQA 4RW8B 3QZ7A 1NB2A 3MM5A 4K8RA 1JIHA 4TXSA 1Z1ZA 2GMLA 5L46A 4X64F 4Q45A 2DGVA 3L95X 2VG7B 4ZKAA 1BMQB 2A6OA 4H4MB 2OTJS 1S77D 1P27B 2BVZA 9ATCB 1SJFA 1QD1A 1AXQA 1U0SA 4ECYA 2V94A 3PJWA 1IUJA 5E7OB 4MKBA 5A0YA 4PWDA 3OT9A 2ZUGA 3T6JA 3K8VA 3LTOA 4KT0C 2OKQA 4KB7A 2LFVA 1TL1A 3E8OA 2D7SA 3T1HF 3J81U 3RB0A 4KBIA 4AQYJ 5KOXA 4X84A 5C24B 2F9JA 4DFMA 2AHOB 2UXDJ 1K8AT 1FHTA 1JK9B 3Q0AA 1VBXA 4FS2A 2J0QD 1KHVA 2GQ2A 1IKXA 2HEKA 2HQDA 4RX6A 5C25B 1U25A 1U2RA 2GVDA 2J8SA 3O1LA 4K59A 4RKUC 5DG8A 2VQEJ 4DL4A 4NCBA 2E9RX 1J2VA 2KHDA 2NXCA 1HARA 5F3TA 5KT6A 2JEIA 2UU9F 3IC1A 1K44A 2IVMA 4OYMA 2JC0A 2UXBJ 4TQRA 3GCXP 1Q8BA 2EG1A 1U45A 1LK5A 4KE5A 2UUBJ 1FXDA 2F3JA 5THWA 4I7FA 3UDEA 1MMLA 1RLCL 2BRKA 1M1GA 2GNKA 1E6VA 1S57A 2V68A 4NA2A 3M7VA 4Y0FA 4CNZA 4PWDB 2BYCA 3GYXB 1TELA 2VIHA 4QWAA 1S0NA 2R7VA 1UPPA 2KB2A 2IDEA 3GMGA 2QFJA 1R0AB 1XMBA 1K0VA 5HLFB 1PCAA 1C0TB 4RL1A 2C22A 4ELVA 2ZBRA 4DR7J 2RF2B 4EU0A 4IOCQ 3I55S 3IRWP 4QU6A 2ZITA 3D66A 3P3DA 2F8HA 5BYRA 1N36J 4O3RA 1NZAA 2Z2LA 2MB0B 4LQ9A 2HRTA 2DRDA 5HQLA 1XNQJ 5IV3A 1M0SA 3CD7A 2ZD1B 3ZZYA 5ADZA 1FKOB 2RUGA 4B3TF 3IR5B 1QRTA 1FX2A 1UP1A 2OEJA 3GWCA 4B9VA 3M32A 3SYZA 1D3WA 1F9HA 2GAGC 1CJTB 3PIOS 4WJBA 5D78A 3RG6A 1S49A 3ZNUA 3ADAC 5HQ8A 4IH7A 2AD9A 3GONA 3OHBA 2YTCA 3HMJG 4DR5F 2HFOA 3J7A1 3W63A 3H59A 2AEJA 2IBOA 3H90A 4P72A 2J7UA 3F44A 2VBWA 2PA3A 4JI3J 1RKIA 4L72B 5M2UA 1MG7A 4J9NA 5H9FK 1O0PA 3PTWA 2VJVA 4AE5A 2M88A 3TR5A 3Q8VA 3M8SA 2UXCF 3KNAA 1KQFB 4LF6J 3DLEB 4RW4B 1RAHB 5J2QB 4IG0A 1P6TA 3OUYA 3OL7A 3HVTA 4RBUA 1RWUA 4OX7A 4DV2F 3M2VA 5ETKA 1VC6A 1TFYA 3TZXA 2CPFA 5M2RA 4JBCA 1UJ5A 1C4CA 3M6XA 2RH3A 2OPSB 3AOCA 3OTBA 1IWGA 3OR2A 5KFSA 2CWXA 3M6VA 2MKYA 2W4PA 3M1VB 4DS5A 2J9CA 3CJQA 3Q86A 4LUBA 3UD4P 3OXFA 4IG3A 1L3KA 1URRA 2CNNB 2JOQA 5KFIA 4RUCA 1X4EA 3LP0A 1RJJA 2QMWA 3S7RA 2ZH8A 4K4ZA 4FYDA 4MK8A 2IJNA 4NXMJ 2PMHA 3M8QA 3AY0A 3KG1A 1IR0A 4E2FB 2FJAB 2BZ2A 2FDNA 3ZTOA 3TJAA 4HLBA 1LOUA 1WKLA 4LR7A 3TI0A 5KFCA 4U6PA 2DNHA 3EVOA 3KUHA 1W25A 4OZ0A 4F26A 1GTHA 2VA2A 3C16A 2VD3A 2ZNZA 3IS9A 3LO3A 3HVRA 1NKBA 3K5PA 2YWFA 4L76A 2CJKA 1UVJA 1UVMA 3G87A 5B7WA 3BO2A 4YB6A 3CD6S 2FLOA 4M8LA 2PMZD 5GAGU 4JI7J 1VDHA 2BKPA 1M90T 1IKWA 5D3GA 4P74A 4X4UA 3KJVB 4X2BA 1WEYA 2CQBA 5C42A 1MNEA 3PR4A 1XN9A 3C6TB 2CPYA 4KGVB 2PA8D 5K9FA 4V19X 2G0JA 3RAQA 1UEVA 4QWCA 2ALYB 4IG3B 3VAKA 5CCLA 1HHTP 4O3PA 2WVBA 3AD7C 4WZMA 1ZPWX 1REVA 2HLUA 2JRSA 2XMTA 1CQMA 1HNXF 3NAHA 2HAFA 3MPDA 3QNWB 1H0HB 4DPXA 2VBZA 3MM7B 4C4WA 1Y11A 4ANDA 3PCOB 4DR6J 2IIHA 4HI1A 3WC2A 1QUPA 5E2QA 2RQCA 2UVRA 5ITHA 3P5BP 1SIWB 4QYRA 4CTAB 1WHWA 3DM2A 5EN1A 2BA9A 2F40A 2VFVA 4C0OC 1Z2LA 3H2LA 1V9OA 5C2CA 1WHXA 3MURP 2H5IB 2J6TA 2IM1A 1WC0A 3RW6A 3MEDA 5B09A 1G7CB 1UTAA 2K06A 2KG1A 3TARA 5T41A 5T7LA 1REGX 2W9AA 5B0BA 4ZN3A 3DLLQ 5KFNA 1FEHA 3HD2A 5A76A 1RP5A 4LQ3A 4CI0B 1RISA 2IAJB 2ZH3A 1VRQC 2F4FA 4E8BA 5CH7B 5K8OA 1SJ1A 4K4SA 2DXDA 4YHHF 2KYZA 4ZCKA 5IC4B 3PW7A 2QO3A 5KT4A 4U7UK 1WC3A 1W26A 1HR0F 5KFQA 2E44A 1R43A 1T0TV 2NXJA 4L3KA 4DR3F 1OY8A 3J80U 2YX7A 4PG8A 5SZTA 3AT1B 1XC9A 1KC8T 1RHMB 3MOZA 3T3FA 1BY9A 3FBBA 3PO4A 1UW4A 4DPWA 1VQ4S 5IT4A 5L1LA 1JLQA 2LU2A 4KIAA 1KTVA 1U2FA 5KG7A 2P9CA 1OQ6A 3T5HA 3DRRB 1Y5IB 4X4PA 4ED0A 3M4XA 4B3MJ 2CPJA 2HHXA 3J7ZT 4YN3B 4J9QA 1RCOB 1SJQA 1D6KA 2E66A 3HXMA 1H6KX 2DHGA 3AD8C 3B6BA 1JXLA 4DWIA 4Q0BB 3HFKA 1LWFB 1WC1A 2CQ3A 3BREA 1OIAA 2CUYA 3QSYB 3CMQA 3R3TA 4F02A 1HLWA 2ZE2B 2HQCA 1TK0A 4DL7A 1TAQA 4ZMMA 1APSA 2FZCB 2IRXA 3MMCB 1KBRA 2CPEA 2DY1A 3AFGA 1U2CA 3BH6B 3OL8A 3CZBA 1KNZA 3MEGA 3MEEA 2F5GA 1YVFA 2W1BA 2J8AA 1OPZA 3POTB 2CQ2A 5GAGI 4P10A 3PW0A 4JI0J 3C46A 1R8CA 2HAIA 3SQGA 3UR3C 1WDTA 2PMWA 2RRAA 2Y8WA 2HMIA 2EFGA 4L6V3 4JV5J 2R7TA 2AP6A 5H9FJ 5KFBA 2AE0X 2EEYA 4QIWD 2ROGA 4IO9Q 3D1HA 1VQ7S 3CJ2A 1JQGA 2DY9A 3DRXA 3EXCX 4LVNP 4R5PA 1GX6A 3QGPA 1JLFA 4N5SA 1ZETA 4OJHA 3OSNA 4QBUA 3C2PA 2MKCA 2I5JB 4I64A 4WFYA 4AD6A 3UW1A 3D0GE 3CDAA 3O44A 3FCWA 4TN2A 1VOMA 2YQ0A 2ZH4A 4USWA 2XM3A 4Y2MA 3EPGA 3X1LB 2L9DA 2J0XA 1OYEA 1YKWA 2ZBQA 1KONA 3W5XA 2M4MA 1VMBA 2XZDB 3D0IE 4CO3A 2OMOA 3W2WB 3QZ8A 3MFHA 1YBUA 1FRMA 2G1HA 3N5BA 3UR0A 4FN5A 1IR1A 3EDQB 4G1PA 4WTYA 1T05A 4NZ0A 1RTIA 1FVSA 2M52A 4URGA 4K4TA 4I2QB 4NPOA 3LAMA 3C15B 1T05B 4GKJJ 1XMOJ 2MLYA 4DV6F 1NK0A 2V2VA 4NA3A 2WAQD 1IBKF 3CEDA 5HVFA 1RU2A 2HZAA 5G0RB 3ONQA 4FNIA 3W3SA 1C0UB 2EVZA 3DLKB 1JLFB 1NCLA 3BEGB 4JV2A 1HNWF 1IKVA 2QE5A 1CC7A 1F2HA 4C6AA 2HQIA 3MPVA 3FCHA 1S6PB 1IKVB 1Q81T 3GFYA 4M5MA 2FY1A 3I0RA 2CPZA 4ZVFA 4X4SA 3QATA 1S6PA 1R6VA 4B9TA 1RT7B 2KFZA 1RUSA 3LPYA 4O3QA 3QFWA 2N4DA 2X51A 3CCJS 2KM8B 3WIUA 2VPZB 3ILLA 1QTNB 1GMUA 1YG0A 2QSFA 3ENQA 4FZVA 3UD3P 3HVTB 1IKWB 2XBPA 1S7IA 1S59A 1BGXT 3BB5A 3CJSA 3OPKA 3T19A 5BXIA 3TEGA 4BWMA 4J9LA 3G6YA 3C6TA 2HHVA 2CVIA 1T9VA 4B3SF 4DDFA 1TKTB 2GIQA 3E01A 5HMZA 2Z2ZA 1WHYA 3PYFA 2BDPA 2ZOFA 1S6OA 3L7PA 1C4AA 3Q83A 4TVAB 3R9LA 1HQUA 2BANB 5KFAA 2FJVA 2EKNA 3A8IA 4F7VA 3P45B 2FVPA 4DQPA 3IR7B 5A8WA 5D8HB 3BF4A 3V4IB 1WKJA 5G4DA 1NEEA 4J9KA 1JWWA 3IWLA 2FY8A 5DGBA 4HDHA 4IFVA 1C1CA 4CWBA 3THTA 5K8MA 4DX5A 3W9HA 2VFTA 1PJ5A 3CDUA 4F0HA 4ZDNA 1N5YA 1I94J 1DHMA 3A3PB 4M5DB 3GP9A 2D3UA 4QIGA 3JYTA 2ZHBA 1BQXA 4MKVA 3FQLA 1B70B 2ASYA 2DBBA 1RCXB 2CPDA 1H73A 2LQBA 4O3OA 4XTTA 5IFMA 5I42B 2E5LJ 4AL5A 2AJ4A 2KG0A 1NK5A 2HFSA 1GFWB 2MJNA 5B0FA 3OV7A 3CC4S 2W2MP 4L3NA 4ELUA 4FXDA 4CZCA 2P8IA 2P9GA 3VVUA 3ILJA 4HR2A 2UUTA 4DV5F 5AE1A 4QCLA 1XWLA 3BSOA 4Q43A 5HO4A 4O3SA 3H98A 2HQGA 1N34J 3QRQA 2DH9A 2QA2A 1YIJS 1FJGJ 2QYGA 3G6XA 4QOTA 4HTIA 4DR4F 3AJ2A 4DR1J 4OYPA 5ETOA 3U1MA 2OUGA 4JI6J 3LQVA 2QL7B 4IUFA 4CH0S 2J7WA 1VQ8S 3GE9A 2X3GA 4RNFA 1FCAA 2F9DA 3W1YC 1RA7A 3MD1A 2FIUA 2YKNB 4P2BA 3ZC4A 1FWKA 5L38A 3THPA 1YBAA 3WX8A 3Q23A 2LECA 2UP1A 4W92B 2V2ZA 3FSYA 4WCES 3EWGA 3O6QA 4IR9A 4KYZA 2BE9B 1PJ6A 1OSCA 1PAUB 4C8NA 4CTAA 3M9OB 3CCRS 2M9KA 5F0UA 4RNMA 3PFEA 4DR2J 1UWBB 2P5VA 5E3RA 3TAMB 2OELA 2RSQA 5L9NA 3MR3A 5L1IA 1CS4B 3CDBA 4QR2A 4PABA 2FJEB 4OYIA 4QW9A 5LM7E 4M94A 3DN9A 2B5JB 3ILIA 5L8RC 2PJJA 1U02A 1NXIA 2E7VA 3ISZA 4C7QA 3UVJA 3KK2A 2W8LA 3QJLA 1LWCB 4GKKF 2ACMA 4OLOA 1N0UA 3E3XA 1X5PA 3KHGA 2V34A 3KJNB 3DOKB 4YY3J 1G2EA 2NQPA 4HH1A 1RTDA 1FFSB 5LMUF 1UVLA 3KXDA 3C16B 3H2VE 1I6JA 3KYLA 2IBKA 3FEZA 4QJVA 4E8UA 2R7QA 5B08A 2RAQA 4BS2A 4KGKA 5AT1B 4E98A 3KLGA 5IM0A 2E9ZA 2P2CB 3JSMB 1RWKB 2RE8A 3H7HB 3DOMA 2PFDA 3OJUA 3RB4A 4ZVTB 1S0VA 4P52A 3PHEA 3OTOJ 3MD3A 5CYMA 3TJ8A 1PYOB 3FMBA 3VVTA 5KOWA 3GSDA 1UFWA 2VC0A 1NDKA 2G2ZA 4CO2A 2BACA 2Q43A 5IOLA 1Q53A 1TMMA 3OVBA 1AROP 4PXBA 1NH7A 4ZIWA 2OH2A 2I6WA 1EKSA 1SL1A 4MTPA 1GMVA 2DB1A 1NU4A 2L9NA 4LRCA 2Y1IA 2L41A 3D0HE 2HFVA 2D9PA 4ZA1A 1N34F 5KFVA 1R0AA 1Q95G 3D1QA 2KVQE 4PPDA 2V4JA 3KG0A 1JNZB 1F9FA 4ED4A 2X1AA 1N54B 1C0TA 4A8YA 3BH7B 4MAKA 3OR1B 2AJ0A 3W9JA 2ZH5A 2HNDB 5K14B 4W90B 2LQ9A 3VWSA 5KT3A 4CIOA 3J7Z5 2YNGB 1GTSA 4H4KA 2WBMA 2UZAA 2NYHA 3EVWA 3PRBA 4LBPA 3T5JA 1VQNS 3ILOA 1Y00A 3MMBB 5HJYA 1TUVA 2NUUG 2D3OR 3POTA 4LRDA 1FRHA 2QZ8A 4OZ1A 2MEWA 2NUHA 1BE4A 1PKUA 2FPHX 3SSQA 2QV6A 3OQ2A 3GCWP 3SXLA 1K1QA 2RNEA 3F0NA 4XIUA 5GMDA 5MAOA 1MMNA 4PEOA 2MKJA 3BSAA 4LFCJ 2KO1A 4K5SA 4I6WA 1U1PA 3FZ2A 2AF6A 2QFIA 4K0KJ 5GAHW 1QRUA 4J90A 1N88A 1V3SA 2ERRA 2VBXA 3FSXA 1LQ9A 5J1EA 3IXQA 1L3SA 2VFSA 1RT2B 2G6GA 3TW0A 2XGQA 3NLCA 1QAJA 1AB8A 1FE0A 2E5HA 1B4SA 4Q2LA 4YOEA 4CLUA 3A3OB 2AV5A 4ZJOA 3G9CA 1UEUA 3TVYA 2MZTA 1NPKA 4DSIA 1K1SA 2O66A 1U26A 2DYAA 4CYUA 2RIJA 4WYLA 4B3TJ 4WBFA 2QEXS 3W7BA 2R7XA 4WU3A 4C11A 1HI1A 3PX4A 1F3FA 4CYUB 2QL9B 4K7QA 1XR7A 5D4NA 4LSLA 4P7VA 4FKYA 2O01C 2DIVA 4ZJLA 2OFGX 4USUA 3OR2B 3CDWA 4LSLB 3TX8A 2BQRA 1C2PA 1NJXA 2VOPA 4DMZA 1LWEA 2H1YA 1R89A 4ECVA 4GKKJ 4PQUA 3J7AN 4NLWA 3MWBA 2NREA 2RILA 2HZ7A 1HBMB 1ZM4A 1PJ7A 2B8PA 2KI2A 5LXRA 4NYOA 1L5UA 1RT3A 4R8UA 2DR6A 1BUXA 2DHXA 2JLEA 3D3CJ 3US5A 1M5VC 1VQKS 1WNEA 2QA4G 2R7RA 4DG1B 1QAYA 1I5OB 1SB6A 4LF2A 4LF5F 3K58A 4PG5A 3NGRA 5LJ3Y 1CJKB 2MZJA 2XS5A 1D8ZA 2XSJB 5HAOA 3T1AA 1N56A 4DFJA 3D67A 5MLCV 1KVJA 2HHHJ 2VBYA 3QSIA 4B9UA 2H9ZA 2AZ1A 4CLZA 4KGMA 3KJFB 4DUZF 2VDHA 3H42A 4TLRA 2GA7A 1CULB 3R7SB 3G4SS 3TANA 1ZTTA 4EZ9A 4DUTA 1SPBP 2F4VF 3LGNA 4U7CA 2IMOA 3VAGA 4N76A 1UAWA 1VISA 1Y3JA 3CD5A 4JB8B 2BOAA 4MFBA 2DJWA 3LWLA 3PDNA 1QTMA 3FZBA 2KTQA 3GIKA 2MZSA 3IRXB 2MY8A 1DFUP 2LA4A 2MZQA 3QMQA 5LSRA 4DV1F 5J1PA 2O3DA 5HROB 4NXMF 2HFNA 1I3OB 4ZPTR 3R97A 5KFRA 4BC7A 1CJVB 1NXZA 3NXZA 2KRBA 2V9WA 1DURA 3S6EA 2LYVA 3NP5A 2XQCA 2LQ5A 3LW5C 3P4UB 3QFHA 2AT1B 1WC6A 2C3UA 2W2OP 4ZOSA 3OVAA 3PW4A 1N32J 2EFPA 1H38A 5FLXU 3KHRA 2YQ1A 1Z85A 1JLAB 4KKOB 3EGWB 2CJXB 1HFEL 2P9EA 1YK9A 2FD2A 4EUVA 5DQIA 2D3O1 1RXOB 3IMQJ 2Z0GA 3CULA 1PC4A 4EK2A 1HNVA 2IDLA 3IN5A 2HZCA 4JP8A 4FDFA 2W9CB 2EKYA 2VFRA 4F3OA 1R6YA 5F8HA 2HS3A 4NA1A 4Y65A 2BOPA 3W65A 2XZWA 3GFZA 4I0WA 3J81Y 3EGZA 3I4HX 1XK8A 3NBPA 3UO0A 3SI8A 1YTYA 3DDNA 3IA0A 5EHHA 1NK7A 2HNZA 2F8MA 4A47A 4X62J 1N33F 5KFUA 1ZAXA 5I3UB 3MAQA 1TFWA 4K4UA 3DMJA 3TZWA 3QT8A 4RNNA 3CCTA 3DGVA 3V4MA 1S4EA 5H9EJ 4YR2A 3IBCB 4F0KA 2DEIA 4FBTA 2QIFA 2RQMA 5ETTA 4X65F 3C14B 3C8YA 3RYLA 4AXIA 2RKIB 1LW0B 3D6TB 1F5BA 3I0RB 1UMJA 2CQ4A 4ZVSB 4NEZA 1D9FA 4X4QA 1VJWA 4BHQA 3HT0A 4C0BA 1L3VA 1URNA 2CDRB 2BJ9A 4YS2A 3JB9k 2I8EA 6FDRA 1NLKL 1WUUA 3R7BB 2LLZA 4U95A 3D2WA 2C2RA 2NSCA 1ZPVA 3R2DJ 2WK4A 2QLJB 4NRTA 4GKJF 2B9XA 3AOAA 2E1CA 3PY8A 1FDAA 4Y34A 1R0BG 2CRLA 1S1VA 2QA4S 3TRGA 4OL8A 2W2PP 2ZFHA 3B4DA 2MKSA 3Q8RB 2X1BA 3MEDB 3MCNA 3IWXA 4LBHA 3MPWA 1XJWB 2B9EA 1KDNA 3VTIA 3BSCA 1EX8A 1ZBTA 1NAQA 4NZ7A 2IRUA 3U7JA 6FD1A 5HN0A 2RS2A 3M8YA 1KS2A 4KFBA 4ES2A 5K8PA 1NJIT 4RU2A 3OHAA 1HIYA 1WTBA 2FHOB 1CLFA 1IKYB 3T5LA 1JLEA 3DU6A 2DKOB 1RHUB 2D9OA 3ZZTA 4YEAA 2P6SA 3BYRA 4USJC 3L7OA 2J9DE 1YSJA 4NWBA 3R8YA 5JXSA 5D4LA 4X4OA 1UW9A 2A6MA 2APOA 5BNZA 3U02A 2CDQA 4C8ZA 3UDLA 3K8WA 2BJEA 4DXLA 3MR7A 3VF0B 1AZSA 4DF8A 3WBZA 3GJTB 1EQ0A 2B9WA 1RTJA 5D4PA 3AHPA 2K1RA 2FUG9 3FUYA 1HHSA 1HWIA 5IQ6A 4DSLA 4IDKB 3GIMA 5JVHQ 3J7ZV 3NS5A 1HPZB 3DLBA 2BW7A 3E51A 3K5OA 5IC6B 2DPIA 3GV8B 1FRKA 1HPZA 1RQ0A 2YWEA 3I5CA 4OLPA 2YNIB 2LDIA 2BABA 1XEZA 1TUWA 3WZ0A 3W9IA 2Y8YA 3LGHA 4EYIB 1FNXH 3PO5A 3C6UB 1UJ6A 2JLFA 2PEHA 2X3DA 2VKRA 3HHEA 4YQWA 5KT5A 5KG4A 5AE2A 3MPYA 1S9GB 3KNGA 1VQLS 3D28A 3AXKA 2QMXA 2D41A 1IVZA 2WONB 2HGLA 2JDJA 4LF6F 1MWYA 1X4GA 4O44A 1EIYB 2UUBF 3PFOA 4PWWA 4DJBA 3OXGA 4CLPA 4MIAA 1FDDA 1C1BB 2GCFA 2EG2A 1RTZA 2VG7A 1UVKA 3OFHA 2XGPA 2IJRA 1C1BA 4MKYA 4DPYA 2KZMA 1UL3A 2DHSA 1AT1B 1OS5A 1KQSR 1HNIB 4K50A 2W4CA 1HNWJ 2X1FA 4YHHJ 1B3TA 4U67S 4HTJA 3QRRA 2AJ2A 1FXLA 1F5CA 2OO4A 3TA2A 1N6QB 3CUNA 2XB2D 3EM1A 3IGVA 5JVGQ 1FI4A 1U6ZA 2HK2A 2YKPA 4M5KA 3KK1A 1HYSA 1NH8A 1S9GA 5CAAA 4ED5A 1UEKA 2FGOA 2HSEB 3CT9A 3JQMA 5HI7A 4CP5A 4DS4A 4LJMA 4LSNB 1HYSB 3W2WA 3KHLA 4NLQA 3VQTA 2VPWB 2QA1A 5D0GA 2H5EA 3GV5B 3CCES 1YJWS 5I3PA 5DQGA 3H5SA 2AGOA 1PYTA 2ZD1A 1WG5A 3BDPA 3IM9A 4IYQA 3N9UC 1RZMA 2H3EB 4JI6F 2ALZA 2VASA 1JLBB 4QW8A 4A46A 1CJUB 1CJTA 2LXIA 1OO0B 3MECB 1NYLA 4UOHA 5E3AA 5AJ3F 3UCUP 3GG0A 5K5MA 5ETNA 4YR0A 1H2UX 2IYGA 3H5UA 3MUMP 5KAKA 1FTCA 3NAIA 3DRSB 5I4MA 1RAGB 3ISND 2EK1A 3LANA 3R5BA 3EGVA 5HLFA 2QLWA 3JSYA 4DV3J 1KVIA 3SCJE 3GJQB 1BQMB 2PICA 4B3RF 2M5YA 1TV6A 2C3PA 5LMNJ 1N5QA 2G1DA 2CIMA 2LQ8A 3HZEA 3M2RB 3BDEA 5CZXA 3HJFA 2AJ1A 2OGUA 3U1NA 2MDAA 1HNZJ 3CJ5A 4JI0F 1FJ7A 4OX6A 3BGLA 4OJGA 2U1AA 4USVA 3SIPB 3SDEA 1AA1B 4K2XA 1UDXA 1QE1B 2XHWA 3S8SA 4F3QA 3PEHA 2UU9J 2QJ3A 2WSFC 1WWHA 1CQNA 4I2PA 1UA1A 1BD6A 1JNRB 4ZP8A 4WFAQ 5KG2A 4B3RJ 4I2PB 1FNOA 1IBMF 3GIIA 1GH8A 4DV4F 1NO8A 2E5GA 3LP2A 2FYXA 4J5OA 5KTQA 4P75A 4X4TA 2AMCB 2QG9B 3OLBA 1F1BB 3UQSA 1YRTA 1BQMA 4LRAA 3LA0A 3MM7A 4DV4J 4NCGA 1ZH5A 1IWAA 1JLCB 1YJTA 2BXJA 2KN4A 2MKHA 2PE8A 3M2RA 5AXKA 4O23A 5D3GB 4FBUA 4WF9Q 1WG1A 3MFIA 1RWMB 5DDOC 1B7FA 1XR5A 1P9YA 1X60A 2C3YA 4EO6A 3MMAB 2ZZTA 4DOZA 5DLFA 2DNGA 1WEXA 1TVRA 4C8MA 1RDRA 3V2UC 4JXZA 3JS9A 4C48A 1BWVA 2HKEA 4NLGA 3KG4A 2R7SA 2DGWA 1DY3A 1JJHA 1VQPS 1HD1A 1FA0A 2CJBA 1M1KT 3MM5B 3KLFA 4G3IA 1DLOB 2DHAA 2G5DA 2MQLA 4IFYB 1G3OA 4UW2A 2E7WA 4F36A 2ZH1A 2C3MA 1WACA 7FD1A 5JVHS 3Q8PB 3PKMA 4CM0A 1RKJA 2XSJA 3O2IA 3IAM9 4LF7F 3U27A 2IM3A 2J7KA 2MTLA 2VG5B 4PXEA 3R1HA 4HEA9 4L74A 4Q0BA 1YWXA 4X64J 1VQ9S 1TKZA 3H4BA 4GO7X 3GG1A 1T94A 4KGZB 2KH9A 5J2PA 3H25A 4OZNA 2V4RA 4LFBF 2UXCJ 3DOMB 2K8GA 2NYIA 1YJRA 3NS7B 3VAMA 3FMWA 4EZ6A 3NCRA 5GADI 1FEEA 2BE7D 2XY7A 2GO8A 1DBDA 1HI8A 4TY8A 2DH8A 3NOCA 2RD2A 2ABYA 3PG9A 1KQGB 2J0SD 1LNQA 1CS4A 3TZZA 3SZ2A 2XWYA 2ZH6A 3CCVS 1N5VA 3DHWC 4IFYA 3MM6B 2HIQA 3G82A 3UNYA 2GS8A 3Q2SC 4Z37A 2BBEA 2C2MB 2DGOA 5FD1A 1ZM2A 2DNOA 4U96A 4O0IA 4M5LA 3G82B 4QQBA 2XYHB 1E6VB 2JLGA 1DTQB 3EICA 2A2CA 4LF8J 3PZPA 1ELOA 1X31C 3J7YI 1VRTB 2V6AA 1Q79A 1HMVB 1UKUA 4N47A 3TA0A 3KMSA 4ZHRA 3AJDA 1I94F 1M5PC 1Y5LB 5F8IA 3C6UA 3GFXA 1QDUB 4F04B 2UXDF 3OTEA 2ZE2A 5KFWA 2IC3B 2CKWA 2FB0A 2ZEJA 3TUZC 2NPIA 1VQOS 5IM0B 4DQSA 3MAAB 2X1GA 4NLUA 3SFGA 1U09A 4HACB 4ELTA 1DARA 1A6LA 3RUBL 1S1TA 3VV2B 1RT5B 2OI2A 1GXLA 2ASJA 2Z2YB 2HNYB 4LR8A 1F6TA 3PIPQ 1RB0A 3CTRA 4P6QA 4JOUA 4UQTA 1YZ6A 2GMJA 3FEYB 3Q8YA 2KT3A 4OYOA 1EHWA 5DO2A 1ULRA 3LWMA 1OWXA 2BQUA 4CO1A 1TL3A 4ZLLA 1WC5A 4UZBA 3AOBA 3ZZOA 4ZCMA 4DUZJ 5DGAA 2XLKA 2OJ3A 4R5PB 2WOMB 3ZTPA 5D15A 5KFKA 3SEOA 4IQXA 1TL7B 1SH3A 2GJFA 2KXFA 4DL0C 4EI2A 1SKWA 4HH0A 1VC5A 3OR1A 4XDCA 1AYEA 4C11B 1NM2A 3HKZD 3LP1B 4WP9A 3UWTA 3ZO7A 4WFBQ 1M5OC 1YBTA 2XNRA 1EETA 3OUYB 3NG8A 3UN5A 2H65B 4EO8A 4OZLA 2VB6A 3HULA 3H0PA 1YJ9S 1S1WB 1A0OB 1RYRA 2H54B 5B0DA 4NLTA 2UVVA 1MW7A 5KFDA 5KT2A 1N0VC 4WFZA 3SQOP 2Q1LA 3C15A 3P8BB 4USTA 4K0KF 1K0TA 2RDIA 3QLHA 3QWUA 4DX6A 4DG1A 1YZ7A 5L1JA 2KT2A 2M0GB 5LMUJ 4DR5J 3ISNC 1U0HB 3DOLA 4IRKA 1X9SA 2K7KA 3M8QB 5A8RB 1RWPB 1UPMB 1S9EA 4P2FA 4G65A 1KOOA 1E6YB 1N5SA 3J7YU 1JJCB 3GLJA 3RB6A 1UVNA 3UCZP 2J6UA 3KLIB 5KG5A 1NK8A 4CO4A 2QT7A 1VQSA 3QAUA 4CLSA 4KTQA 2CFXA 3PRDA 1ZM3A 4YFUA 3IG1B 5SUHA 2RDJA 4RBVA 2VQFJ 3WIVA 4CLLA 4F4XA 2HHQA 3M8ZA 1K9MT 2YQ3A 2VONA 2BE2B 4RZRA 3OLAA 5C42B 1SI9A 1FF2A 5DM6S 4O0NA 3BR8A 1P1TA 2DO4A 3AB4B 3DYAA 3BM7A 1N4LA 2BE2A 3SSRA 5BJRA 1JKHB 3ULHA 1XTZA 1LXJA 1S6QB 1V3ZA 2M70A 4M5HA 2RU3A 4ECQA 1SQFA 1CJUA 2CNLB 2LA6A 2XMVA 3DLKA 3GR0A 2OPQB 1EKRA 1WELA 1B75A 1TMJA 2YNIA 1FRLA 4P73A 3E01B 4XAKA 1XNQF 2ZNYA 4B9NA 1VK3A 4R0JA 1O0BA 3CCLS 2H4WB 4CM2A 4LFCF 2CJAA 3HPOA 2MQPA 4N77A 2HIYA 2XO7A 1HNXJ 1VLOA 3LGMA 4PG7A 4PQAA 2J76E 2N7YA 3VALA 2D69A 2YKNA 2E1MC 3R5DA 5J2NB 3WC0A 3L4BC 5RUBA 3PJ9A 5DDPC 2H48B 2R2RA 1FT8A 2CZ4A 2PD1A 1X4FA 4GVBA 4GC6A 3BBBA 3BR9A 1GXUA 5GAEU 9RUBA 3T1YJ 3NGUA 4NEYA 2OP5A 1JKHA 1KWMA 4OV1A 1J5OA 5HROA 4OHZA 3EMTA 2ATLA 3OL9A 1NDPA 2FJXA 4HHUA 1SXLA 2B5JA 2GV1A 4ED8A 2X7IA 4X4NA 3OFEA 2QRRA 3H40A 3AQOA 4ZPWR 4R25A 5F8LA 1FK9B 2G0CA 4X65J 1U1NA 1D09B 4IOCS 3HX9A 4RU9A 2RRBA 1KTQA 2H4YB 2RJZA 1C1CB 2LMIA 2MPUA 4UY8T 2PFFB 2M3DA 4GC7A 2DK2A 1RACB 3EX7B 3AIIA 1RT1A 1X4HA 4ZLPA 1LV5A 1KFDA 4NI2A 2B6AB 4GRSA 2DHHA 2KJVA 2RHQB 2DNMA 5LJ5Y 1ITPA 4S0MA 4LRFA 4RLEA 3N6MA 1RAJA 3N5FA 3NBPB 1A7GE 4I69A 4NYZA 3VAFA 2Z30B 5HP1B 4LT6A 2GO9A 4IRCA 1OSDA 1HA1A 1X4DA 3DRRA 3M32B 3PW5A 5FJ4A 2A0FB 4PKDB 2B4VA 2J9DA 2BMBA 1SJRA 2L08A 4ZPDA 5KFMA 2HW3A 2Y1LB 4YB7A 3ET6B 3W2VA 1LW0A 4DV7F 1G1XA 3UVJB 4KV8A 4A8OA 4ECUA 1YRUA 1RT4A 2ZWOA 2HHPA 2WRMA 4H4OA 1N5YB 2GVZB 1RT4B 4U67Q 1QRSA 2R7OA 2BJ3A 4KR0B 2H51B 1FKPA 3K2YA 2WVCA 3SV4A 3C19A 1QM9A 1T95A 2Y1JA 4IKAA 2AJQA 2W2NP 3DRPB 4UOGA 2B7BB 2CPHA 3BPSP 1UWBA 3M30A 3PRVA 1T7PA 1B7YB 5LT5A 3SQGB 4IOBA 4USIA 5FDLA 4LFAJ 4QPXA 3HI9A 4FYVB 1G6BA 2I9SA 3KLVA 4LF4F 4RW8A 3VZIA 3THVA 2A2DA 3BPDA 4ZN1A 2MQOA 1RAEB 4OZJA 4J9RA 1Q7LB 4CNYA 2YX1A 4DX8H 1NKCA 2DGUA 4JV5F 2R9LA 1FJCA 4ED1A 2GAHC 5DDQC 1S4FA 1VQYA 3V5RA 4DCJB 3TVKA 1IR2A 1FD2A 2GHPA 3OVSA 2Y3YA 3V6JA 2DCUB 1Q5YA 2MMYA 3LOUA 5IWAJ 1U24A 1FD8A 2ADCA 2KDOA 1SL2A 3LP1A 2Z56B 2KJWA 2XWXA 4DQQA 3MMAA 2OHDA 3GJRB 2UVWA 1EETB 3ZTRA 1NKEA 5LL6d 3D9BA 3W8GA 3M30B 4LIWA 3VCDA 2EGWA 3LH2S 4ID5B 4IQMA 4CH1A 1UA0A 1S10A 1Q8LA 2ILZA 3D6MB 4JI5J 3QGIA 1OY6A 3M6UA 3ITHB 4ID5A 2W9BB 4PZVA 3R5CA 4U9RA 1S1XB 2KFYA 3ITHA 2AWZA 2W9BA 2HRYA 2QSWA 3SMZA 1CEZA 4DL2A 1NPRA 5G0RA 3CSKA 4JI4J 1RAAB 3HHNB 4Q8FA 5KG1A 1NNDA 3DDKA 3LALA 1JLGA 1R27B 3TZYA 4ECTA 4WFAS 4FKXA 2GGPB 4QIFA 3EJMA 1G4CA 4FPIA 1RLDA 1V6HA 1CJKA 4CO5A 1Y4ZB 2KL8A 2FGCA 4PCQA 3CXCR 3QT7A 3KLGB 5FLXY 4F4YA 2EGVA 1T03A 1MROA 3RB3A 1U8WA 3AA8A 2AGPA 1UFLA 1KKHA 2YPZA 3MMBA 4OQJA 4D3GA 1OPIA 1WG4A 4ZP6A 5KT7A 3EZOA 2F7VA 1Q16B 5A2QU 5KFJA 2XMAA 2J6SA 1BQNB 4KJIA 3MM6A 1O51A 3DYAB 1XMOF 2YWHA 2E29A 4O4GB 2MLXA 1HBUA 5DS7A 4EBEA 4DR6F 4W4MA 4Z7YA 4ZPCA 3KK2B 1UCNA 2YPYA 3GQCA 4DSKA 3R7NB 1RHRB 3KDNA 1ZYQA 3TUPA 4OHWA 4PQUB 2HBQB 4ID8A 4B3MF 4EGLA 1YJ7A 3V81B 1HNIA 4TU7A 4DL6A 3Q24A 5HATA 2YNFA 3DLGB 3KLEB 1PO6A 2KFNA 1Q4RA 2ATCB 4YY3F 4ECWA 3VGUA 2K2PA 4WTOB 5GMKa 1RHQB 3GIJA 1X5OA 2FHKA 2FLNA 4WE1B 5DRKA 1T9TA 1VLYA 3KLIA 4ECZA 4HKQA 4NXNJ 3ETOA 2CG4A 3M9MB 3BGRB 4CO0A 3I82A 3O8WA 4AUKA 3J81j 4LVOP 1ZM9A 2AZ3A 3FDSA 3PNIA 1TP7A 5AJ3J 4ZK7M 3IR6B 2FLPA 3MCOA 1LWEB 4C8KA 1DQAA 1U1QA 5KFHA 1U6BA 1RWXB 3OW2R 2LP4A 4DQRA 2PN6A 1HBMA 1HW9A 1VBZA 1GTEA 1MLAA 4ES3A 1U1LA 1DRZA 1CJVA 3HHLD 3GYNA 5ETPA 4DLGA 1RT6B 2R3VA 1S72S 1MWQA 5A6PA 1B64A 3JQJA 1ZAWA 3FNNA 2KXHA 2JFDA 5GMEA 4FVCA 5JVGS 2OEKA 4ATNA 2QTWA 2DEJA 4MH8A 4NCGB 4WYWA 4HDGA 3PXGa 3I0SB 4NX9A 4ANCA 4RUBA 3R6LB 4PWUA 1JXEA 3TVZA 4RW6A 3RTVA 4ECXA 1QVGR 5J2QA 1V3RA 3KDOA 2QN6B 3HHKA 4WKYA 5J2NA 1U49A 1X4CA 2A1BA 2AYMA 5LSOA 4X4VA 2YKOA 5B0CA 2G2OA 1KLMB 1KOHA 3PYGA 4GVBB 4WXWA 4OYWA 5EX0A 5HQMA 4UUWA 4GO5X 3QLHB 3FJ2A 1UWAA 3UE2A 3BN7A 3P96A 1K47A 5KG6A 2LKZA 4Q7AA 2OPRB 2R7UA 2YNHA 4JI8J 4ERDA 1RTHB 3DGPA 1SKUB 2R4FA 2ZBIA 2I5JA 4OI6A 4PG4A 4C98A 1Q7YT 4IO9S 2Q66A 4JUZA 4JXXA 1RTHA 3DGPB 4UF4A 3RRGA 4KPCA 4M5JA 4WP3A 5KG0A 1KP6A 2B3TB 1VHIA 2HLTA 2JH3A 5ETSA 4TQSA 1AFIA 2DITA 3IBFB 3IG1A 2MXYA 2F1FA 4ED2A 4NLXA 2BM0A 3VAHA 2HHUA 4LREA 5HVHA 5E33A 2GIFA 3KWMA 3R27A 3P49B 2N7CA 5F9LA 4MK7A 2WB4A 1TAUA 4ZITA 3NRBA 4ICLA 2HQ3A 2BX6A 2V0NA 2BRLA 5HK4A 2V8DA 3AXMA 1Y7PA 3I32A 4CLTA 5HSPA 2BJ8A 4ZJQA 3RBEA 5L9XA 2LEBA 2NXUA 1FRJA 2LDYA 5E41A 3TAPA 2IFXA 1V6ZA 1HNZF 4J3CA 3CCWA 2XG8A 3QBCA 3MI7X 4YB5A 2EFVA 4DI6A 1HBNA 3R1LA 1FKAF 2LXUA 1R3NA 2YNHB 2W7PA 4IR1A 3C3LA 1DFDA 3V4IA 2YVSA 4D3HA 1FERA 4LFBJ 4BLGA 1O8BA 1X4AA 1JB0C 3OFGA 4NRUA 2C42A 4WPAA 3C66A 5KFTA 2Y1RI 3AH6A 3BGFA 3N4WA 2CG8A 2C2EA 1HNVB 3IP0A 1U7LA 3K5LA 4QZVB 3OSPA 5CABA 5CD4H 1GTRA 3F41A 3MAAA 1RU1A 2OD6A 1S1UB 3SCKE 5F8NA 1FFGB 3G2XA 1S1TB 4WIQA 2U2FA 2MHEA 3EVMA 2AEFA 1SJ4P 5DZ7A 1KD1T 1KRPA 1WKKA 1KHWA 4ED7A 4WU2A 3RBDA 3FGVA 2YKMB 1X0PA 2GVDB 4LF9F 4KAIA 5FDLB 1FKOA 1AZSB 1QAXA 1S1XA 1TKXA 2V9KA 1RE1B 3AD9C 3KLHA 1NZ8A 2IVYA 5AXNA 5IT9U 1VYAA 1W7WA 2W25A 1TKXB 3IM8A 5D0EA 1QSYA 2HWHA 2DR8A 1YHQS 1Q5VA 1XMQJ 4UOFA 2A18A 1IBMJ 3Q8UA 4WK3A 3K89A 4C2MA 5F3ZA 2C2NA 1DTQA 1RK8A 2IAJA 1RWVB 2WOMA 3UN3A 1DJ0A 1H3DA 3A8JA 3CJKA 1OJ4A 1JLEB 2XULA 1GAOA 2CQ1A 3CF5S 3EXYA 1Q86T 4J91A 4K5RA 1N36F 1M5HA 2Y9HA 1WJ9A 2FC9A 4M5DA 4DV5J 3G86A 4N56A 3HP6A 3EE3A 3F73A 5F0WA 1U4BA 3MUVP 4F50A 3IAS9 4FYWB 3S1TA 2AIRB 3WQPA 5D6GA 4EBDA 1RADB 1Q0NA 4HACA 3T9ZA 2XLJA 2OPPA 4ZVRB 1X7VA 1S76D 2W2QP 2MKIA 3A12A 1MWZA 2DXEA 3PVXA 5D0HA 2MY7A 1R0CB 5GAEW 4DPUA 1AW0A 2XCAA 3AJ1A 3HO1A 2IMWP 4CH7A 4DV0J 2RVJA 5A8KA 5EDWA 1N32F 2XEXA 4X4RA 4CQ1A 1L3TA 2XMJA 3MEKA 1IQZA 1B99A 2QX0A 2AYBA 4FPRA 4M5NA 2HQFA 4OI3A 3ZZPA 4CDIA 3GILA 2JEFA 4H4OB 1JLGB 4RUAA 4KHRA 2E9TA 4J9VA 4F67A 1M5SA 1SBRA 2DGTA 2FHJD 2LVWA 4UY85 4Y28C 3JQKA 5C24A 4ETZA 2JZ5A 4PUOB 1S99A 4DUYF 3F56A 3ENVA 2DT9A 4RW7B 1TV6B 4I6AA 1O5JA 3H4DA 2ZDOA 4FF2A 2HS4A 1NK4A 4AQYF 3MEGB 3MEEB 4RW7A 4JYAF 2MQNA 4ED6A 1D1UA 4ALZA 1LXNA 2R2SA 4WFNQ 3HVAA 4WXOA 5DG9A 3NCPA 2B0GA 4XPCA 2CYYA 4I56A 4P71A 5A8KB 1SUQA 2YWGA 3FVYA 5ETVA 8ATCB 3BYPA 3VQSA 4ED3A 5H9EK 3CCZA 1JLBA 1X5SA 3UFCX 5CYQA 2IHR1 1FDNA 1EP4A 1WOPA 2QLXA 2RE1A 3MF5A 3KK3A 2R2TA 2CJ9A 4DL3A 4NCAA 3KOAA 1FJEB 1FTRA 5BR8J 1UZDA 1EXDA 4MT1A 3BJYA 2JHEA 3X3UA 1HL6A 1SH2A 1IBCB 2KYXA 3BBCA 3DLGA 3KLEA 4JI1J 1ZZFA 4C3LA 1FE4A 1T8EA 4KPYA 4F3MA 4LMZA 4RPFA 4WE1A 5DJBA 1TL5A 1WHVA 2KU7A 2Q6BA 2Y0SD 1T3NA 5J1NA 3G96A 1NB7A 4OYZA 1TZ0A 1PIEA 2ROPA 4JYZA 4B17A 4R0EA 5KFEA 2Q79A 5DG7A 2YKQA 3NEKA 1O0CA 1TTHB 2MKKA 2L3MA 1ZZNA 3CC7S 3RW7A 3ZTSA 4DR7F 2MGZB 3DLLS 3MUTP 1S0OA 1QVFR 1D0EA 1SQGA 2ZOGA 3I4PA 2ZVSA 3R2CJ 4I67A 1A9NB 2VF3A 2JFKA 4KRWA 3DNCA 2D74B 4M1KA 4KQZA 2O67A 3B82A 3MTKA 2ZJQS 1RT2A 2CQ0A 3CW2C 3D7SB 2HK3A 2DH7A 2KVIA 3HCXA 4IO1A 4LSZB 4TNOA 4CT9A 4F4ZA 2C3OA 5JUMA 1GMWD 3A8KA 4NLOA 4MJKA 4OX8A 3MM9B 4QIEA 3I87A 1KLNA 1R8HA 2OMLA 1NHVA 3PKYA 1TKZB 2RD5C 1MROB 1WI6A 5E0OA 1VRUB 3ICLA 4NI2B 5B0AA 4LSNA 2FJBB 2C2DA 2F65A 4JI5F 4HT5A 2G9OA 3TA1A 2IA0A 4ITSA 2M8DB 3GPAA 3OXLA 5HL7Q 4WIIA 2HVZA 2VFUA 2MQQA 4YB1P 4OHXA 2AYEA 2NLWA 2DNZA 2MYFA 3DFEA 3HKWA 1TU0B 1IM4A 3CJTA 1PC5A 3DM2B 3SDEB 3N6NA 4X62F 1S1VB 3DHXA 2MGZA 3EYZA 2W7OA 4DV2J 2CZ9A 4AXJA 2HZVA 5ETRA 3M1VA 1S79A 1YJUA 2WSCC 5IZNA 3K0JA 5H1SV 5CYJA 1YI2S 2HYIB 1NSQA 2DCLA 2DNYA 2WVEA 1NK9A 3BGUA 4OMFG 1XNRF 1RBAA 1P9QC 2QGFB 3N28A 2N4CA 2PGCA 3DRSA 2HPUA 3MAHA 4NLRA 2FHJA 3BO3A 4DV1J 4M95A 3I9ZA 5CZVA 3ZNJ1 4QR0A 2V63A 3R5AA 3W5ZA 4USMA 4N7TA 3T1HJ 1Q82T 7AT1B 3SFUA 1JLCA 1HHQA 5F8MA 4P7TA 2CPXA 3ETMA 4NLDA 1ICEB 2RMLA 3CIZA 2FJWA 1R8AA 1ACMB 1WF2A 3CGIA 2A10A 5GVQA 2HHHF 3D5MA 5JMNA 3JTOA 3Q89A 3KTQA 3PX6A 2XS7A 1F5AA 1GQEA 1WOSA 2V8VA 3BGOP 1VQMS 2GIRA 1Y9OA 1GK8A 1NK6A 1N8RT 1D8YA 4LF5J 3NWRA 3VGSA 2XC9A 1OMSA 3NMRA 3G71S 1LKZA 3GJSB 3MM8A 4UUXA 5F9NA 1GMWA 4LF9J 1AUDA 2O1PA 1CVJA 3Q2TC 4UOCA 4QWBA 1CSJA 2UV8G 2GQQA 1HQ2A 2WHOA 4MK9A 4DV7J 5EUHA 3TQEA 1HBNB 3LP0B 3SV3A 1PSDA 1ROFA 2CJQA 2K3IA 1HQEB 4OI2A 2GJ2A 4PPZA 1U48A 3MTJA 5CQGA 1JLAA 3CB4A 1VGYA 4KKOA 1RHJB 5HMXA 1QTQA 5IS2A 2ZH2A 4PG6A 3QYYA 4AT1B 4A8MP 1KFSA 2ZC3A 4MMOA 3BKFA 3WX4A 4A8KA 1TL7A 4EFAC 3CPWR 1TL1B 1FVQA 4LFAF 3HK2A 1JXVA 3V6HA 4NXNF 2DVIA 2OFHX 3FEXB 4PRFA 4DSFA 3GU0A 2R42A 2DD8S 2ZBCA 5HBMB 3MMCA 1QSLA 4F4KA 3IRXA 1FX4A 1Q78A 2E1PA 3ZZRA 5CD4A 3DC2A 3NY0A 1RT5A 3O5TB 4P2SA 5DZ6A 3UN2A 1VIOA 2DNNA 4XO0A 4C0HA 3A13A 4PR6A 3VZHA 3NCQA 1NPPA 4J9MA 4IDKA 4KHPJ 3GYGA 4FVMA 2RU9A 2OLWA 4I7FB 1F60B 2WSEC 2F4VJ 1T9YA 4FYXB 3TO8A 3ZZZA 1U0HA 4I6YA 1SKRA 1NSPA 4I4BA 4DZDA 5E3CA 2FLLA 4Y2AA 2NR0A 3PV8A 3GB0A 2ZM6J 5C7PA 2UUWA 4FNHA 4NASA 5KFGA 3JSBA 2W9CA 2E5LF 2CQIA 5JJBA 2HNDA 1VBKA 4ICLB 5K14A 2R7WA 5DM7Q 3RR7A 3D54A 4Y6IA 2YNGA 2YY3A 2ASDA 1U8SA 1ZAVA 2NXEA 4PYAA 3HHLB 2HBYB 2D1CA 3W5YA 1S48A 1PILA 3CWJA 3ZXWA 5IXUA 3PACA 3W60A 3QPIA 2R8HA 4USHA 3TX0A 2XMWA 1VFJA 3C14A 3ENWA 3GSIA 3W66A 1TL3B 3HLUA 3E2EA 1NRKA 3H2UB 2UUCF 1IXKA 2ZJQQ 3MOJB 2IJFA 1RAFB 3RBXA 1JMTA 1BXNA 3TUIC 2VUGA 2JEJA 2FVSA 1EQMA 2QMUB 1YLXA 4RW9B 3W8PA 4DX7A 4A48A 1OQ3A 1T9UA 2Z8QA 2XZTB 3A8EA 5D77A 2KZZA 7FDRA 3GIRA 5C25A 2WVFA 4J37A 1WORA 5K8NA 1T03B 1RT7A 4XPEA 1CG2A 4PXCA 3ENAA 4ZIVA 4YMEA 2DTJA 2SXLA 2V67A 4U7UD 2NZ4A 1P8GA 2E1RA 3RJMB 4I1TA 3MZIA 2K1RB 3OTCA 1QE1A 4ZVUB 3I5AA 5ETQA 1VJQA 1IM6A 4DFKA 3EZUA 4RJVA 4F4WA 4QYZK 4IH5A 2OD4A 2CQCA 2XHCA 2RDDA 5U47A 4BC9A 1VS3A 2HGNA 4HYKA 3CJKB 4OYAA 3V81A 2EFOA 3QIPA 2ZJRS 3MR6A 3TNVA 3BV8A 2AU0A 2B56A 2CXEA 3QWPA 3I56S 5IZHA 1H74A 2J9EA 2YNFB 2E5IA 3QGGA 1FXRA 5HANA 2Q6CA 4CLFA 3M2UB 4WCEQ 3DXSX 5KFFA 2XY5A 2VH7A 4K4YA 4C3KA 2QL5B 2PI8A 1UJ4A 1VIXA 4HL9A 2VQEF 4F4AA 4O44B 2QC3A 4RW4A 4KSEB 5HMYA 2J5AA 3Q8SB 2PDAA 2HVEA 3EPIA 1RTIB 1WI8A 3QAEA 4NLSA 1TR0A 3RRHA 3IFEA 4Q8EA 2AW0A 3PHTA 1U6FA 1IBLJ 4CLKA 3GV7B 1VHFA 2L48A 4NE9C 1NMEB 2VHGA 2V8PA 2BKOA 2HURA 1YITS 4HVZA 3BS9A 3MHYA 3NGKA 1DLOA 1TUGB 3SBMA 4ECRA 4B08A 4N8OA 4F2RA 1SVDA 2ZZMA 4OX9J 1BWEA 1HWKA 2EC0A 1WOOA 2ZBPA 3VGTA 1U1KA 4PUOA 1FK9A 4ES1A 4C9DA 4OX9F 2NPFA 2P6TA 3UDCA 1SKSA 4LF7J 2DNPA 2DRBA 2IVFB 2B9YA 1KSPA 2EPIA 1F0XA 3KUEA 2GVZA 1KN6A 4RW6B 1CULA 1HI0P 2C2KB 2VV5A 2XNQA 1R31A 1DTTB 1VC0A 1SC1B 3CCSS 2OPSA 2POKA 1JX4A 2D3ZA 5GADW 1CC8A 4KGXB 1GXTA 4ZPAA 3LUYA 2VG6A 5J2MB 2V50A 3K5NA 2R8IA 1GEHA 4JI8F 3FK4A 4C8OA 4L69A 2PEBA 4OIXA 4IOAQ 1RBLA 3FBFA 3FRZA 3L3CA 5HP1A 2RQKA 4O4RA 1TL4A 4A8SA 3N0VA 1X8DA 2NS1B 3OBIA 3TOQA 3PX0A 8AT1B 1HQUB 2NWAA 5HMWA 1NHKL 2ACYA 3OTOF 2BJ7A 2BEFA 2VPXB 4BDPA 3DKDA 3HM9A 2WVDA 1SQEA 1IQTA 3DI6B 4RUHA 4DFPA 2VG5A 2XMUA 1N48A 4M5IA 1NDCA 1OYDA 3HZGA 1LK7A 3PW2A 2BKNA 2HVHA 4DU8A 1RTDB 4ZVQB 2V69A 4YR3A 1UFKA 3CJRA 5LMNF 4TU9A 2B6AA 4A8XA 4OI0A 3D3BJ 4DV3F 3NKYA 2HHTA 4B3SJ 5C5JA 5HBMA 4F8RA 3HDSA 1RBOB 4ILRA 5DM7S 4DEZA 2KKHA 1VBYA 1FKPB 2XMMA 1SIZA 3HHDA 3TAQA 3IGNA 4OHYA 2DNQA 1CBKA 4J9SA 3D68A 3DRPA 3SCIE 3IBWA 4OJ1A 3LPEA 4NLPA 5E3PA 3UPFA 4FF3A 1F9EB 1H2VZ 4OFZA 4LIRA 4RBTA 5I3QA 3RU0A 5A2QY 5HJXA 1Y3KA 1ZJWA 3KFWX 1WC4A 5A6WA 2ZKUA 4Q2MA 4DPTA 3G8TA 4B3OA 3WDOA 1KVKA 2RKIA 4ZCLA 2VOOA 3PM9A 4DN0A 4L75A 2I1RA 1T3OA 5CHCB 3CO9A 3O3LA 4USKA 2GC8A 3R5JB 5EX3A 3K57A 4EEYA 1EARA 2CQDA 3T5KA 4MIBA 3M05A 1RAIB 3IO1A 1AUSL 4ECSA 2KHCA 2MHNA 2WZ1A 1J27A 1LW2B 3CIMA 3M8WA 3EDRB 3BSNA 1S1UA 2O5DA 1XR6A 3QT6A 3RAMA 4UT4A 3VGVA 3V6KA 2V2QA 4AL6A 2BM1A 4OI4A 1VQ5S 2IA6A 4IRDA 1P1LA 4G1QA 1S1WA 1YJNS 1QSSA 2IM2A 1SC6A 4Y2KA 1EJ7L 1JLQB 1YX2A 1ZOTA 2EI5A 3BBFA 3CJ8A 3CVKA 3T1YF 1GNKA 3UD5A 1RGVA 3I6PA 1PGZA 1HKAA 1B0PA 4P9SA 1FFWB 4DV0F 4B3OB 3P6YC 2RHSB 1SJ3P 4MYUA 3FCVA 2AGQA 4KV8B 2CWKA 4KY3A 4AL7A 1IJEB 1SC3B 2YH1A 4OZ3A 1WEZA 4Q44A 5GAHI 2W7AA 5J1EB 4QWDA 2JEGA 1Z4UA 1Y0HA 2OSRA 3CO0P 4NL5A 3I9V9 3I96A 1NHUA 5IT9Y 4YUDA 4GMKA 4DHVA 4UQGA 2AX0A 2WW8A 1T11A 8RUCA 4U8YA 3VAIA 5BYSA 2UUAF 1QY7A 1QUVA 1RWWB 1OY9A 3OFFA 4P2XA 2LXFA 5IQQA 3K59A 1XNRJ 3NGSA 2UUAJ 2JSXA 5DQHA 1QAIA 4URQU 1EUYA 5HL7S 4OV6A 4RO0A 5LSLA 4V19J 4QIVA 1R8BA 1BLUA 2Z4PA 1QJHA 3FC9A 4WP8A 4ZVEA 2MZ1A 4XK8C 2HBRB 2GHVC 1LEOA 4DSEA 1S7HA 3QQCD 2YWKA 2CAJA 3AAWB 2GGPA 2V4QA 1RT3B 2HFZA 2UV8A 1Y5NB 5AXLA 4R8UB 3DOKA 4DZ6A 1V5IB 3JXOA 2ZH9A 3N6LA 3CF5Q 4LF8F 3BKUA 3N79A 3RR8A 2M2BA 3NWGA 3VAJA 1XMQF 1I51B 2M8HA 2DGXA 2LEPA 4DR3J 4KHMA 3I0SA 3NGTA 4C97A 2RF2A 3HT3A 3UCGA 2CZVC 2PI5A
chains in the Genus database with same CATH topology
1DZ5A 1R8PA 3B8HA 2XLIA 2VQFF 3KMQA 2MJUA 3B4MA 5CYMB 1WF1A 4JI2F 3OL6A 5I3UA 4MIWA 4O4GA 2EFQA 4MFBB 1YJVA 4ETXA 2GX8A 4FXWA 3MECA 4JI1F 4DPOA 5BR8F 1D9AA 2XCPA 3CJ3A 3CJ0A 1EP4B 3KK3B 2VPYB 1NJZA 2OPQA 3D1OA 4A8FA 3MM9A 4Y00A 1J5EF 5CA5A 1FRXA 2K3KA 4AFFA 4A8QA 2FVCA 3PJXA 1DQ9A 5AXMA 2FC8A 4TYAA 1VRUA 2EBEA 3M2UA 4TKTA 2OIHA 3T9NA 3J80Y 4JI3F 2ZHOA 1RT1B 2OSQA 4TY9A 4YDXA 5M2PA 4WFNS 4Z2XA 2C28A 4HT7A 1JJ2R 4OZ5A 3JAMY 1HWLA 2HMIB 2VG6B 3A1YG 2FTRA 4FF4A 1HBUB 2DISA 5E3QA 4OI1A 3QJPA 3JSRA 2IRYA 3AA9A 5KG3A 1VQ6S 3M6WA 2W4DA 3DOLB 2XNRA 1KR4A 3NNHA 2CPIA 2Z2MA 1S9EB 2JVOA 5IT9Y 2BANA 3S01A 2F8EX 2VODA 1H7WA 4DR6F 4ZS6A 1LFPA 2V8GA 5EWGA 1S6UA 5A8WB 2UXBF 4Q5VA 3ZFVA 2VL1A 4EYHB 3UI3A 4IFVB 1DAXA 2ZM6F 4C8YA 2R8GA 2BV3A 3IS9B 3UNGC 3BGRA 4FS1A 4EWTA 4WKRA 4NYPA 3G8QA 2WB1D 4G1IA 2VA3A 4N41A 2HS0A 2JL9A 2GHWA 1VI7A 2KT5A 4KHPF 2AYGA 4A4JA 5IT0A 4PXDA 5J2MA 3H5XA 4TLQA 2BJDA 3AQPA 3NS6A 1ZTWA 2ROEA 4TYBA 2DPJA 5KFXA 2EK6A 3H20A 1WF0A 3QIPB 4CCHA 5CXTA 2V8HA 4HHJA 1C0UA 4BCAA 1DQ8A 3HHLC 3TQ1A 4F25A 1HWJA 4A8WA 3BQ2A 3MR5A 2N3OA 3W2VB 2WTFA 1S97A 4WF9Q 2J0WA 3RZAA 2EWHA 4NZ6A 3CJ4A 3CC2S 1D9DA 4ZPVR 4ZP9A 5A0YB 2GQCA 1IKYA 1TK5A 2QYCA 4QPTA 3MGJA 2DGQA 2E5JA 5EWFA 5GAHU 2DO0A 2HNZB 3JSMA 3HF5A 3K5MA 4J9OA 2WONA 2MSTA 4G1QB 3M8PB 4DBQA 3DMJB 2OPPB 3I5BA 3TP2A 5IWAF 3M8PA 4C3MA 5KFOA 3BQ0A 3IWNC 3EGNA 1W2BR 1TKDA 2OPRA 2HVIA 1RTJB 5F8JA 2XY6A 3QO9A 2JJ4D 1LWCA 3BN4A 4NOHA 5LXYA 3FFIB 4DLEA 2PI4A 2RRNA 2FJDB 2JX2A 3M8RA 1FDBA 2W24A 3NNCA 2B4OA 5KFYA 4DN9A 2NSBA 3DU5A 2MZRA 4DF4A 1X9MA 1VRTA 4K4VA 4DL5A 4M63A 3MDFA 2ZJRQ 4G6VB 2OAUA 2V4JB 2BW2A 5L39A 3VR1A 1HW8A 2LEAA 4RWWA 3V6DA 2L9WA 2PC6A 3HHLA 3SSSA 1BC6A 2ZH7A 4TY8B 3SCLE 1B0VA 5EWEA 2YKMA 1YRXA 5E5NA 4NLVA 3QJJA 4OJ3A 4I68A 3KLHB 4K4XA 2CVEA 3RAXA 4JI7F 4TU8A 1S0MA 2ADBA 2AX1A 5T7LB 5CYQB 5AE3A 2Q3PA 3DI6A 5B0GA 2ZC4A 2DGSA 4F2SA 4ILMA 1HMVA 2I2YA 2CQHA 3BO4A 2VC1A 3DLJA 4WK1A 3KHHA 3CMAS 1CPZA 1N6QA 1RA6A 5KFLA 2IC3A 2KXNB 3CCQS 3V6DB 1U47A 4B9SA 2CQPA 2ILYA 2ASLA 2WCXA 4BWJA 2LQJA 3OJSA 5GAGW 1TK8A 2KM8C 5GADU 2B4UA 1XERA 4NLYA 3M2VB 1KQKA 4JV1A 1BQNA 4B9MA 3FQKA 3Q22A 4O3NA 2DR5A 2EBGA 1KEKA 4NMLA 2RS8A 3I31A 2AJFE 2PSZA 4H4MA 3M9NB 4QU7A 3AB2B 4KFBB 4FP9A 4K4WA 1FEUA 4H54A 2IYIA 4ZCIA 4Y2IA 1LWFA 5A8RA 2ZJPS 2KRRA 3ZZ0A 4CT8A 4RW9A 4Y2CA 1NJYA 1MSWD 2BQ3A 1E6YA 3PR5B 3G6ES 1I1GA 2FHMA 1HBOB 3EUNA 3GR1A 4WZQA 1F2GA 1X9WA 1AFJA 2HHSA 2DNLA 2G4BA 1KLMA 4H3SA 1XBWA 1MMDA 2COLA 5L1KA 2E1AA 1X4BA 1JJ4A 4XDDA 4URSA 1GX5A 2OTLS 4ILLA 1UVIA 4N8NA 2B43A 4AYBD 4B9LA 2W8KA 1IBLF 3MCSA 1S6QA 3K7RA 2G13A 5EGYA 3KLFB 2ZKTA 4MYTA 3H5YA 2GW8A 2XSFA 3H8YA 1SL0A 2DNKA 2B51A 2HWTA 1RT6A 2FVQA 5KFZA 4DR1F 3NMAA 4ZP7A 3LP2B 4WF9S 3N01A 5GAEI 4JV0A 2JWNA 1HBOA 2PIIA 2I0XA 2V5HG 4IG0B 4YP3A 3QGHA 1X5TA 3Q8QB 4EBCA 2V2KA 2XS2A 2N3LA 3DCAA 1MU2A 3NGDA 1YGYA 4JI4F 2PO4A 1FRIA 2IM0A 1T02A 1RI7A 3JTPA 3P5TL 5D4OA 3EZ5A 3G8SA 4J9PA 1MU2B 5F8GA 2R8JA 4WFXA 1H7XA 2DR9A 1SUQB 1U1RA 4I2QA 4Y3CA 1FJGF 4RNHA 1W2IA 2EW9A 2PT0A 5CCMA 2RB7A 1R7IA 4OHVA 4QWEA 3CMES 4UY88 3TUJC 2XMKA 4X66F 2BUNA 3FSIA 1HD0A 1M5KC 3NNAA 4ZHRB 4QR1A 3BQ1A 3CE8A 4BBYA 1B0TA 2HWIA 4KC5A 3DLEA 2HGMA 1FESA 2DIUA 3LF0A 4HI2A 4RWXA 3PIPS 1DTTA 3U1LA 4YDDB 3J7ZT 1SH0A 4FF1A 2LCWA 5I42A 3KJVA 2R8KA 2HRUA 2MSSA 1EUQA 1GT8A 2DR7A 2YX4A 1J5OB 3G6VA 4ZPBA 3PIOQ 2I38A 2HNYA 2HHWA 3MMJA 3MM8B 1IJFB 3CDEA 1TKTA 4DQIA 4RNOA 4B02A 2E7XA 2ZDPA 1RYSA 2UVUA 1QLNA 4KO0B 3PEJA 3FRYA 5FIIA 4DSJA 4WFBS 3KKFA 3MXHP 2B7CB 2GJIA 2WBRA 2VKZG 1Q1KA 2XI3A 1FNMA 4KO0A 3OTDA 1L3UA 3DLHA 2FVRA 1LW2A 1NJWA 2YH0A 1N5TA 2CQGA 2DRAA 3CCMS 1N52B 5DETA 1FO1A 5DLGA 4H4KC 4IH6A 3JYTB 2ZOMA 3B78A 3GZ7A 1VK8A 2AQ4A 2YKAA 1TVRB 3JTNA 1WTFA 3TAMA 4IOAS 2JC1A 3T6BA 1SV5A 3BZQA 4MKAA 1IN0A 1H98A 1S9FA 1SV5B 5DDRC 2RT3A 5KFPA 1X0FA 2R2UA 1YQHA 4DR2F 4E0DA 3DRYA 3QIDA 2A3JA 1HQEA 2VZ9A 1REVB 2K7JA 3QO9B 2BR0A 2EFNA 3LAKA 3RRKA 3DXBA 3ZZUA 2GMHA 2JVRA 3FFIA 5T14A 5J2PB 1LFWA 1Z2ZA 2M7SA 2MQMA 1H2TZ 2LU1A 3HVWA 2ZJPQ 1UETA 1WD6A 3TYTA 5B0EA 2N82B 4QYZJ 4ZVGA 2ZZNA 5F41A 5DM6Q 1U1OA 2GFFA 2HG4A 2XI2A 4V194 1Q8IA 4FXVA 1IKXB 1TQLA 3KK1B 4ZVHA 2ZHAA 3GFHA 2B4PA 4C8LA 3CCUS 1K73T 1U1MA 2DNRA 1HWUA 3CD0A 2RQ4A 3L09A 5BYQA 4RW8B 3QZ7A 3MM5A 4X64F 1JIHA 4TXSA 1Z1ZA 2GMLA 4Q45A 3J7YU 2DGVA 3L95X 2VG7B 4ZKAA 4H4MB 2OTJS 1S77D 1P27B 2BVZA 1SJFA 4ECYA 1AXQA 2V94A 3PJWA 1IUJA 5E7OB 4MKBA 5A0YA 4PWDA 2ZUGA 3T6JA 3K8VA 4KT0C 2OKQA 4KB7A 1TL1A 3E8OA 2D7SA 3T1HF 3RB0A 4KBIA 5KOXA 4X84A 5C24B 2F9JA 4DFMA 1FHTA 1K8AT 1JK9B 3Q0AA 1VBXA 4FS2A 2J0QD 1KHVA 2GQ2A 1IKXA 4RX6A 3KK1A 5C25B 5DG8A 1U25A 1U2RA 3O1LA 4K59A 4RKUC 4DL4A 4NCBA 1J2VA 2KHDA 5F3TA 1HARA 5KT6A 2JEIA 2UU9F 3IC1A 2IVMA 2JC0A 4TQRA 1U45A 1Q8BA 2EG1A 1LK5A 4KE5A 1FXDA 2F3JA 5THWA 4I7FA 1MMLA 2BRKA 2GNKA 1E6VA 4NA2A 4Y0FA 4CNZA 4PWDB 2BYCA 3GYXB 4QWAA 1S0NA 2R7VA 2KB2A 3GMGA 2QFJA 1R0AB 1XMBA 1K0VA 5HLFB 1C0TB 2C22A 2RF2B 4EU0A 3I55S 3IRWP 4QU6A 2ZITA 3P3DA 5BYRA 2F8HA 4O3RA 1NZAA 2Z2LA 2MB0B 4LQ9A 1M0SA 3CD7A 2ZD1B 3ZZYA 5ADZA 1FKOB 2RUGA 4B3TF 3IR5B 1QRTA 1UP1A 3GWCA 4B9VA 3M32A 3SYZA 1D3WA 4OL8A 3PIOS 4WJBA 5D78A 1S49A 5HQ8A 4IH7A 2AD9A 3OHBA 2YTCA 3HMJG 4DR5F 2HFOA 3J7A1 3H59A 2IBOA 2J7UA 3F44A 2VBWA 2PA3A 1RKIA 4L72B 5M2UA 4J9NA 1O0PA 4AE5A 2M88A 3TR5A 3M8SA 3KNAA 2UXCF 1KQFB 3DLEB 4RW4B 5J2QB 4IG0A 1P6TA 3OUYA 3OL7A 3HVTA 4RBUA 1RWUA 4OX7A 4DV2F 3M2VA 1VC6A 1TFYA 2CPFA 5M2RA 4JBCA 1UJ5A 1C4CA 3M6XA 2RH3A 2OPSB 3OTBA 3OR2A 5KFSA 3M6VA 2W4PA 3M1VB 4DS5A 2J9CA 4LUBA 3UD4P 3OXFA 4IG3A 1L3KA 1URRA 5KFIA 2JOQA 4RUCA 2ZH8A 1X4EA 3LP0A 1RJJA 2QMWA 3S7RA 4K4ZA 4FYDA 4MK8A 2IJNA 2PMHA 3M8QA 3AY0A 3KG1A 1IR0A 2FJAB 2BZ2A 2FDNA 4HLBA 1LOUA 3TI0A 5KFCA 4U6PA 2DNHA 3G9CA 2VA2A 1W25A 4OZ0A 4F26A 1GTHA 3LO3A 2VD3A 2ZNZA 3IS9A 3HVRA 1NKBA 3K5PA 2YWFA 2CJKA 1UVJA 1UVMA 5B7WA 3BO2A 4YB6A 3CD6S 2FLOA 4M8LA 2PMZD 5GAGU 4X2BA 1M90T 4X4UA 1HD1A 1IKWA 5D3GA 3KJVB 1WEYA 2CQBA 5C42A 1MNEA 3PR4A 1XN9A 3C6TB 2CPYA 2PA8D 5K9FA 4V19X 3RAQA 1UEVA 4QWCA 3VAKA 4IG3B 5CCLA 1HHTP 4O3PA 4WZMA 1ZPWX 1REVA 2HLUA 2JRSA 2XMTA 1CQMA 1HNXF 3NAHA 4C4WA 1H0HB 2VBZA 3MM7B 4HI1A 3WC2A 1QUPA 5E2QA 2RQCA 2UVRA 5ITHA 1SIWB 4QYRA 4CTAB 1WHWA 3DM2A 5EN1A 2BA9A 2F40A 2VFVA 4C0OC 1Z2LA 3H2LA 1V9OA 1WHXA 3MURP 2J6TA 2IM1A 3RW6A 3MEDA 5B09A 1G7CB 3TARA 2KG1A 5T41A 5T7LA 2W9AA 5B0BA 3DLLQ 5KFNA 1FEHA 4LQ3A 1RP5A 4CI0B 1RISA 2IAJB 2ZH3A 5K8OA 5CH7B 1SJ1A 4K4SA 4YHHF 2KYZA 4ZCKA 3PW7A 2QO3A 5KT4A 4U7UK 1HR0F 5KFQA 2E44A 1R43A 4DR3F 2YX7A 4PG8A 5SZTA 1XC9A 3PO4A 1KC8T 3MOZA 3T3FA 1BY9A 1UW4A 1VQ4S 5IT4A 5L1LA 1JLQA 2LU2A 4KIAA 1KTVA 1U2FA 5KG7A 2P9CA 1OQ6A 3T5HA 3DRRB 1Y5IB 4X4PA 4ED0A 3M4XA 2CPJA 4J9QA 1SJQA 1D6KA 2E66A 3HXMA 1H6KX 2DHGA 1JXLA 4DWIA 4Q0BB 3HFKA 1LWFB 2CQ3A 3BREA 1OIAA 3R3TA 4F02A 2ZE2B 1TK0A 4DL7A 1TAQA 4ZMMA 1APSA 2IRXA 3MMCB 2CPEA 3OL8A 1KNZA 3MEGA 3MEEA 1YVFA 3PW0A 2J8AA 1OPZA 3POTB 2CQ2A 5GAGI 3C46A 1R8CA 2HAIA 3SQGA 3UR3C 2RRAA 2HMIA 2EFGA 4L6V3 2R7TA 2AP6A 5H9FJ 5KFBA 4QIWD 1VQ7S 2ROGA 4IO9Q 3D1HA 3CJ2A 3DRXA 3EXCX 4LVNP 4R5PA 1GX6A 3QGPA 1JLFA 4N5SA 1ZETA 4OJHA 3OSNA 4QBUA 3C2PA 2MKCA 2I5JB 4I64A 4WFYA 3UW1A 3D0GE 3CDAA 3O44A 4TN2A 1VOMA 2ZH4A 4Y2MA 3EPGA 3X1LB 2L9DA 2J0XA 1KONA 2M4MA 1VMBA 3D0IE 4CO3A 3QZ8A 2OMOA 3W2WB 3MFHA 1FRMA 3N5BA 3UR0A 4FN5A 1T05A 4G1PA 4WTYA 4NZ0A 1RTIA 1FVSA 2M52A 4URGA 4K4TA 4I2QB 4NPOA 3LAMA 1T05B 4DV6F 1NK0A 4NA3A 2WAQD 1IBKF 3CEDA 5G0RB 3ONQA 4FNIA 3W3SA 1C0UB 2EVZA 3DLKB 1JLFB 3BEGB 4JV2A 1HNWF 1IKVA 2QE5A 1CC7A 2HQIA 3MPVA 3FCHA 1S6PB 1IKVB 1Q81T 3GFYA 2FY1A 3I0RA 2CPZA 4ZVFA 4X4SA 1S6PA 4B9TA 1RT7B 2KFZA 3LPYA 4O3QA 2N4DA 2X51A 3CCJS 2KM8B 2VPZB 1YG0A 2QSFA 3ENQA 4FZVA 3UD3P 3HVTB 1IKWB 2XBPA 3BB5A 3OPKA 1BGXT 3T19A 2L41A 5D3GB 4BWMA 4J9LA 3G6YA 3C6TA 2HHVA 2CVIA 4B3SF 4DDFA 1TKTB 2GIQA 3E01A 5HMZA 1WHYA 2BDPA 2ZOFA 1S6OA 3L7PA 1C4AA 5KFAA 1HQUA 2BANB 2FJVA 4DQPA 2FVPA 5D8HB 3IR7B 5A8WA 3BF4A 3V4IB 5G4DA 1NEEA 4J9KA 1JWWA 3IWLA 5DGBA 4HDHA 4IFVA 1C1CA 3THTA 5K8MA 2VFTA 3CDUA 4ZDNA 1N5YA 1DHMA 4M5DB 2D3UA 4QIGA 3JYTA 2ZHBA 1BQXA 3FQLA 5IFMA 2ASYA 2DBBA 4O3OA 2CPDA 2LQBA