4H4KA

Structure of the cmr2-cmr3 subcomplex of the cmr rna-silencing complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
259
Chain Sequence
VTFTPYDVLIPLPQTVAGAIRTLLFYEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRILRIEKIYAWIEDPGCGIKDILSSYEFLTLGSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cmr2-cmr3 subcomplex of the cmr RNA silencing complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Rna binding protein
molecule keywords CRISPR system Cmr subunit Cmr3
total genus 55
structure length 259
sequence length 318
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4h4kA02
3.30.70.2940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4kA01
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4kA03
3W2VB 3X1LB 4H4KA 3W2WB
chains in the Genus database with same CATH superfamily
3HI9A 3QGIA 4ECWA 1Z4UA 4OX7A 4YB6A 1CSJA 4WJBA 4PR6A 5A2QU 4PXDA 1U45A 2JEJA 3M30A 3DRSB 1VDHA 5GADI 4JXZA 1RT6A 2YWWA 3ETOA 1ZPVA 5GAGU 1QRSA 1FDNA 2XO6A 1YJWS 2NXCA 1O51A 5I3UA 3DLGB 3KMSA 3QWPA 2VG7A 5KTQA 1Q5YA 4KKOA 2V0NA 4YMEA 5A8WB 2D69A 3I0SB 1FXDA 3MMCA 4RW4B 4RZRA 3HO1A 1LXNA 4NXMJ 3H40A 2N4DA 4G1QA 4DQRA 1U4BA 4W92B 3H4DA 2V2VA 4QWBA 1U1OA 4ES1A 5IZHA 4GC7A 2RQMA 3V6KA 4OZJA 4OYBA 1V3RA 4QPXA 3AY0A 3UD3P 1DTQA 1VBXA 2RIJA 1RWPB 2BM1A 2AEMA 2PE8A 2Y0BB 1X4GA 3G8QA 1IBKJ 5B0FA 4YOEA 1JLCB 1BD6A 2IAJB 2NYHA 4DPOA 2YKMB 4C6AA 1TUGB 3I82A 4DV5J 2J0SD 1RWVB 4PQUB 4KKOB 4UZCA 2BBEA 4TLRA 4DPUA 5A8WA 5HVGA 1FNXH 2QLJB 2QEXS 1X5TA 2FUG9 4WK1A 1E6YA 2CPEA 1QRUA 2POKA 4OJ1A 5DM6S 1O8BA 2RS8A 2ZOMA 1XMOF 3QRQA 1J5OB 1DTTA 3FCWA 3R5AA 5DM6Q 1SUQA 4F02A 1SV5A 3PTWA 4LMZA 3TAMA 5F8GA 1YBUA 3H2LA 4RNOA 3FEXB 4HH0A 1KP6A 2QC3A 4HI2A 4DX8H 3V6DB 2MKJA 1UJ6A 5HVHA 4I2PB 4DQPA 3QAUA 2XMUA 2A2CA 2GO8A 2QG9B 1VGYA 3FRZA 4OLPA 3ENVA 3B4DA 2GNKA 3A8JA 5KG3A 1Q79A 3GIRA 3M6XA 2ZH9A 4JI3J 2BJ8A 2QA4S 5DETA 2UUWA 3W1YC 1HNIA 1K0VA 5CQGA 4DV1F 1NJIT 3MUMP 2KFZA 2CFXA 1JJ4A 1RTZA 1H7WA 4IFVB 1ZM9A 2HFUA 4LSNB 2PI4A 2DXEA 3HHEA 4MH8A 4X84A 1VC0A 4UY88 1K1QA 4WWSA 2KTQA 4HVZA 2HHTA 4HHJA 3ONQA 3I31A 1NO8A 4FXDA 3CMES 2VU5A 3M2RB 3PIOS 3BBFA 3PEHA 5J2QA 4B3SJ 1Y0HA 4ZJOA 3OR1B 4HTJA 4RU9A 4LF5F 2ZBIA 3C6TA 4M8LA 5RUBA 1CVJA 2OLWA 3M9OB 1EETA 2RB7A 1RU1A 3DLGA 1U1MA 4M94A 2YKOA 5HMWA 3ET6B 2GJFA 1VI7A 3FQLA 4ED8A 4B3TJ 2ZVSA 3OTBA 3NMAA 4CYUB 2E5JA 2R2UA 4Q0BB 1JLEA 1GX5A 4S0MA 4F4KA 4J9LA 4H4MA 2DGTA 1SKUB 4EWTA 2MZ1A 3SV4A 4FS2A 1XNRJ 2CNOB 3EYZA 3NGDA 1HWJA 2IM3A 2WK4A 2KJWA 2LP4A 4LFCF 5E3AA 4Q45A 4H54A 4DR1J 2HRYA 4DJBA 4DG1A 1N5SA 3C16A 4LFAJ 1PCAA 1XTZA 2LQJA 4ECTA 4HL9A 1YBTA 3MR2A 2JLEA 4DV4F 1UW9A 1PG5B 4JI6J 4O3RA 1UA0A 3M9MB 1HWLA 4RL1A 2A6OA 4CLTA 1S1VA 4NL5A 3SQOP 1T9WA 1WG5A 2GO9A 1W7WA 2MQ8A 2D3OR 1NJXA 1S9EA 3I87A 3KHHA 2IVYA 1Q86T 2CPIA 4FVMA 2N3OA 3LGNA 3DHWC 4M5DA 3NNHA 1C1BA 3EXYA 4F4WA 5HL7S 5SUHA 4V1Ak 1C0TB 3OR2B 3N9UC 4OI4A 3E51A 4FN5A 2NCKL 2HZCA 3UR0A 1U1NA 2UUBF 3OD2A 1VQ7S 4QYZJ 5HROA 5E2QA 2VASA 3V5RA 3LQVA 5K8NA 1X4EA 3AXMA 2C28A 1UL3A 1RACB 3HULA 1OQ6A 3MEGA 5AXMA 1HI1A 1RLCL 4TKTA 3OJUA 1X5OA 3PX4A 1YRXA 3K7RA 1UW4A 2B51A 1HR0J 4DU7A 2UXBF 1CULA 1JLGB 3M1VB 4USWA 1IKYB 3QGPA 4IOBA 4NLYA 1T7PA 4CI0B 2OPRA 3CDEA 3FQKA 3FVYA 3LOUA 5KG2A 2OEJA 4ZIWA 5D0EA 4NLXA 1S0VA 2P9CA 3PFOA 1X9SA 3US5A 4OI6A 1DBDA 2HURA 1M5PC 2HMIA 4TXSA 2YWHA 1EB0A 1PAUB 4UW2A 4C3MA 1S59A 1V6HA 4QZVB 3NKYA 3GG1A 3KK2B 3CJ2A 4P10A 5DLFA 3EGNA 2RDDA 3M8RA 5A8RB 5IOLA 2F4FA 4AL5A 3KOAA 4M5HA 1IUJA 2HZ7A 4WCES 2CWXA 4NZ7A 2XMJA 3OFEA 5I42B 5G4DA 4AL6A 3JB9k 5KT5A 1DY3A 3TWZA 5MAOA 1RT2B 2QL5B 4J9OA 4RBVA 4C11B 5F8NA 2HQCA 3DGPA 1IN0A 3H59A 5U47A 3KK3A 4U67S 1RAEB 2A10A 4RW6B 2MMYA 5D4LA 4DV0F 2Y1JA 4DR4J 3RZAA 5IV3A 4J9SA 3UNYA 2W2PP 1VFJA 3HKWA 5BR8J 4ED6A 2BJ7A 3UN5A 2B6AA 2KRRA 4OHVA 1TL1A 4OLOA 4AFFA 2M2BA 4OIXA 4J9RA 2ZD1A 4WP3A 4CCHA 3HT0A 3OL9A 5F41A 1NPKA 3GYNA 4EYHB 4TY8A 3HVAA 4C8NA 4TNOA 2DR8A 2FZKB 4PG6A 1FNOA 1RTDB 3GFHA 1RCXB 5K9FA 2EG2A 3ZTSA 2BQRA 3D3CJ 3ISZA 1BWVA 3KJVA 1N56A 2J0QD 5DDOC 1BXNA 2UUCJ 1D09B 2ZJPS 1S49A 1IBLF 3GJQB 3T6JA 4C0BA 1RABB 4DS4A 1LWEA 3LPEA 2P6TA 1R6VA 1FKAF 2HAFA 3EDQB 4J9UE 2FC8A 4BC7A 2FLPA 3ZTRA 3GV8B 2CPJA 2BMBA 4ECQA 1WKLA 5KFQA 3RB4A 4DV2J 2E44A 2XS7A 1YDLA 3E01B 4KYZA 2PICA 2CQ4A 2ZKUA 3DLHA 4ED0A 3HHKA 3K89A 3OL7A 3TO8A 2GX8A 2Q79A 1J27A 3H2VE 1FEEA 1FT8A 1WI6A 1W25A 1GMWA 2BX6A 2CNLB 3IG1B 2HQIA 3CW2C 3ZO7A 4RW4A 4B08A 3W5ZA 2W9AA 1U1QA 1N36J 1SH0A 2HQ3A 3IS9A 4LF6J 1G1XA 5DDPC 5CYQA 4ECXA 4K4VA 4CT9A 2YX4A 4USKA 1RTJB 2ZOFA 3GMGA 3RBEA 4K4ZA 4V194 5KG5A 3R1HA 2PI8A 1FDDA 2GS8A 3I32A 4LF9F 2GHPA 3FCHA 2GV1A 1UWBA 3DOLA 3HSJA 4X4PA 1MLAA 3RAQA 1XNQF 3FUYA 2HK2A 2IYGA 1VQ9S 2AJQA 1NUEA 3IM9A 4Q43A 3TQEA 3WIUA 1KD1T 2W4DA 1FRLA 1FJGF 2VQEF 2ACYA 4C8YA 4LJMA 4ANDA 4J37A 3R9LA 4GVLA 4JYZA 4DUTA 4Y2CA 2I9SA 2IVMA 4IRDA 5J2NA 4DSJA 2UXCJ 1YGYA 2AW0A 4B9NA 3IBWA 2MKCA 3W61A 4CLUA 5AT1B 4QWEA 2CQ2A 4WTOB 3PX6A 3DLEB 2G5DA 4DN9A 2DNMA 4A47A 1GK8A 4I6YA 1LWCB 2DTJA 4ED7A 3PACA 4GVBB 1S4EA 2JOQA 1BY9A 1NKBA 3PG9A 1U8SA 2MPUA 3NGUA 3QBCA 4LIRA 4AE5A 4ID5B 2OO4A 5HMXA 4YY3J 3BO2A 3H42A 2ALYB 3ETMA 3R5GA 4QOTA 5D6GA 3LW5C 1QDUB 4B3RJ 2DNZA 2AGOA 2ZH5A 1OPIA 2OSRA 2JC0A 3W64A 1D9AA 2UVVA 4P7VA 2VPZB 1WD6A 4OJ3A 2C2OB 3SIPB 1KLMB 2DKOB 1NHUA 1OSDA 2I0XA 2RKIA 1LNQA 3T6BA 3T1YJ 3KK2A 5KFAA 4P71A 5EUHA 4OI2A 1EARA 4ZA1A 1OSCA 2NXJA 2W9BA 2CJBA 4KHPJ 4NASA 3Q23A 2VJUA 1EP4A 1DURA 2ZVIA 4Q44A 2L48A 4Z7YA 1FFGB 1KWMA 3ZZTA 1JLQB 2YPYA 5LJ3Y 4KHMA 2J5AA 3UWTA 3H5UA 4NCGA 1J5EJ 2FJVA 1RCOB 1LWXA 1N6QA 1VQ6S 3GZ7A 3QAEA 1RE1B 1HFEL 3W2VA 2AD9A 2C2NA 2MLXA 2RD2A 3LGMA 1RISA 4CIOA 1L3UA 4C8LA 2FGCA 3MCNA 6AT1B 1VQLS 4DLGA 2R8JA 3D5MA 3HHLD 1EX8A 2EFGA 3MM7B 4OFZA 1CBKA 2DGWA 3PR4A 1IBMJ 4IO9S 2YXLA 3RR8A 2RDJA 4WK3A 2B5JA 4X62J 1L3KA 3QT7A 1VQSA 3K5NA 1TAUA 4O4RA 2EFQA 2XMVA 3DN9A 3ELHA 1NK7A 1S76D 1HQEB 2J0XA 2DO4A 4UF4A 3W5XA 1JLFB 2QA1A 1RHUB 1VCTA 2OAUA 3BSCA 4JBCA 2DT9A 2VUGA 1RAFB 2KRBA 4DZ6A 2H5EA 3N6NA 5HMZA 3V4IA 2OPSA 2FJEB 1Q81T 2BDPA 4M5GA 2I5JB 1TUVA 3UR3C 2C22A 1MROA 1XMBA 1Q4RA 2DNHA 4JI7F 2YNFA 2GZOA 5EX0A 2RSQA 5JMNA 2DGQA 3GB0A 4MFBA 3UD4P 2GQCA 4OZ0A 4Y2MA 1VR6A 3KUGA 1CJUB 2YKPA 3D54A 3EICA 3P3DA 2A2DA 3CNQP 4IOCQ 2DITA 3EVOA 2DNRA 5KFYA 2BJ9A 5T7LA 3BGFA 1YJRA 2ZHAA 1EXDA 2FC9A 2HHWA 2RAQA 1NSKL 1MWYA 2AYGA 4ZITA 1I94J 3SYZA 4PPZA 2K7JA 4ZN1A 5KFPA 2CQDA 3W8GA 1UEKA 3EPGA 1B0PA 4FZVA 1IKXB 3GIKA 3K57A 1HHTP 5K14A 3TUZC 1VISA 5E33A 2ZJQQ 3AQOA 1O6XA 2E1MC 1SJ4P 1XIQA 1SV5B 1Y5IB 2C1EB 1E6VA 1QAXA 3P5TL 1OMSA 3NWGA 3AD7C 1HMVA 3FBBA 4WFXA 1UVMA 3MZIA 2KL8A 4ELUA 4HLBA 2V9KA 5BYRA 2X1AA 4R25A 5LMUJ 2CZ4A 1SPBP 3CIZA 1FEUA 2VFVA 3HVTB 3H2UB 3HX9A 4KB7A 3QQCD 5J1NA 3VAFA 5HK4A 2V94A 5L1JA 2B3TB 1LWFA 3BV8A 4LSNA 2GVZA 4ZCLA 5FLXY 3TZZA 4BBYA 2WBRA 4KSEB 3NWRA 3KUEA 2CDRB 3MURP 4LIWA 2E1CA 1R8CA 5AJ3J 1AXQA 1N4LA 1KTVA 3RUBL 1UZDA 2NXUA 1AW0A 3LP2A 3MECA 4CO5A 3LF0A 1FNMA 4O44B 1RA6A 4B9LA 4P72A 4JI2J 2VOPA 4K4XA 3T1HJ 1JJ2R 2UUAJ 2LKZA 2FJXA 3C14B 2UUBJ 4FVCA 3PKMA 3DU5A 4KPYA 3P4UB 4QU7A 1V5IB 1RWMB 2BOAA 3PR5B 1N32F 2V6AA 3CCZA 4NLUA 4I1TA 4UQGA 2Z2LA 3BSAA 2H54B 2QFIA 4TLQA 3BS9A 2ZH2A 3TARA 1CJUA 4HI1A 2ZD1B 1MSWD 3LWMA 2XMWA 3TJAA 2DGVA 4LBIA 5CAAA 1NLKL 2NPIA 4OZ2A 1NK6A 4P73A 5KFNA 3PFEA 1S12A 1S4FA 2HVZA 2DXDA 1FJEB 2E1RA 5KFEA 4OX8A 4A8YA 1F9EB 2BW7A 4HR2A 2AGQA 1MW7A 2EVZA 4P2MA 2A18A 1YLXA 4DU8A 2L08A 1SB6A 1HWUA 1XEZA 3MEKA 3CWJA 5ETTA 1B64A 1TMJA 5KFFA 2RMLA 3KDOA 4C48A 3M7VA 1KFSA 2HRTA 1RT7A 3FGVA 4AQYJ 1HQUA 4O3NA 3A12A 1LW0A 1KDNA 2KFYA 3C19A 4JI1F 2CG4A 2CKWA 2OSQA 4IYQA 1T05B 5K20B 1VQYA 2UUTA 1CC8A 2X7IA 3OUYA 4WIQA 4WPAA 1WF1A 4DL0C 1FRMA 2MHNA 5HQMA 1M1HA 4CO1A 4O44A 3FBCA 4XPCA 3ULHA 4K4YA 3EZOA 1V9OA 1FERA 1WEYA 1HPZA 1RI7A 1RSCA 2XEXA 3M4XA 1UPPA 2ILZA 2N82B 3CXCR 1NHKL 3W7BA 2R7QA 1PSDA 1HWIA 4WYWA 3WC2A 2MGZA 2AEFA 2BM0A 2KHDA 1PJ5A 1IR2A 3RAMA 1SQFA 1TVRA 3TI0A 1S72S 1KQSR 2ZH7A 3S6EA 2HIQA 1O0CA 2QFJA 2HZAA 4L3NA 4AXIA 2MQPA 3SQGB 2XYHB 3J80U 1B7FA 2XI2A 4XDCA 1XR5A 1N5TA 3HFZB 4IFYB 4OYMA 4M5NA 5CZVA 2Z0GA 4YN3B 1XR7A 2B7CB 2R8KA 1XBWA 4KY3A 4L72B 3R8YA 1F2GA 4IDKA 1RT4B 4IH5A 1UVIA 1RT1B 1QTQA 4RBUA 1RBOB 2HK3A 2YNHA 3Q86A 4LBPA 5A8RA 3TVZA 3R2CJ 1S6OA 3TUPA 1XMQF 2VFRA 4M5LA 4KTQA 1RYRA 1SI9A 2HEKA 3E01A 1B99A 1CJTA 2RE8A 1NM2A 1X8DA 3MMJA 3HHDA 2PMHA 3EGVA 3O3LA 2KXNB 1FJ7A 2XSFA 1ZM4A 2HMIB 1JXLA 1URRA 2XTJP 4J91A 1Z1ZA 3M6VA 4NXNF 5F8MA 1W26A 4X2BA 1PAEX 3A3PB 4D3GA 2LQ9A 4ZIVA 3Q22A 3MPYA 5HANA 3T1HF 4DFPA 4CLLA 2FLLA 3KJVB 4ECZA 1S1XB 2CADA 2RDIA 2VG7B 4QWAA 2YVSA 4I2QA 5AE2A 3IAS9 2MSSA 5JVGS 1K9MT 2E5LF 2B4VA 2WVBA 1BQXA 4F25A 3OTDA 1Y7PA 3NP5A 4GO7X 4N8OA 4TY8B 2H1YA 3FNNA 4C8MA 3S1TA 3KTQA 1Q78A 3M2VB 1TL1B 3CD6S 4OYZA 3TAPA 2RU3A 1RT3A 4F36A 1TTHB 2DH9A 5DG9A 1D9DA 1HYSA 4ZP6A 5F8IA 2HNDA 4N5SA 2VHGA 3KK3B 3CCES 4JUZA 3E8OA 3VVTA 4WU2A 3JSYA 4ANCA 4CO4A 1WC5A 2OHDA 3EDRB 3HD2A 5C7PA 4LUBA 3GE9A 1LKZA 3IG1A 1IKWA 3MAAB 1FXRA 4K2JA 1FD2A 4G1PA 4MTPA 4URQU 2GQQA 2W25A 2Z30B 3T9ZA 3OTOJ 2OIHA 4TU7A 5CZXA 1U09A 1HW8A 1HQUB 2OTJS 2BJ1A 2CQ3A 3A8KA 1U0SA 4CDIA 1GEHA 1Z2LA 2VG5B 3FFIA 2HSEB 2ZDOA 4KGKA 3F41A 3NS6A 3GFZA 3LA0A 3VZHA 1Q5VA 3MDFA 4EUVA 3NOCA 4DR2F 2NREA 3VAJA 1WHYA 1ZJWA 2ABYA 3HHLB 5KFOA 2CA9A 4FF4A 2V5HG 2FPHX 1MG7A 3FSIA 5L1KA 5H9EK 3CDAA 4ICLA 3UDEA 5L9NA 3FEYB 3IP0A 1WEXA 4IQMA 2HHQA 3GJSB 4C8OA 1GNKA 4DV6J 2UVUA 1NBEB 2HHVA 2G2ZA 5D3GA 2UU9F 1TR0A 2KZZA 2HHSA 5ETOA 5DLGA 4WFNS 2HVDA 3SI8A 4I7FA 2HS3A 3MEGB 3S8SA 3MCSA 5KFBA 2MHEA 4CLPA 4YUDA 5BJRA 1TL3A 4K5SA 1RHMB 1NJWA 5DM7S 3FEZA 3JSMA 2DCUB 2XC9A 3SSQA 3EE3A 1S1XA 2AMCB 4J9KA 3PV8A 1BUXA 4HHUA 1TKZB 2GAHC 4C3LA 3P8BB 2DPIA 3L7PA 3KFWX 2YQ1A 3R5DA 4WFAQ 4EMDA 4DV3J 1S5ZA 2FJDB 2Z8QA 1T05A 3QMQA 2EPIA 2Z57B 1Y11A 2W4CA 4ITSA 4PXCA 2BRLA 3EGZA 2YY3A 2VQFJ 1VQ5S 1A0OB 3AA8A 2LMIA 1HNZJ 2V4JB 5LT5A 2JJ4D 3RJMB 1GAOA 2YNHB 2NLWA 2XCAA 1XWLA 2H9ZA 1HNIB 2QX0A 4A8OA 2CPHA 2IRYA 2OPPA 4HTIA 3C16B 2B9YA 2YNFB 1DFUP 1OJ4A 2EFPA 4DUYJ 3QIPA 4PXBA 1P6TA 2FLOA 2OPSB 4L74A 4DQQA 4W90B 3PKYA 1U2FA 4H4OA 5MLCV 1J5EF 4WF9S 3I0RB 1CC7A 1R27B 4H4MB 4KGVB 4JV1A 2RQKA 2V8GA 3CT9A 1S0NA 2CRLA 8RUCA 1JLEB 1YITS 1AUDA 1S1WA 5DRKA 3S7RA 4P9SA 3CCLS 3H0PA 3DI6A 3MMAB 2ZJRS 2VPWB 2L41A 2G9OA 3THTA 3Q2SC 3K5PA 4ID8A 2FHJA 1FKPA 1PYSB 2JEGA 3DLBA 4JI4F 2DR7A 1WACA 3C6TB 4GO5X 3QATA 4BLGA 3SCJE 1AT1B 1YBAA 4FYWB 1T03A 1WDDA 2Z56B 4KRWA 3PDNA 1NJYA 4DUYF 3FRYA 4LQ3A 1OPZA 4CNYA 4XPEA 4WZMA 1H2UX 2F1FA 3M2UA 3MUTP 2N7CA 2XULA 3TZYA 1S9EB 3RBZA 2OFGX 5EWGA 3BGRB 5T7LB 5HP1A 4KAIA 3O2IA 4OV6A 1JLCA 1VHIA 1RK8A 1T9UA 1TL5A 5M2UA 3PIPQ 2VQFF 3H25A 5IQQA 4AXJA 3F56A 3UCGA 1SH2A 1X4HA 1VHFA 3D0IE 1S77D 3MR3A 3AB4B 2UXCF 4L6V3 4ZVRB 2FHJD 2Z4PA 1MROB 2JFDA 4I64A 4DG1B 4UOGA 7FDRA 3VALA 4Q2LA 3CCMS 1CJKA 3GJRB 3HVTA 1KRPA 3QT6A 3M8SA 2QMWA 1UEVA 1RLDA 4A8WA 4OJHA 3HSZA 3GIJA 1QAJA 1T9XA 1AROP 2MDAA 3KKFA 5DG7A 4CLWA 3PZPA 1TKZA 3MD3A 1H2VZ 1FJGJ 1Q0NA 1VMBA 2V69A 1RKIA 3QIDA 4OZ5A 1R8PA 1XN9A 3OFFA 1KTQA 4NA2A 3CJSA 2VZ9A 4WE1B 5DQGA 2XMTA 3GYXB 4X64F 1B70B 3NRBA 5FJ4A 3BN7A 1EQMA 2C3UA 4LF2A 1WTBA 4EFAC 2LA6A 4LF9J 3BZQA 3IBCB 4DV6F 4X4NA 1KC8T 1EAYC 3SEOA 1M5KC 1MWQA 3WC0A 1GH8A 4CH0S 5CXTA 2Y1IA 2IMOA 2E66A 2F9DA 3CD7A 4WFAS 3P45B 1NK8A 3DOMB 4P52A 3D0HE 4I2QB 4OL8A 1N0VC 4IOAQ 3M6WA 3DLKB 3MMBB 5JXSA 4ES3A 1VIOA 4PYAA 2QN6B 3MPWA 1XR6A 5C25B 3UPFA 1N6QB 2IMWP 1WF0A 2LQ8A 3CZBA 1WOPA 2FY1A 2WW4A 1RAGB 3L09A 3LP2B 5LXRA 1P27B 3RB3A 5IT0A 3ZZZA 1X5SA 2ILYA 3C6UB 4MKAA 4EO6A 2CQPA 4WU3A 5J2MA 2C42A 2HKEA 3BR9A 1HHSA 3ILJA 1D8ZA 3NGKA 5FD1A 3VTIA 5B0BA 1RXOB 2NUHA 5ETPA 3KK1B 3HVRA 3M8QB 5HBMA 3P96A 2VDHA 3OTOF 3AB2B 2DR9A 1OYDA 4RPFA 1L3VA 2IY5B 1S0OA 1IXKA 4ED3A 4WZQA 3WZ0A 2MB0B 2HWIA 3DRXA 4YEAA 3DRRA 4ZVEA 6FD1A 4PQAA 1TUWA 4CLSA 4DDFA 5C42A 2NQPA 3PHTA 2UUCF 2V68A 4OYAA 2ZUAA 2AYEA 3UVJA 4LF1A 2DEJA 2G1HA 3D7SB 3POTA 4DUZF 4F8RA 4RW9A 4LSZB 4ED5A 2CQCA 3T3FA 1VJWA 2GJ2A 1PO6A 2DPJA 1NYLA 2QL9B 4MJKA 2FZCB 1QTNB 2ZC4A 1JLBB 1W2IA 3TVYA 4V19J 3HCXA 1G4CA 5A0YB 2VIHA 5HQ8A 2ZHBA 2QLXA 3G6ES 1B0VA 4RLEA 1L3TA 2XB2D 4DMZA 4PABA 1PGZA 3PYFA 4U7UK 3MEDB 2AX0A 5B08A 2NSCA 3OHBA 1H6KX 5ETKA 1DQ9A 2DR5A 4NXNJ 1VBKA 3EJMA 3G82A 1Q8IA 3AOCA 3IO1A 4ZCMA 3GCXP 3CUNA 2WCXA 4DL2A 4CQ1A 1BQMA 1WSRA 5AE1A 2G4BA 4J3CA 3FZ2A 2CJQA 2XGQA 2VOOA 2AIRB 2KT3A 1REGX 3MPUB 4F4ZA 1FE4A 2BABA 4DV7F 1HI8A 1QRTA 2Q6CA 2HG4A 5C24B 2V34A 4RNMA 4FXWA 1BHNA 3AXKA 4YHHJ 1U6BA 1RTJA 4Z7CA 1Q95G 2I5JA 1EUQA 4IOCS 4NEYA 2N4CA 2LQBA 3LP1A 2KHCA 1KKHA 2E5HA 3CEDA 4RUBA 2ZM6F 3JXOA 5A8KB 3IWXA 2KH9A 2ROGA 4QIEA 1VRUA 4J9VA 5C2CA 1SKRA 2FVPA 2AF6A 2KT5A 1D1UA 3PY8A 4DV3F 3DLLS 1GT8A 2F8HA 2WW8A 4UUWA 2MGZB 4DV7J 1FF2A 3DYAA 1I51B 4MIBA 4UY8T 2LDIA 2E1PA 5ADZA 3OJSA 5T14A 1KONA 1OY8A 2C2MB 4DFJA 2PEBA 1VS3A 2UVRA 1IKXA 2BJ3A 4C98A 2LEPA 5DJBA 1KOOA 2JDJA 2W8KA 1U1KA 2AP6A 3A3OB 2MXYA 1YHQS 2LA4A 2LYVA 2AGPA 1UFKA 2MKYA 1R0AA 2DY9A 4AQYF 4WYLA 4CRJA 4EBEA 4KFBA 3WBZA 1H38A 1KVIA 1R6YA 1LW0B 1LW2A 2RS2A 5ETNA 1SKWA 2D1CA 2PMWA 1WC1A 2EC0A 4JP8A 3G9CA 2R7TA 1JLBA 2V63A 2DK2A 1SXLA 1Y5LB 3N6LA 1FTRA 2PMZD 5IFMA 1G7CB 3D6MB 3IN5A 1N5YA 2Z2YB 3HJVA 1H2TZ 3GFXA 1KS2A 3CO9A 4DR1F 1C4CA 2CPFA 3WHIA 3OFHA 1CS4B 3ZNUA 3CD5A 3J81Y 4F3OA 4QR0A 4DSEA 1ZTTA 2M8DB 5LXYA 2IIHA 4DUZJ 4H4KA 3F0NA 4X4RA 4GRSA 4C97A 1F5CA 3DDKA 4RW8A 3FBEA 3W9HA 2E5GA 4OZ1A 4NLDA 5HBMB 3VQSA 3M8YA 4NMLA 4ZLPA 4DSKA 4K4SA 3CCTA 4G6VB 3PXGa 5GAGW 2ZWPA 2IC3B 1LK5A 2OMOA 4USHA 3Q8RB 2XY7A 3C6UA 3MWBA 2RUGA 2H4YB 1DQ8A 1F6TA 1Q7LB 1M5SA 2ZEJA 3FDSA 3LP0A 2IYIA 3O8WA 4UOHA 4H3SA 2OPQB 4CTAB 5K8PA 3Q24A 2CQGA 4KIAA 2WHOA 2FJAB 1Y10A 2MLYA 3FMWA 4NA1A 3A4TA 2YNIB 4ZVOB 3R7SB 1PBAA 3FKBA 3OUYB 4DL4A 3DMJB 3IRXA 1TZ0A 3P49B 2VC1A 2MZTA 4AD6A 3DYAB 2YH0A 4KE5A 5AJ3F 2CQ1A 4HHHA 4UOFA 3RYLA 2BEFA 1LFWA 1ZM3A 5HLFA 2IBKA 4JI3F 2VFSA 4Y00A 3VWSA 4Y34A 1WNEA 3K5OA 1NHVA 3MM5B 5CYQB 4X64J 2Y8WA 3CDWA 1TL7B 3BH6B 2QGFB 1YJ7A 2DCLA 1WC6A 3OPKA 4IQXA 4PYDA 5LMUF 5EX3A 4C3KA 5KFHA 3JYTA 4Q8EA 1RWOB 2BV3A 5EN1A 1NZ8A 4ZPCA 3L3CA 4DS5A 2BZ2A 5C24A 2DNKA 4PG5A 4J7CA 3VZIA 4KJIA 2QSFA 2PN6A 2EFVA 3TA0A 3E3XA 3CJTA 4E8UA 4YFUA 1FA0A 4RBTA 2HHHF 1SVDA 4LVOP 1ROFA 2F8EX 3ZZUA 4U7CA 3V81B 4USIA 2JVRA 4O4GB 4LT6A 2ZE2A 1XMOJ 3ILOA 4Y28C 3LANA 2CQBA 3LUYA 3CCUS 1TP7A 2CJAA 1SC3B 2YPZA 3V4MA 1I94F 3M32B 1IKYA 3JS9A 3R2DJ 4UZBA 3D1QA 1QUVA 4HACA 1RBLA 3N79A 4PRFA 4DX7A 5IT9U 4QU6A 4DR5F 3R27A 4HT7A 3JSMB 3U7JA 2LEBA 3VR1A 3X1LB 2EBGA 3ILIA 3QT8A 4ENOA 3OLAA 4JI4J 2XNQA 5EWEA 2MY7A 4I6AA 1FVSA 1RWNB 1XC9A 2X1FA 2BUNA 2YWKA 4CLZA 1VQ4S 2GHWA 2GVZB 2EGVA 1YJ9S 3KWMA 4WXOA 3HK2A 1VRUB 1RUSA 1Y4ZB 2YKAA 4MFBB 2FJWA 1RWXB 1KLMA 1FDAA 2GJIA 3NXZA 2OP5A 1GFWB 4FDFA 4OYWA 2JNJA 3TA2A 1NB7A 1KFDA 1RT5A 5GMDA 1YJUA 1FDBA 4WP8A 5DQIA 3KLGB 3S01A 2RQCA 5KAKA 1OS5A 2OTLS 2YKNA 4USVA 2FVCA 1S6PA 1TK5A 3QLHA 4X62F 3QJPA 2UZAA 4NZ0A 2FZGB 5F9NA 3SV3A 1G2EA 1MN7A 5IT9Y 2DRBA 2H3EB 1IBMF 2DGUA 4ZMMA 2UP1A 2HAIA 1NJZA 4N41A 1VHKA 3TAQA 1HBUB 2MSTA 4FKYA 3B82A 4ZPWR 1HNZF 3J7AN 3PRDA 4I69A 5KFTA 3IRXB 3PYGA 1ACMB 1PYOB 3RRGA 2ZJRQ 1TQLA 4ILRA 2FHKA 2RHSB 1P8GA 1M5VC 4BDPA 5KFJA 1HD0A 2GMLA 4F50A 3JQMA 4DF4A 4O3SA 4OHWA 3HDSA 1HL6A 2OUGA 3LAKA 4L75A 2HWTA 3VV2B 5C2GA 4X4OA 4KHPF 2DY1A 3AJ2A 3V81A 5D4PA 1TELA 2IC3A 2CQHA 4DEZA 3CJ4A 3DI6B 1LOUA 1Y5NB 2N3LA 1QUPA 5IC4B 4R8UA 2Z58B 4I7FB 4ZJLA 4F4AA 2V4RA 2DRAA 3CULA 4DOZA 4OHXA 4ERDA 4DR5J 1TMMA 1M90T 3C2PA 2AT1B 5J2QB 3TP2A 2UU9J 4ELTA 1GTEA 2GMJA 2UV8G 3MM6A 3GYGA 1JXVA 4PG4A 1SCJB 4ECSA 1LK7A 2H5IB 3CD0A 1APSA 3HM9A 5KFMA 2HIYA 4YY3F 4KV8B 2HFVA 5JJBA 3TNVA 2JH3A 4BS2A 4BCAA 1QSYA 4QR2A 3KJFB 4NEZA 1KQKA 3ENQA 2XMAA 2ZH3A 4DR2J 2FJBB 3BSNA 2AYMA 2LU2A 5IC6B 2R8HA 1RAAB 5KG6A 4EEYA 3RW6A 4CT8A 2ZZTA 3M2UB 2HQDA 4RWXA 1JQGA 2PC6A 3QFWA 3T41A 3UDLA 2MQLA 2WSEC 4DWIA 3IR7B 4IKAA 3RBDA 2J9DE 3HPOA 4B02A 2IJFA 1S6QA 2DISA 3UN2A 2CPXA 4QQBA 5GMKa 3CF5Q 2R7SA 2IM0A 4FPIA 4F67A 3R7BB 3PYEA 4PPDA 3GSIA 2RRNA 1P1LA 2K7KA 2ZFHA 4J90A 1EQ0A 5H9EJ 1DTTB 4DBQA 1FWKA 3M8ZA 2GIFA 3DRPB 5E3CA 5IV4A 1C1CB 4NLVA 2QO3A 1S97A 1UP1A 4EZ9A 4MIAA 2CVIA 5L1IA 2E5LJ 4DX6A 2NR0A 2JLFA 1KR4A 2WB4A 1XQIA 1ZTWA 1O5JA 5KFGA 2HGLA 1WHVA 7AT1B 7FD1A 3DFEA 5KT7A 4K7QA 1U25A 2E7WA 1SJRA 5D0HA 4F0HA 4DV2F 3CMQA 1NH8A 3L9ZA 3G4SS 1U7LA 3ZZYA 1S1VB 4EO8A 3W2VB 2VG5A 2RNEA 3JQJA 3H8YA 1NSPA 1FKOA 4HH1A 1N54B 1UPMB 3J7ZT 4QIVA 1A6LA 1OYEA 1XMQJ 2RHQB 1IBLJ 1BQMB 2RH3A 1SJQA 4X4SA 2IDLA 4UQTA 1D6KA 4A4JA 1RAJA 4XO0A 3FZBA 4GVBA 4GKKF 3M9NB 1JK9B 1R7IA 1U49A 4KT0C 3QGHA 2EKNA 1GMWD 1PJ7A 3UW1A 3ITHB 3KLVA 4USJC 1HYSB 5D8HB 2GMHA 2QSWA 2WRMA 3I9V9 3P5BP 4OZ3A 1YRUA 3QO9A 5GMEA 4N7TA 1FCAA 4RWWA 4F04B 1ZAXA 2DHGA 1T94A 1FKPB 3IMQJ 5IWAJ 2K3KA 3KG1A 3MOZA 4LRFA 4DR4F 3AFGA 1TKTB 2HQFA 1V3ZA 2EI5A 4CM2A 5HN0A 2Q6BA 4IG0B 5KT2A 1HPZB 4DPWA 1NK0A 2B9XA 2B8QA 2MQNA 5A8KA 3EPIA 3V6JA 3MHYA 1SIZA 3BQ0A 2MZQA 5LMNJ 3NY0A 1RJJA 1VIXA 2I6WA 1VLOA 5T41A 3N6MA 4WFZA 4ZK7M 1BQNB 3Q8PB 2KFNA 1F9HA 3BBCA 1N88A 1Y3JA 3FCVA 5D4OA 4ZN3A 1FWLA 1NKCA 1TK0A 2LXIA 3TX0A 2Y1RI 3PO5A 1U0HA 5D77A 3W3SA 1BE4A 4KBIA 2ZBRA 4PWWA 1SC1B 2A0FB 2WZ1A 4JI1J 2XYPB 2XMMA 2YNGB 2ASDA 1WC3A 2G0IA 1S99A 4F3QA 2K1RA 1RT1A 3V6HA 3KMQA 3W66A 1G6BA 1RAIB 3L4BC 3JTNA 1T0TV 5CCMA 1H7XA 1VK8A 2D7SA 1QSSA 1Z85A 2X1BA 3CCRS 1HBOB 2JWNA 2ZM6J 1WDTA 1SJFA 1UVLA 2OPRB 1VC6A 3DLLQ 4WF9Q 3CF5S 2XCPA 3PW4A 3PW5A 3CC4S 1U1LA 3M1VA 3PX0A 4USUA 2CVEA 3J7A1 1P9QC 4YHHF 1FX2A 1REVB 2DO0A 2CX8A 3TJ8A 3KYLA 3KG0A 2HZVA 3GG0A 1TL3B 3U1LA 2O66A 3BREA 3HSGA 5HROB 2OMLA 1EETB 1S1WB 3NGTA 1S6QB 4KPCA 1SKSA 1K0TA 2R9LA 1ITPA 2DHHA 2PDAA 3D66A 5L46A 4ZVTB 1C0TA 2B0GA 1CPZA 4ED2A 1NPRA 4ZPTR 2NZCA 4AUKA 2VB6A 4OI0A 1ICEB 1PJ6A 3KW2A 2PJJA 1KVKA 3KLHA 3I55S 2LLZA 4J9MA 1GXLA 2BRKA 2HNZA 2LEAA 2M5YA 2F65A 1CQMA 2QZ8A 2VKRA 4JI2F 4JI6F 4F0KA 3EX7B 1SL2A 2UUAF 1S9GA 4NLRA 1WKJA 4HDGA 1U6FA 3KNAA 2KO1A 2VKZG 4LFAF 4CO3A 4DFMA 1KSPA 1UKUA 4DL6A 4NCAA 2IJRA 3O44A 5BNZA 2VF3A 4IR9A 1KBRA 2HBRB 3GV5B 2V2ZA 4K4UA 3AA9A 4KH1B 2AE0X 4YP3A 3CCWA 2H51B 3D68A 3PIOQ 1RAOA 3HZEA 2HVEA 5DS7A 1CJVB 4FXVA 3R5BA 3LWLA 4PWDB 2W2MP 3AIIA 1UFWA 2GIRA 2LQ5A 3MR7A 4NLQA 2W24A 3ZZPA 2RQ4A 3I0SA 3MMCB 2KG1A 5DDRC 3CJ5A 1JLFA 1ZS6A 2WONA 2M9KA 2KU7A 3N5FA 4DCPB 4F0MA 4KQZA 3HXMA 4EI2A 2WVDA 3UCUP 3I5CA 2GCFA 3PO4A 3R6LB 5E41A 2NPFA 3MMAA 3QSIA 3K58A 2FY8A 1KQFB 2H4WB 1S7HA 2ZH6A 3M05A 3I56S 3OW2R 4B3SF 3D0GE 4YB1P 1F2HA 3PW7A 2EEYA 3PRBA 3ITHA 5FLXU 1C1BB 3MOJB 2VBZA 3M32A 2BXJA 5DGAA 1MMNA 3MR6A 3BR8A 2C3OA 3SCIE 1HKAA 2EK6A 4O4GA 1O0BA 4UTGA 3K5MA 4YDDB 3OVBA 2JX2A 1GXUA 4A8KA 3ADAC 1NMEB 4QYRA 3UO0A 4CP5A 4EBCA 5D0RA 3EZUA 5B0EA 5KT6A 4X4TA 1LWFB 3RTVA 3VGUA 3C3LA 2L9WA 2NXNA 1DZ5A 4DCJB 1HNVB 1D0EA 3BGRA 1ZH5A 2IFXA 2ADBA 3KLHB 2WVEA 3CIMA 1BQNA 1Z2ZA 3SMZA 5EGYA 1NAQA 2BKOA 5GAEU 1T3NA 5K8MA 2ERRA 5GAHU 4L69A 4I6WA 1JKHB 1U2CA 3Q89A 2GA7A 4J9PA 5LJ5Y 5H9FK 1UVKA 2ZJPQ 2LCWA 3KJQB 4FNHA 4WFYA 4ECVA 2BANB 1GMUA 1VYAA 4NLTA 3DKDA 4MYTA 1JMTA 3VGSA 1JNRB 2B4PA 3THVA 1CEZA 5I3PA 1RGVA 3AT1B 1FI4A 2P5VA 2YWEA 2ZWOA 3DMJA 2EGWA 4WIIA 1M5HA 5LL6d 2XWXA 4CWBA 1F5BA 1B0TA 4CNZA 3KLEB 4DV5F 2AYBA 2KXHA 5KG0A 5M2PA 2DNOA 4RUAA 4ILMA 4DR7F 1IBKF 3T5HA 3ISND 3BF4A 1N0UA 3MECB 2DIVA 2ZUGA 1UWAA 1WOOA 1EP4B 2OPPB 3LTOA 3D6TB 4LR8A 2LU1A 2AWZA 1SJ1A 3C15B 5ETMA 2W9BB 2BOPA 1Q8BA 2BVZA 3QLHB 2BACA 1CJTB 5I3QA 1S9GB 4A8XA 2CNKB 5KOWA 4WCEQ 3BEGB 1FTCA 3TEHB 2R3VA 1RB0A 1HNWJ 2KG0A 1N33J 5F3ZA 4ZCKA 2J9CA 2PNWA 1QY7A 2QL7B 2YBVA 2XBPA 3T1YF 1IKWB 4M5JA 2KB2A 1YI2S 3G8SA 1RTHA 1HD1A 3RAXA 1V6ZA 5B0DA 3MM6B 4CM0A 2HFSA 3UFCX 4D3HA 5F0WA 3GTYX 2HVHA 4Q2MA 1PYTA 2DIUA 1Y3KA 2EC2A 3EVMA 4FYXB 4USMA 5CD4A 1E6VB 4B3RF 4O0NA 3CDBA 4RW7B 4QW8A 3N4WA 4I4BA 5K8OA 4DXLA 5G0RA 2MEWA 1Q7YT 4MK8A 2AU0A 1F0XA 1T9YA 4N47A 5J2PA 5IM0A 2MKSA 3PW0A 1YRTA 3ICLA 4UY85 4PEOA 2PA3A 4MK7A 3MM9B 4L73A 5CYMA 3BM7A 4P74A 3O5TB 2C3MA 3D3BJ 3PNIA 2IM2A 1R3NA 3IGNA 3B54A 4IO1A 4NLWA 6FDRA 2JC1A 3MCOA 3CJKB 1BGXT 1DHMA 1DLOB 4NA3A 2EFOA 2MKIA 2HQGA 2OH2A 1FK9B 3C46A 1U8WA 3J7ZV 4ILLA 1FJCA 1N52B 3B8HA 4FS1A 1X4AA 2QYCA 3FFIB 2F9JA 4U96A 1YKWA 3FMBA 1SJ3P 3TJ9A 4DPTA 2J8AA 2IM1A 2EBEA 2QV6A 2V67A 4ZJQA 3RRKA 1ZZNA 5F3TA 1CLFA 3PJ9A 4PWUA 3GLJA 2CPZA 3MEEB 2GGPB 3H20A 2V8HA 2IRUA 4EK2A 2R8GA 2APOA 3U1MA 3J7YI 1MNEA 9ATCB 1UDXA 2A1BA 3OLBA 3T5KA 1VQKS 4X4UA 2OJ3A 1RDRA 2XLJA 2HNDB 3NBPB 4Y2IA 2DBBA 5ETQA 3BSOA 2VODA 3FBFA 3J81U 4B17A 3QYYA 2HPUA 2F5GA 3K8VA 1H3DA 5DGBA 2B4OA 2KYZA 1ZYQA 1KVJA 3DLJA 3OXGA 1WEZA 3A8EA 4K8RA 2XYGB 3I4PA 4KFBB 1UVNA 3ENAA 3OTEA 4B9VA 4O3OA 3QWUA 3N0VA 4R0EA 2D9PA 3Q8QB 3GV7B 1NK4A 4HACB 2C3YA 2AQ4A 3GR1A 1IR0A 1DQAA 2MLZA 3A13A 4WKRA 2AZ1A 2D3UA 1JLQA 1D3WA 3LP0B 3TYTA 4ES2A 1R31A 1U6ZA 2CPYA 2B4UA 2KI2A 2PO4A 4ZLJA 5KFKA 3EZ5A 5DM7Q 4R5PB 3MCMA 4ZOSA 4A48A 4PUOA 2SXLA 3D4JA 2AJ0A 2VG6A 2CWKA 2XSJB 4E0DA 3D67A 3QPIA 5CD4H 4YR2A 1RWKB 1EJ7L 1VQOS 2ZJQS 2GIQA 4M1KA 3KHLA 5AXNA 4NE9C 3JSBA 3DRYA 1NDCA 1H74A 2HBYB 5D15A 3NG8A 2U2FA 4ZP8A 5BR8F 4KV8A 5I4MA 3R3TA 2ADCA 1AZSB 3KNGA 3KLGA 4AYBD 2KKHA 2QTWA 1JX4A 4G3IA 2Q66A 2NZ4A 1AFJA 3MPDA 1CS4A 1KLNA 2XWYA 3JYTB 1F9FA 3DHXA 1QE1B 5E7OB 1IJFB 3ZZRA 5J1EB 3HVWA 2D3O1 2E9RX 1U47A 4QJVA 3DC2A 1OQ3A 4M5MA 5CH7B 4N76A 4FYYB 3BDPA 1B7YB 1Y00A 3Q8SB 1Q16B 3CB4A 3H98A 1R8HA 2WTFA 4B9UA 3SDEB 3D6HB 3H5SA 4YS2A 3VAHA 2KVQE 1R0AB 2E9ZA 2XI3A 4LBHA 5KFWA 3U02A 3CCSS 3UE2A 3UN3A 4LRDA 2YNIA 3CCQS 1NXIA 3VGVA 2R8IA 1TKXB 1FFSB 1CULB 1YWXA 2CJ9A 4OJGA 2MY8A 3TANA 1QLNA 4DR6F 3H90A 5HSPA 3DCAA 2VONA 2RRBA 2P8IA 3I9ZA 4MIWA 4QR1A 2UXBJ 3L7UA 2AJ2A 4MKBA 1M0SA 2ZBCA 3UDCA 3ZTPA 4K50A 1T9VA 2HGMA 4ZS6A 5L9XA 3QZ7A 3OVAA 3EWGA 4JXXA 1WG1A 3NGRA 4M95A 3I5BA 5DO2A 5HATA 3QSYB 2DYAA 1EZZB 5JVHQ 2HHHJ 3RR7A 2RKIB 4KR0B 4FPRA 3R1LA 1X4DA 3K17A 3GILA 4C0OC 2BQ3A 3QT5A 2YWFA 3G6XA 1P1TA 2F40A 4A8FA 1VRTA 3K2YA 3OXFA 3TUIC 3OSPA 4TY9A 4FBUA 3JAMY 5CHCB 4MKYA 1MMLA 3RB6A 1RHKB 2BE2B 3M8PA 5H9FJ 3A3NB 4O3QA 4P2BA 1YTYA 3JTOA 3T1AA 1SL1A 2PFFB 2YX1A 2DEIA 1G3OA 1NNDA 3N5BA 3HMJG 3F73A 1KOHA 2F63A 5KT4A 4TU9A 1UCNA 1IWGA 3NEKA 3P6YC 2J0WA 1C0UA 3DOKA 2WVFA 2QMUB 4RR5A 1KQGB 3BQ1A 4YR3A 4LFCJ 5HAOA 1IBCB 2OGUA 5EHHA 3L95X 2W2NP 5KG1A 4DHVA 1F3VA 4LRAA 1MU2A 2HBQB 1JNZB 2MYFA 1FVQA 3ILLA 3KLIB 4G65A 4LREA 4R0JA 4CTAA 5E3QA 4JI0J 2R7UA 1IKVA 1YQHA 2XHWA 2R7WA 4DSIA 2BE9B 2J6TA 1QJHA 4TQRA 4JB8B 4JYAF 3ET6A 2AZ3A 3AQPA 4B9SA 1SUQB 1REVA 3KJNB 1YG0A 2MZSA 3D1OA 3GSDA 4LRBA 1NDKA 2BE7D 1R43A 4AL7A 4O23A 3OBIA 1LFPA 4DN0A 4RW8B 1NK5A 5J1EA 3IGVA 1N32J 4TYBA 3NOGA 2YH1A 3EUNA 1VLYA 1RT5B 2NSBA 4OV1A 4F4XA 3NS7B 4LF5J 2DD8S 4Y65A 2W2OP 4Y6IA 4X66J 1F5AA 1TFYA 5AXKA 2XLIA 2K1RB 1UJ5A 2KJVA 1VC5A 1EUYA 3E2EA 3D28A 2EKYA 3SSSA 3CJ3A 3R5CA 2XZDB 5D4NA 2FDNA 1UEUA 4ED4A 3OFGA 3MAQA 4QIFA 1SIWB 2IA6A 5HP1B 4LSLB 4KHRA 4WFNQ 2HS4A 1HIYA 2M8HA 3BO4A 2WOMA 5J2NB 2R2TA 1X7VA 5C25A 4MMOA 1S1TB 2KM8B 1R0CB 5DQHA 4QCLA 2VICA 2Z2MA 2LXFA 2W2QP 1IM6A 1FEHA 3BKTA 3GONA 4A8QA 4DQIA 1SQGA 1RZMA 4F26A 2P2CB 2HFNA 2JRSA 3IR5B 2VFUA 3M2VA 2JEFA 5A6PA 3MFIA 3OT9A 3D2WA 4DLEA 4NLGA 5G0RB 2IA0A 3AJ1A 3CVKA 2W4PA 1UWBB 3DOLB 3M6UA 5HI7A 2GAGC 4FYDA 4C4WA 1IWAA 4P75A 2CXEA 2B9WA 2CQIA 1S6UA 4P6QA 2XLKA 5D78A 2FB0A 4Q5VA 3G8TA 2G1DA 2Y3YA 5IS2A 4LF8J 1RADB 4XIUA 3AOBA 3POTB 3LALA 3QIPB 1N5QA 3Q8UA 1YZ6A 4H4KC 3TZWA 1WJ9A 3MM8B 2FGOA 4KO0A 4ZHRB 2DH7A 2ASLA 2VL1A 3QRRA 1HWKA 1YZ7A 4IFVA 4NWBA 3C66A 1FKOB 1Y9OA 3BB5A 3GP9A 4N8NA 4J9NA 4ZVSB 3VAGA 3J80Y 4ZLLA 1VOMA 4PXEA 2DGOA 4NOHA 5E3RA 5L1LA 3B78A 1WORA 2DHAA 2DJWA 2PT0A 4XK8C 4EU0A 5C5JA 2FLNA 2D9OA 2QT7A 4RUHA 2RRAA 2DH8A 1HNXF 1Q8KA 2QA4G 2EW9A 3MAAA 1ZETA 4JI7J 2F4VF 3AHPA 2AJ1A 4CLFA 3BDEA 4NMXA 1MN9A 2F4VJ 4J5OA 4I56A 1S1UB 2VBXA 2RE1A 3CCJS 1N48A 4NXMF 1C1CA 1O0PA 2FVQA 1TL4A 3HHNB 1AYEA 5I3UB 2WBMA 4LQ9A 5IZNA 2Q43A 2AJFE 2ZKTA 4LVNP 1WELA 3FJ2A 4MKVA 2PGCA 1RT6B 3MAHA 4UOCA 4E2FB 2UXDF 1D8YA 1OY6A 1F1BB 1MWZA 2BANA 2DR6A 2M52A 5AXLA 1WTFA 3BGUA 2WB1D 3IAM9 3BO3A 4ZLNA 2GW8A 1FFWB 2EFNA 1HLWA 1I1GA 2O3DA 4RW6A 1L5UA 1ELOA 3AAWB 2ZHOA 4Q8FA 3AODA 1FRXA 3SCLE 4M5KA 3EXCX 3SXLA 4BC9A 4GC6A 3F44A 4JI5J 4B3OA 1X0PA 3LGHA 3NCRA 3MF5A 2J76E 4M5DB 4RKUC 3KXDA 2V2KA 4U7UD 4I68A 1IVZA 1QVGR 5GAEW 5K5MA 1RHJB 3N01A 5CA5A 2N7YA 2XS5A 1P9YA 1HNVA 2QMXA 2YNGA 3AH6A 5HQLA 2GVDA 1WHXA 2E1AA 2V8DA 2XSJA 4JI8J 1RTIB 3DDNA 1HBNA 2GAEA 4Q7AA 1YJNS 1CG2A 3AD9C 1H73A 1V5VA 3GFYA 2M0GB 3OXLA 4ZHRA 3IWNC 3NS5A 2CDQA 5E5NA 5KFUA 1HI0P 1NU4A 2D41A 4FF2A 2B8PA 3G87A 1TU0B 2V8VA 3IWLA 5IXUA 3K59A 4E8BA 1WC0A 3DLKA 3MMBA 1EHWA 2G2YA 2BYCA 3DRPA 4IG0A 5IM0B 5HO4A 3FK4A 1SC6A 4CLKA 4IOAS 2DGXA 5J2PB 2CNNB 3CJ8A 4NLPA 5BYQA 4F7VA 5CYJA 4DL7A 1U1RA 1X9WA 3DRSA 1DARA 1GQEA 3K8WA 4NX9A 5B0CA 2C2RA 3BGLA 1BMQB 1ZAVA 2Q3PA 2VBYA 4JV5F 3ZTQA 4LF4J 3VGTA 4RW7A 2V2QA 1M5OC 2FVSA 2B9EA 4TVAB 3IC1A 3MXHP 4MT1A 2O01C 4DX5A 4LFBJ 4K59A 3PEJA 2HNYA 2AHOB 2I8EA 3T5JA 1UFLA 2QLWA 3DU6A 3VVUA 1KEKA 4H4OB 2DHSA 5B0AA 3HFVA 4URGA 4P2XA 4TU8A 2XQCA 4OZNA 1K1SA 1OWXA 2GGPA 3BYRA 5C42B 2E9TA 3HP6A 3ISNC 3IFEA 2C2DA 1WC4A 3ZZ0A 2VQEJ 1JJHA 1T9TA 2W1BA 1ZA2B 2NYIA 2XNRA 3H7HB 1NEEA 3G86A 2KT2A 1XNQJ 5A6WA 1NDLA 4P2FA 1T8EA 2GC8A 4GKJF 3C15A 1S6PB 2R2SA 4MYUA 1SC4B 1RAHB 2HW3A 4E98A 3PVXA 2J7WA 3MM8A 4KO0B 1GTRA 1VJQA 2BA9A 3D9BA 4C8KA 4NZ6A 2DNPA 3G82B 3AD8C 2OFHX 2EK1A 5DZ6A 4BWJA 1QTMA 3W62A 4LF6F 2P6SA 2HNYB 4OZLA 1N36F 2RU9A 3MEDA 5AE3A 2RUSA 3DOMA 2WVCA 3DM2B 3NAIA 1SL0A 2IPOB 2VC0A 1WOSA 4WXWA 2HFZA 3TOQA 4Z2XA 3G96A 2R2RA 2ATLA 2C2KB 4C9DA 4G1IA 4R8UB 4QPTA 2CIMA 4OYIA 2DNQA 3ZC4A 4WP9A 2B6AB 1S79A 5KFDA 1HA1A 3RB0A 4F2SA 1X4CA 4DPXA 1J5OA 4DR3F 2YKQA 4RJVA 4C8ZA 2K3IA 3NAHA 4RW9B 4A8MP 4TYAA 1ULRA 2A3JA 2KYXA 2QYGA 3UVJB 1H0HB 3LH2S 2J8SA 5FDLB 2P9EA 4PZVA 1CJKB 4IG3B 3DRRB 1TKDA 2HFOA 4N77A 2MKHA 3B6BA 2W9CB 4I0WA 1YX2A 3EVWA 1HBNB 1RT7B 3VAMA 2IAJA 3HHLA 1XJWB 3J7Z5 1PC4A 3GJTB 2LXUA 3M8QA 2WAQD 3TRGA 4QW9A 4F2RA 4A8SA 5LSRA 4JOUA 5J2MB 1DTQB 3CE8A 3O6QA 5CABA 4Y2AA 1S9FA 1NB2A 1UAWA 2EG1A 2G0JA 2OD4A 2YTCA 3GQCA 4DV0J 4B3OB 4ZDNA 4KGZB 3KLFA 1JWWA 1K44A 4KH0B 4Y3CA 5EWFA 2V9WA 1YVFA 1UMJA 2F8MA 2G6GA 4XAKA 3SQGA 2IJNA 4DZDA 2X3GA 3ZXWA 2JEIA 1ZOTA 1NKEA 2J7UA 2IBOA 2H5JB 1TVRB 2W01A 5IT4A 1UETA 3BKFA 2MZRA 3TZXA 4FBTA 1NDPA 1DFDA 2E7XA 4X65F 1XK8A 1J2VA 4HYKA 2IVFB 4IRKA 2AX1A 3EMTA 3HF5A 4OYOA 1BLUA 2HS0A 3IA0A 3TAMB 2XM3A 3MFHA 1X4FA 3HHLC 3BQ2A 4F4YA 2VA2A 3M30B 3B4MA 4WTYA 1JKHA 3FSXA 4XTTA 1MU2B 1T11A 4RNHA 3MM7A 2MZJA 2WONB 1S1UA 3D1HA 2K06A 4ZPAA 5D3GB 2KN4A 3T9NA 4QBUA 1KN6A 2DXFA 3T19A 4WKYA 2RD5C 2W7AA 2XMKA 5THWA 3W8PA 4F3MA 4J9QA 1U48A 2R7XA 2QLFB 4ZP9A 1FRJA 3RW7A 1X60A 1CQNA 1F60B 2OI2A 1FO1A 3K5LA 2ZE2B 2VV5A 2C2ZB 3ZTOA 1TAQA 2F3JA 2L9DA 3O1LA 1HR0F 3NNAA 2DNGA 2CJXB 2CJYB 2ASYA 4LR7A 2QIFA 5ETLA 2W7OA 3IR6B 1VHYA 2KVIA 2CUYA 2IRXA 3PJXA 2BE2A 3M8PB 3W63A 3OQ2A 4AT1B 3Q0AA 1C4AA 3AOAA 3GIMA 1AA1B 4EZ6A 4IRCA 3MD1A 4HDHA 2XHCA 5KFXA 1GTHA 2W9CA 1WWHA 5GADU 3KHGA 4IDKB 4NYZA 3UDVA 3OSNA 1N34F 1HHQA 4DR3J 1B3TA 2CJKA 2MQQA 1AZSA 1AUSL 1UJ4A 4B3MJ 3LO3A 4IFYA 1NK9A 5LSOA 1RHQB 4ZPVR 1HQEA 5J1PA 2Z0YA 1JLAB 5DDQC 1IJEB 3PM9A 1IQTA 4NYOA 1TKTA 3CTRA 2B5JB 4MK9A 4ETXA 4DV4J 2JL9A 1R0BG 2M88A 1IQZA 1QSLA 2R7RA 1RYSA 3W2WA 3WIVA 4PG7A 3K0JA 3DM2A 2PA8D 2V8PA 3R5JB 4W4MA 3TA1A 2R42A 3BJYA 4IR1A 2WOMB 3MTJA 3OTCA 2M4MA 2ZNYA 1UZHA 3Q83A 4URSA 2H65B 4DF8A 1LEOA 4U9RA 4C7QA 1C2PA 1HBUA 2DNLA 4C0HA 5F9LA 3L7OA 2QE5A 1RP5A 3NL0A 3QJLA 4X4QA 2PD1A 5EDWA 1NH7A 1JJCB 4QIWD 3G6YA 4JV0A 4DSLA 1VK3A 2YQ0A 1FRIA 2IHR1 2FQQB 2ZITA 1URNA 2V4JA 4B3TF 3A8IA 2L3MA 3CSKA 3QRPA 1U0HB 3LAMA 4USTA 3SBMA 3QFHA 3X3UA 3UCZP 2VDIA 3GR0A 1UVJA 3V2UC 5D0GA 9RUBA 1RBAA 1QE1A 2ZH4A 4NI2B 2XO7A 1QD1A 3HD1A 5FDLA 3U1NA 3VQTA 2W7PA 1XNRF 1UTAA 1WUUA 4LFBF 3PW2A 1FX4A 1R8AA 2QRRA 3LPYA 4RX6A 3R97A 4DL5A 1NRKA 4JV5J 1M1GA 2G2OA 4OI1A 1HBMB 4MAKA 1S48A 1LQ9A 3IXQA 3Q2TC 2DNYA 4U6PA 5L39A 2BQUA 2ZC3A 4PKDB 1PKUA 3CGIA 4DV1J 1LW2B 2MJNA 1K8AT 2E7VA 1YIJS 4IO9Q 2C3PA 2LFVA 3M8WA 2AJ4A 2DVIA 3SZ2A 2AV5A 4ICLB 1K47A 1Q1KA 4EYIB 3SSRA 4RO0A 4OX9J 2V50A 1SH3A 3TR5A 1C0UB 3DOKB 3MM9A 2OPQA 1S1TA 3G2XA 2X51A 1WSVA 2YKMA 5JVHS 2I2YA 4ZVHA 1HNWF 1N33F 4JI8F 1ZA1B 5B0GA 2HLTA 2RVJA 4LSLA 2V4QA 2AEJA 1WI8A 2JSXA 4ZVGA 1RWUA 2QLBB 8AT1B 4DSFA 1QVFR 3W60A 4FP9A 1YSJA 2O5DA 4XDDA 2M70A 1NPPA 1X4BA 3C8YA 5H1SV 4WFBQ 1LV5A 3PJWA 1MMDA 1KHVA 3ZZOA 3NBPA 3HT3A 1RWWB 4OHYA 1YJTA 4JI5F 4DR7J 2CQ0A 3CPWR 4FF1A 1VQNS 1X5PA 3OL6A 1RT2A 2MQMA 1S10A 2JVOA 1TL7A 2RT3A 2FYXA 3HJFA 2HLUA 3CC2S 3QGGA 4RNNA 3NMRA 4ID5A 1X0FA 4OQJA 4YB5A 2COLA 5KG4A 2HBZB 3WX4A 2BR0A 4U67Q 1TK8A 2MJUA 2ASJA 3UI3A 4RU2A 1KNZA 2UXDJ 3J81j 3PCOB 5KFSA 3RU0A 2D3ZA 3TVKA 2VG6B 3WQPA 3BPDA 3GWCA 2IDEA 3RGIA 4HKQA 2M7SA 1OO0B 1DJ0A 4UUXA 3QO9B 5HL7Q 4K4TA 5ETSA 1DLOA 1LXJA 1GMVA 2VJVA 5KFCA 1LWEB 1OIAA 3DXSX 4LRCA 2VD3A 2WSCC 3BGOP 3QNWB 3R7NB 3CJQA 5CYMB 1HNXJ 3H5XA 2M3DA 2VH7A 1JLGA 2G13A 3MI7X 1EIYB 3CJ0A 3KDNA 1A9NB 1FE0A 4OX9F 3UQSA 3HLUA 2J6SA 4I67A 3HFKA 4DQSA 1ZBTA 1F3FA 1FESA 1I5OB 5KFIA 4DCOB 2DGSA 2I1RA 1WHWA 3HKZD 5SZTA 2J6UA 1HBMA 1B4SA 1KHWA 4WE1A 4LR9A 2DNNA 2K2PA 3HZGA 4WBFA 3MGJA 5HJXA 1VBZA 3I6PA 1FWPA 1BWEA 3W9JA 1PILA 3ZFVA 2F7VA 2X1GA 4KGMA 1TV6A 4LF8F 1VRTB 3IRWP 2Y9HA 4NRTA 5GVQA 4ECRA 3PIPS 4NI2A 2ALZA 1QAYA 5I42A 2ACMA 3IBFB 3VAKA 2PSZA 1DRZA 1NSAA 1JXEA 2BKNA 5HVFA 1Q82T 3U27A 4WFBS 1WKKA 3BN4A 1NSQA 3D6FB 1RQ0A 1YK9A 2HVIA 2UV8A 5GAGI 1LWCA 4QYZK 2JZ5A 4NYPA 4B9TA 4P7TA 3J7YU 2JLGA 2HWHA 1ZPWX 3ZNJ1 2L9NA 1GX6A 5JVGQ 2O67A 2BJEA 2HRUA 4QIGA 5K14B 4ER8A 4TQSA 4RUCA 2VFTA 2Y8YA 2BW2A 1S7IA 2Y0SD 3ENWA 3IM8A 1TKXA 4CO0A 4Y2KA 1S0MA 1PC5A 4YQWA 2Z2ZA 3KLEA 1T02A 1U2RA 2HYIB 2LDYA 4YR0A 1I3OB 2FIUA 4NCGB 2FTRA 4QWDA 1AB8A 2RF2B 2XZWA 2Q1LA 4Q0BA 4EBDA 4QWCA 2OELA 4CYUA 5B7WA 1FRHA 2KXFA 3T5LA 4X66F 2DRDA 1NZAA 2ZBPA 4PG8A 4K0KF 2YKNB 1EKRA 1WG4A 3NGSA 1T3OA 4ATNA 2BKPA 2CPDA 4ZKAA 3NCPA 3OR2A 1EKSA 1RTHB 3M2RA 4C2MA 1QAIA 1QM9A 3W5YA 5F8HA 2MTLA 2MQOA 4B3MF 1N5VA 2CZ9A 2YQ3A 3TUJC 3V4IB 2VA3A 2OEMA 4M5IA 1NXZA 3MTKA 5LSLA 1N34J 1PIEA 3H5YA 3KHRA 4HT5A 3WDOA 1H72C 2NUUG 1GTSA 1W2BR 4JYAJ 2VPXB 4OI3A 1N5YB 4JI0F 5F0UA 2W8LA 5L38A 5KFVA 1IKVB 5LOQA 2HNZB 3TEGA 4O0IA 3MR5A 4NPOA 2ATCB 3KLIA 3N28A 4ZCIA 8ATCB 3A1YG 5ITHA 2A6MA 5KFLA 2HHPA 5JUMA 3CDUA 2CZVC 2J9EA 2B7BB 3C14A 3KG4A 4IH7A 3W65A 3QZ8A 4Z37A 1SBRA 2HHUA 2DHXA 2CAJA 2P9GA 2FD2A 1RTDA 4ZPDA 3VAIA 4YDXA 1TFWA 1X31C 3PYDA 1HQ2A 4ZP7A 2YWGA 2RILA 4HEA9 3EM1A 4W98A 2ZZNA 3VCDA 2NWAA 5A0YA 4JV2A 3BYPA 2NXEA 2J7KA 2EXUA 2R4FA 3KUHA 4L3KA 4ECYA 3DDIA 4OMFG 3Q8VA 4CH7A 4ZPBA 4O3PA 5F8LA 1WF2A 1VQMS 4NCBA 5E0OA 5B09A 4DFKA 1R89A 4X65J 1PBUA 1VQPS 3DGPB 3DXBA 2FVRA 2XZTB 3RG6A 1A7GE 4FF3A 4UT4A 2ROEA 2C2EA 3WX8A 1RU2A 2EWHA 3I4HX 5LMNF 3KLFB 2PIIA 1S57A 4M63A 1HBOA 1JB0C 1OY9A 1TV6B 1RA7A 4OHZA 3I96A 1B75A 3LP1B 3MEEA 5KFZA 4Y0FA 4ANEA 2RJZA 3SCKE 3MM5A 5GAHI 1HMVB 2ZH8A 2R7VA 3OV7A 4FYVB 4NLOA 5L8RC 5GAEI 3CMAS 4L76A 5IWAF 5KOXA 4LF7F 2XGPA 4V19X 2ZDPA 4DR6J 4IH6A 4IG3A 4EGLA 5KT3A 1SQEA 4G1QB 4U8VA 3TX8A 2ZOGA 3CJKA 1V3SA 4GKKJ 4FNIA 3JSRA 2FHMA 3DNCA 2JHEA 2OKQA 2AKWB 4I2PA 2PEHA 4KGXB 3TQ1A 1RKJA 1UA1A 2HGNA 3BBBA 3CJRA 3GIIA 3Q8YA 4BWMA 4OX6A 1NCLA 4U95A 5BXIA 4NRUA 4RNFA 2CYYA 2QA2A 1YJVA 2YX7A 3THPA 4K4WA 2G0CA 1GXTA 3NCQA 2PI5A 1D9FA 4ALZA 4TN2A 1JLAA 2ZZMA 2GFFA 4A46A 3G6VA 5ETRA 1K73T 1ZAWA 3VHQA 5KG7A 4ECUA 3R6GB 5A76A 5GADW 3I0RA 1FHTA 4NLSA 1E6YB 3H4BA 2HHXA 3RBXA 5BYSA 3G71S 1I6JA 5A2QY 5F8JA 5M2RA 2LVWA 3OVSA 3FSYA 4GMKA 3OL8A 1U24A 2XG8A 1R8BA 3JTPA 2O1PA 2CG8A 4ZVQB 4LF7J 3MPVA 3DGVA 2D74B 3BKUA 1ZM2A 5HLFB 3UNGC 1RTIA 4CO2A 2GHVC 2GVDB 1HW9A 2WSFC 3AJDA 3UD5A 2VBWA 3FC9A 3KK1A 4OYPA 2XY6A 1AFIA 3DLEA 2UVWA 2RF2A 1FK9A 4PCQA 4R5PA 4ZVFA 4ZVPB 4FKXA 2QJ3A 5KFRA 1VRQC 2ZBQA 3CCVS 5HJYA 3W9IA 1L3SA 4OYXA 4GKJJ 2BJDA 4CZCA 1T03B 1U1PA 2X3DA 4ED1A 4PAAA 3JQKA 2VPYB 5E3PA 2E29A 3V6DA 3NNCA 3VF0B 1XERA 1RT3B 4CH1A 2LECA 2OEKA 3SFUA 4K0KJ 1FD8A 2B43A 3W2WB 2KDOA 2R7OA 4U8YA 3TW0A 3SDEA 4N56A 2KM8C 3SFGA 3MUVP 2XY5A 2J9DA 3PRVA 4LF4F 1IR1A 3BPSP 2Y1LB 3RRHA 4ELVA 4X4VA 3PHEA 3OHAA 2K8GA 1H98A 2ZNZA 5HMYA 1U26A 1U02A 2JFKA 3OR1A 1FXLA 3QJJA 1CJVA 1RHRB 4PWDA 4PQUA 2PFDA 3IS9B 4CLYA 3GCWP 1ZZFA 5ETVA 4C11A 2I38A 5GAHW 2FHOB 3CC7S 2KZMA 4DI6A 1M1KT 1BC6A 1FRKA 5FIIA 3HSDA 5CCLA 3CO0P 4P2SA 1Q8LA 1VQ8S 3NLCA 5IQ6A 4K2XA 1DAXA 4IUFA 2E5IA 3I5AA 2GQ2A 1IM4A 4ETZA 5DG8A 1HARA 1T95A 4DPYA 2NS1B 2DB1A 3BH7B 2XS2A 4PUOB 1RT4A 5LM7E 4YB7A 3JAMU 2MKKA 1N8RT 4KC5A 4B9MA 4ZVUB 5DZ7A 4BHQA 2OD6A 2U1AA 4K5RA 2ZH1A 4DL3A 1X9MA 1JIHA 1Q53A 1VBYA 2B56A 3GU0A 3EGWB 2H48B 2ROPA 3GPAA
chains in the Genus database with same CATH topology
3HI9A 3QGIA 4ECWA 1Z4UA 4OX7A 4YB6A 1CSJA 4WJBA 4PR6A 1U45A 4PXDA 2JEJA 3M30A 3DRSB 5GADI 4JXZA 1RT6A 3ETOA 1ZPVA 5GAGU 1QRSA 1FDNA 1YJWS 1O51A 5I3UA 3DLGB 3KMSA 3QWPA 2VG7A 5KTQA 4KKOA 4YMEA 2V0NA 5A8WB 3I0SB 1FXDA 3MMCA 4RW4B 4RZRA 3HO1A 1LXNA 3H40A 2N4DA 4G1QA 4DQRA 1U4BA 4W92B 3H4DA 4QWBA 1U1OA 4ES1A 5IZHA 4GC7A 2RQMA 3V6KA 4OZJA 1V3RA 4QPXA 3AY0A 3UD3P 1DTQA 1VBXA 2RIJA 2BM1A 2PE8A 1X4GA 3G8QA 4YOEA 5B0FA 1JLCB 1BD6A 2IAJB 4DPOA 2YKMB 3I82A 2J0SD 4PQUB 4KKOB 5A8WA 2BBEA 4TLRA 1FNXH 2QEXS 1X5TA 2FUG9 4WK1A 1E6YA 2CPEA 1QRUA 2POKA 4OJ1A 5DM6S 1O8BA 2RS8A 2ZOMA 1XMOF 1J5OB 1DTTA 3R5AA 5DM6Q 1SUQA 4F02A 1SV5A 4LMZA 3TAMA 5F8GA 3H2LA 4RNOA 3FEXB 4HH0A 4HI2A 4DX8H 3V6DB 2MKJA 1UJ6A 4I2PB 4DQPA 3QAUA 2XMUA 2A2CA 2GO8A 1VGYA 3FRZA 4OLPA 3ENVA 3B4DA 2GNKA 5KG3A 1Q79A 2ZH9A 3M6XA 2QA4S 5DETA 2UUWA 1HNIA 1K0VA 5CQGA 4DV1F 1NJIT 3MUMP 2KFZA 2CFXA 1JJ4A 2PI4A 1H7WA 4IFVB 1ZM9A 4LSNB 3HHEA 4MH8A 4X84A 1VC0A 4UY88 1K1QA 2KTQA 2HHTA 4HVZA 4HHJA 3ONQA 3I31A 1NO8A 4FXDA 3CMES 3M2RB 3PIOS 5J2QA 3PEHA 4LF5F 1Y0HA 3OR1B 4HTJA 4RU9A 2ZBIA 3C6TA 4M8LA 1CVJA 2OLWA 3M9OB 1EETA 2RB7A 1U1MA 3DLGA 4M94A 2YKOA 5HMWA 4ED8A 1VI7A 3FQLA 2ZVSA 3OTBA 3NMAA 2E5JA 2R2UA 4Q0BB 1JLEA 1GX5A 4F4KA 4J9LA 4H4MA 2DGTA 4EWTA 2MZ1A 3SV4A 4FS2A 3EYZA 3NGDA 1HWJA 2IM3A 2WK4A 2KJWA 4LFCF 5E3AA 4Q45A 4H54A 2HRYA 4DJBA 4DG1A 1N5SA 1XTZA 2LQJA 4ECTA 4HL9A 3MR2A 2JLEA 4DV4F 4O3RA 1UA0A 3M9MB 1HWLA 1S1VA 4NL5A 1WG5A 2GO9A 2D3OR 1NJXA 1S9EA 3I87A 3KHHA 2IVYA 1Q86T 2CPIA 4FVMA 2N3OA 3LGNA 3DHWC 4M5DA 3NNHA 1C1BA 3EXYA 4F4WA 5HL7S 5SUHA 1C0TB 3OR2B 3N9UC 4OI4A 3E51A 4FN5A 2HZCA 3UR0A 1U1NA 1VQ7S 4QYZJ 5HROA 5E2QA 2VASA 3V5RA 3LQVA 5K8NA 1X4EA 2C28A 1UL3A 3MEGA 5AXMA 1OQ6A 1HI1A 4TKTA 3OJUA 1X5OA 3PX4A 1YRXA 3K7RA 1UW4A 2B51A 2UXBF 1JLGB 3M1VB 1IKYB 3QGPA 4IOBA 4NLYA 1T7PA 4CI0B 2OPRA 3CDEA 3FQKA 3FVYA 3LOUA 5KG2A 4NLXA 1S0VA 2P9CA 3PFOA 1X9SA 3US5A 4OI6A 1DBDA 1M5PC 2HMIA 4TXSA 2YWHA 4UW2A 4C3MA 1V6HA 4QZVB 3NKYA 3GG1A 3KK2B 3CJ2A 5DLFA 3EGNA 3M8RA 5A8RB 4AL5A 3KOAA 1IUJA 2HZ7A 4WCES 5I42B 4NZ7A 2XMJA 3OFEA 4AL6A 5G4DA 5KT5A 5MAOA 1RT2B 4J9OA 5F8NA 4RBVA 4C11B 3DGPA 1IN0A 3H59A 5U47A 3KK3A 4U67S 2A10A 4RW6B 5D4LA 2MMYA 4DV0F 2Y1JA 3RZAA 4J9SA 1VFJA 3HKWA 4ED6A 2B6AA 2KRRA 4OHVA 1TL1A 4OLOA 4AFFA 2M2BA 4OIXA 4J9RA 2ZD1A 4CCHA 3OL9A 5F41A 3GYNA 4EYHB 4TY8A 3HVAA 4C8NA 4TNOA 2DR8A 1RTDB 4PG6A 1FNOA 3GFHA 5K9FA 2EG2A 2BQRA 2J0QD 3ISZA 1N56A 3KJVA 5DDOC 2ZJPS 1S49A 1IBLF 3T6JA 4C0BA 1LWEA 2P6TA 1FKAF 4BC7A 2FC8A 2FLPA 3GV8B 2CPJA 4ECQA 3RB4A 5KFQA 2E44A 2XS7A 3E01B 2ZKUA 2CQ4A 3DLHA 4ED0A 3HHKA 3OL7A 3TO8A 2GX8A 2Q79A 3H2VE 1FEEA 1FT8A 1WI6A 1W25A 3IG1B 2W9AA 2HQIA 4X4UA 4RW4A 4B08A 1U1QA 1SH0A 2HQ3A 3IS9A 5DDPC 5CYQA 4ECXA 4K4VA 4CT9A 2YX4A 1RTJB 2ZOFA 3GMGA 3RBEA 4K4ZA 4V194 5KG5A 3R1HA 1FDDA 3I32A 4LF9F 2GHPA 3FCHA 2GV1A 1UWBA 3DOLA 4X4PA 3RAQA 1XNQF 2IYGA 1VQ9S 2AJQA 4Q43A 1KD1T 2W4DA 1FRLA 1FJGF 2VQEF 2ACYA 4C8YA 4LJMA 4J37A 4JYZA 4Y2CA 2I9SA 2IVMA 4IRDA 5J2NA 4DSJA 1YGYA 2AW0A 4B9NA 3IBWA 2MKCA 4QWEA 3PX6A 2CQ2A 3DLEB 4DN9A 2DNMA 4A47A 4I6YA 1LWCB 2DTJA 4ED7A 3PACA 2JOQA 1BY9A 1NKBA 4LIRA 1U8SA 2MPUA 2N7CA 4AE5A 5HMXA 4ID5B 2OO4A 3BO2A 4QOTA 5D6GA 3LW5C 2DNZA 2AGOA 2ZH5A 1OPIA 2OSRA 2JC0A 1D9AA 2UVVA 4P7VA 2VPZB 1WD6A 4OJ3A 1KLMB 2I0XA 1NHUA 1OSDA 2RKIA 3T6BA 3KK2A 5KFAA 5EUHA 4OI2A 4ZA1A 1OSCA 2W9BA 2CJBA 3Q23A 1EP4A 1DURA 4Q44A 2L48A 3ZZTA 1JLQB 5LJ3Y 2FJVA 4KHMA 2J5AA 3UWTA 3H5UA 4NCGA 1VQ6S 4ED5A 1N6QA 3GZ7A 3QAEA 1HFEL 2AD9A 2RD2A 3LGMA 1RISA 4CIOA 1L3UA 4C8LA 2FGCA 1VQLS 4DLGA 2R8JA 3D5MA 3HHLD 3MM7B 2EFGA 4OFZA 3PR4A 2DGWA 4IO9S 3RR8A 2RDJA 4WK3A 2B5JA 1L3KA 1VQSA 3K5NA 1TAUA 4O4RA 2EFQA 2XMVA 3DN9A 1NK7A 1S76D 1HQEB 2J0XA 2DO4A 1JLFB 2QA1A 2OAUA 3BSCA 4JBCA 2DT9A 2VUGA 2KRBA 2H5EA 3N6NA 5HMZA 3V4IA 2OPSA 2FJEB 1Q81T 2BDPA 3UR3C 2I5JB 1TUVA 2C22A 1MROA 1XMBA 1Q4RA 2DNHA 4JI7F 2YNFA 5EX0A 2RSQA 2DGQA 3GB0A 4MFBA 3UD4P 2GQCA 4OZ0A 4Y2MA 3D54A 2YKPA 3P3DA 4IOCQ 2A2DA 2DITA 2DNRA 5KFYA 5T7LA 3BGFA 1YJRA 2ZHAA 1EXDA 2FC9A 2HHWA 1MWYA 2AYGA 3SYZA 4PPZA 2K7JA 5KFPA 3EPGA 2CQDA 1B0PA 4FZVA 1IKXB 3GIKA 3K57A 1HHTP 5K14A 3TUZC 5E33A 2ZJQQ 3AQOA 2E1MC 1SJ4P 1SV5B 1Y5IB 3P5TL 1E6VA 1QAXA 3NWGA 1HMVA 4WFXA 1UVMA 3MZIA 4ELUA 4HLBA 2V9KA 5BYRA 2X1AA 4R25A 2CZ4A 3CIZA 1FEUA 2VFVA 3HVTB 3H2UB 3HX9A 4KB7A 5J1NA 3VAFA 2V94A 5L1JA 2B3TB 1LWFA 4ZCLA 4LSNA 5FLXY 4BBYA 2WBRA 4KSEB 3MURP 4LIWA 2E1CA 1R8CA 1AXQA 1N4LA 1KTVA 2NXUA 1AW0A 3LP2A 3MECA 4CO5A 3LF0A 1FNMA 4O44B 1RA6A 4B9LA 2VOPA 4K4XA 1JJ2R 2LKZA 2FJXA 3PKMA 4FVCA 4QU7A 3DU5A 4KPYA 1N32F 3PR5B 4NLUA 3CCZA 4UQGA 4I1TA 2Z2LA 3BSAA 4TLQA 3BS9A 2ZH2A 3TARA 4HI1A 2ZD1B 3LWMA 2XMWA 2DGVA 2NPIA 1NK6A 5KFNA 3PFEA 1S4FA 2HVZA 1FJEB 2E1RA 5KFEA 4OX8A 4A8YA 2AGQA 1MW7A 2EVZA 2A18A 2L08A 1SB6A 1HWUA 1XEZA 3MEKA 3CWJA 1B64A 5KFFA 2RMLA 1KFSA 1RT7A 3FGVA 1HQUA 4O3NA 1LW0A 2KFYA 4JI1F 2CG4A 2CKWA 2OSQA 4IYQA 1T05B 1VQYA 2UUTA 1CC8A 3OUYA 1WF1A 4DL0C 1FRMA 2MHNA 4CO1A 4XPCA 4K4YA 3ULHA 1V9OA 1FERA 1WEYA 1HPZA 1RI7A 3M4XA 2XEXA 2N82B 3CXCR 2ILZA 2HHHF 3W7BA 2R7QA 1PSDA 1HWIA 4WYWA 3WC2A 2MGZA 2BM0A 2KHDA 3RAMA 1S72S 1KQSR 1TVRA 3TI0A 2ZH7A 3S6EA 2HIQA 1O0CA 2QFJA 4L3NA 4AXIA 2MQPA 3SQGB 1B7FA 2XI2A 4XDCA 1XR5A 1N5TA 5CZVA 4IFYB 2Z0GA 1XR7A 2B7CB 2R8KA 1XBWA 4L72B 1F2GA 4IDKA 1RT4B 4IH5A 1UVIA 1RT1B 1QTQA 4RBUA 2YNHA 5A8RA 3TVZA 1S6OA 1XMQF 2VFRA 4KTQA 1RYRA 1SI9A 3E01A 3MMJA 1X8DA 3W2VA 2RE8A 3HHDA 2PMHA 3O3LA 2KXNB 2XSFA 1ZM4A 2HMIB 1JXLA 1URRA 1Z1ZA 3M6VA 4NXNF 5F8MA 4X2BA 4D3GA 2LQ9A 3Q22A 3MPYA 3T1HF 4DFPA 2FLLA 3KJVB 4ECZA 1S1XB 2RDIA 4QWAA 2VG7B 2YVSA 4I2QA 5AE2A 3IAS9 2MSSA 5JVGS 1K9MT 2E5LF 2B4VA 4F25A 1BQXA 3OTDA 1Y7PA 3NP5A 4GO7X 4N8OA 4TY8B 3FNNA 4C8MA 3S1TA 1Q78A 3M2VB 1TL1B 3CD6S 3TAPA 2RU3A 1RT3A 2DH9A 5DG9A 1D9DA 1HYSA 4ZP6A 5F8IA 2HNDA 4N5SA 3KK3B 3CCES 4JUZA 3E8OA 4WU2A 3JSYA 4CO4A 4LUBA 3GE9A 1LKZA 3IG1A 1IKWA 1FXRA 4J9NA 1FD2A 4G1PA 4MTPA 4URQU 2GQQA 2W25A 3T9ZA 2OIHA 4TU7A 5CZXA 1U09A 1HW8A 1HQUB 2OTJS 2CQ3A 1Z2LA 2VG5B 3FFIA 2ZDOA 4KGKA 3F41A 3NS6A 3GFZA 3VZHA 3MDFA 4DR2F 4EUVA 2NREA 3VAJA 1WHYA 1ZJWA 2ABYA 3HHLB 5KFOA 4FF4A 2V5HG 2FPHX 3FSIA 5L1KA 3CDAA 4ICLA 2HHQA 5L9NA 3FEYB 4IQMA 1WEXA 4C8OA 1GNKA 2HHVA 2UVUA 5D3GA 2UU9F 1TR0A 2KZZA 5DLGA 4WFNS 3SI8A 4I7FA 2HS3A 3MEGB 3S8SA 3MCSA 5KFBA 2MHEA 4YUDA 5BJRA 1TL3A 4K5SA 1NJWA 5DM7S 3FEZA 3JSMA 2DCUB 2XC9A 3SSQA 1S1XA 4J9KA 3PV8A 1TKZB 4C3LA 3L7PA 3KFWX 3R5DA 4WFAQ 2FJDB 2Z8QA 1T05A 3QMQA 2EPIA 4ITSA 4PXCA 2W4CA 2BRLA 3EGZA 2YY3A 1VQ5S 3AA8A 2LMIA 2V4JB 5LT5A 2JJ4D 1GAOA 2YNHB 2NLWA 2XCAA 1XWLA 2H9ZA 1HNIB 4A8OA 2CPHA 2IRYA 2OPPA 4HTIA 2B9YA 2YNFB 1DFUP 2EFPA 3QIPA 4PXBA 1P6TA 2FLOA 2OPSB 4DQQA 4W90B 3PKYA 1U2FA 4H4OA 5MLCV 1J5EF 4WF9S 3I0RB 1CC7A 1R27B 4H4MB 4JV1A 2RQKA 2V8GA 3CT9A 1S0NA 2CRLA 1JLEB 1YITS 1AUDA 1S1WA 5DRKA 3S7RA 3CCLS 3DI6A 3MMAB 2ZJRS 2VPWB 2L41A 2G9OA 3THTA 3Q2SC 3K5PA 4ID8A 2FHJA 1FKPA 2JEGA 4JI4F 3DLBA 2DR7A 1WACA 3C6TB 4GO5X 3SCJE 1YBAA 1T03A 4KRWA 1NJYA 3PDNA 4DUYF 3FRYA 4LQ3A 1OPZA 4CNYA 4XPEA 4WZMA 1H2UX 2F1FA 3M2UA 2XULA 1S9EB 2OFGX 5EWGA 3BGRB 5T7LB 5HP1A 4KAIA 3O2IA 1JLCA 1RK8A 1TL5A 5M2UA 3PIPQ 2VQFF 3H25A 5IQQA 4AXJA 3F56A 3UCGA 1SH2A 1X4HA 1VHFA 3D0IE 1S77D 3MR3A 3AB4B 2UXCF 4L6V3 4DG1B 2FHJD 2Z4PA 1MROB 2JFDA 4I64A 3VALA 7FDRA 4DV3F 3JB9k 4Q2LA 3CCMS 1KRPA 3HVTA 3M8SA 2QMWA 1UEVA 4A8WA 1QAJA 4OJHA 3GIJA 3KKFA 1AROP 2MDAA 5DG7A 3PZPA 1TKZA 3MD3A 1H2VZ 1VMBA 1RKIA 3QIDA 4OZ5A 1R8PA 1XN9A 3OFFA 1KTQA 4NA2A 2VZ9A 4WE1B 5DQGA 4X64F 2XMTA 3GYXB 5FJ4A 3NRBA 3BN7A 2C3UA 4EFAC 2LA6A 3BZQA 4DV6F 4X4NA 1KC8T 3SEOA 1M5KC 1GH8A 3WC0A 4CH0S 5CXTA 2Y1IA 2IMOA 2E66A 2F9DA 3CD7A 4WFAS 1NK8A 4OL8A 3D0HE 4I2QB 1N0VC 4IOAQ 3M6WA 3DLKB 3MMBB 5JXSA 4ES3A 1VIOA 5C25B 3MPWA 3UPFA 1XR6A 1N6QB 2IMWP 1WF0A 2FY1A 3L09A 5LXRA 3RB3A 3LP2B 1P27B 5IT0A 3ZZZA 1X5SA 2ILYA 3C6UB 4MKAA 4EO6A 2CQPA 4WU3A 5J2MA 2C42A 3BR9A 1HHSA 3NGKA 1D8ZA 5FD1A 3VTIA 5B0BA 2NUHA 3HVRA 3KK1B 3M8QB 5HBMA 3P96A 3OTOF 3AB2B 2DR9A 1L3VA 1S0OA 1IXKA 4ED3A 4WZQA 3WZ0A 2MB0B 2HWIA 3DRXA 4YEAA 3DRRA 4ZVEA 6FD1A 4PQAA 2NQPA 4DDFA 5C42A 2UUCF 2AYEA