4H4KA

Structure of the cmr2-cmr3 subcomplex of the cmr rna-silencing complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
259
Chain Sequence
VTFTPYDVLIPLPQTVAGAIRTLLFYEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRILRIEKIYAWIEDPGCGIKDILSSYEFLTLGSRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cmr subunit Cmr3
publication title Structure of the cmr2-cmr3 subcomplex of the cmr RNA silencing complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Rna binding protein
total genus 55
structure length 259
sequence length 318
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4h4kA02
3.30.70.2940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4kA01
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4kA03
4H4KA 3X1LB 3W2WB 3W2VB
chains in the Genus database with same CATH superfamily
4QWDA 1FWPA 5JVHQ 4M63A 4XIUA 2JL9A 1UVJA 4QR0A 1NEEA 1QVFR 1R89A 3LGHA 3OVAA 1B0VA 2F8HA 1D8YA 3GV8B 3T3FA 3QJLA 5K14A 3KLGA 3J81Y 2AP6A 3DYAA 2XMWA 1JJ4A 5HROB 3G9CA 4L3KA 4ECQA 1RU2A 1J27A 2PMZD 3RW7A 1ZH5A 4DCPB 2A0FB 2CG8A 2B51A 3J7YU 2EC2A 3OUYA 4UUWA 3VVTA 1T9WA 4TVAB 4RWWA 3BQ0A 2PICA 1VFJA 1FVQA 5I3UA 4DU8A 1S72S 1NB7A 4Q0BA 3BO3A 2DY9A 2FZCB 2ZC4A 4OI3A 3H2LA 3J7YI 3HD2A 5IXUA 4QBUA 2LKZA 1H2UX 1U1QA 3W8GA 5SZTA 3M8PB 2GQCA 1O51A 1UKUA 5IT9U 2DH7A 1NPRA 5DZ7A 2W4CA 4C3KA 2C2KB 5D4PA 3KUGA 1NPPA 2B9XA 1PGZA 3EM1A 3NS6A 2CJBA 4O44A 5BR8F 1QAXA 2BZ2A 4DV2J 1TFWA 4K4VA 2VG5B 4ELUA 5B0DA 5H9EJ 4UOHA 3CD0A 1WG5A 2OEKA 1PYOB 4PYDA 4FBTA 1T3OA 5LSOA 4G1QB 3AXMA 5B09A 2BW2A 3H5UA 2GQQA 2B4OA 4OLPA 2XMTA 4O4RA 3ZTQA 2UZAA 4B08A 1S5ZA 4ZLJA 2GIQA 1IKYA 5MAOA 4OJGA 2QN6B 4F3OA 3AODA 2MY7A 1NDPA 3EUNA 2KL8A 2ZJQQ 1HQEA 2MZ1A 5T41A 5AJ3F 2RD5C 1AZSB 4A47A 2HNZB 4RBUA 3UD4P 1WC6A 4DX6A 2VBWA 4JP8A 3W2VB 1K9MT 2UUCJ 1FKOA 4BLGA 3PW4A 1LWCB 2HQCA 2PEBA 2ZOGA 3GIMA 4PR6A 2R7UA 3G82A 2RMLA 2AYEA 1DURA 2GJ2A 2HRTA 4CM2A 2L08A 4RBVA 4J3CA 3MM7B 4LR7A 2M2BA 3MPWA 2I2YA 2RILA 2VOPA 4Q44A 3JQJA 4KRWA 4LRFA 1SJ4P 4FDFA 1HLWA 2ZZMA 4OX6A 2CQ4A 5BJRA 2ZE2A 2JDJA 3ZFVA 1X4EA 1NJYA 4B9NA 3BM7A 4IO9S 4HT5A 2X51A 3Q86A 2CQDA 4LRAA 1SL2A 3J7Z5 3MTKA 2AU0A 5LT5A 7FD1A 2KHDA 4OYWA 3JSMB 3U27A 1LV5A 4NA2A 4A46A 2W9CA 4A8KA 2Y0BB 3ISND 3CJSA 4FF4A 2YWEA 2OD6A 4HTJA 2HHUA 1NJWA 2W2PP 4MIWA 1QAIA 2ERRA 4F02A 3K2YA 2JVOA 4BC7A 4ITSA 3C2PA 3MEEB 5EGYA 3D66A 3I0RB 1UMJA 3D28A 3NXZA 2H48B 4ENOA 2LXIA 1WHYA 3BGOP 4LR9A 1O5JA 3T5JA 4ELTA 1NB2A 1RT1B 1UPMB 2B9EA 2QC3A 2P6TA 2XSJA 2LDYA 4IRKA 1VQNS 3QRPA 2YNFA 1VS3A 1FFSB 2KTQA 1VBZA 2GIRA 3KNGA 4WU2A 1P8GA 2ILYA 3TRGA 2UVWA 2DPJA 5DM7S 5KFFA 3KLHA 3OR1B 1VC0A 1WG4A 4F4KA 2JFKA 3EGWB 3KJFB 1Y0HA 3CCSS 4DF4A 1KOHA 1URRA 4B9LA 3QGHA 4YY3F 1YTYA 2DBBA 2BJ7A 3CCZA 4GC6A 3VTIA 3TO8A 2HHPA 2E7VA 4FF3A 2BANA 2EFOA 3HSGA 3K0JA 2OELA 4AD6A 4NLXA 4J9KA 4WXWA 4ZLPA 2HWTA 3CJ5A 1KN6A 1FDDA 4USIA 3OTEA 4P73A 3T6JA 3EVWA 3HF5A 3I0SB 2NYHA 4C8OA 1UEUA 4EI2A 4KFBB 3T41A 3D5MA 2ZWPA 1Q8IA 3OL6A 4FNHA 3MM5B 4V1Ak 4RLEA 2VPXB 3OPKA 2X1BA 4P2SA 1ITPA 3WBZA 1YI2S 4ECYA 1L3SA 1FFWB 3NS7B 2VH7A 4KV8A 1FRJA 5K8MA 1H7WA 3OJUA 3Q24A 1KONA 4M94A 7AT1B 2RHSB 1ZM2A 5ETPA 3Q2TC 2C28A 3NMAA 2ZUGA 3C66A 3HKZD 1PIEA 1FTCA 2CRLA 5C42B 3W65A 1E6VB 2MZJA 2WVCA 2FHKA 3A8KA 3ULHA 1RZMA 2J9DA 2DNMA 3IG1B 3DHXA 1I6JA 2EBEA 4E0DA 4J9MA 2UXCF 4WFXA 1KKHA 1QTMA 2D9PA 2G0CA 2VD3A 4H4KC 1NZAA 4DPXA 2IHR1 3AA9A 4MK8A 3PIPS 3AIIA 1MLAA 4IOAS 4C3MA 2IJFA 2DGOA 3D6MB 1RAFB 3HK2A 3TQEA 2AJ4A 4C9DA 5RUBA 1GXTA 1FEHA 1XNQF 4JI3J 1RTIA 3ZC4A 2AYMA 1JXVA 3BS9A 1G1XA 1RHMB 3Q2SC 1X5SA 3MCNA 1VC6A 3OSPA 4W92B 2HRYA 9ATCB 3TX0A 1NKEA 3OTOJ 3MHYA 4HI2A 3BSAA 3PW5A 1RDRA 2RDIA 3SI8A 1UDXA 4TXSA 3TAMB 1C0TA 4DV4J 3PYDA 3K5LA 4CP5A 4CT8A 1H6KX 5D6GA 3ENAA 1C2PA 2LU1A 3Q8VA 2IA6A 3QJJA 3BYRA 3K5OA 2R7WA 3NGUA 3AFGA 2FC8A 4ERDA 2LXFA 5BYRA 1S6PB 2QTWA 3R27A 4ANDA 3T9NA 3R8YA 5HROA 2V2VA 2FVPA 2FLPA 4CDIA 2E44A 4PG7A 3QATA 1H73A 1YRTA 3LGNA 1NNDA 3MZIA 4ZPBA 3RW6A 2JC1A 3L7OA 4FYWB 1V5IB 1A7GE 2BR0A 4IQMA 2BQRA 1RBAA 3GPAA 5F3ZA 2R2UA 3ICLA 4PWUA 3KLEA 1NSPA 1RHUB 2KRRA 2RDJA 2A18A 1LW0B 2XTJP 2VODA 4F7VA 3MMCB 2MQPA 1GT8A 2IRUA 2VU5A 3M8PA 3P96A 2R8JA 5FJ4A 2KDOA 1JLFB 1YG0A 4CH1A 2BE2B 2VPZB 2E66A 1LQ9A 1CQNA 1EAYC 2XBPA 3W1YC 1FE0A 4LFBJ 1X4FA 3PDNA 1LNQA 4LFCJ 2N4CA 4ID5B 2VG5A 3LA0A 3W66A 4DR6J 4DDFA 1GEHA 4JI5J 5EN1A 4Q43A 1OIAA 4R0JA 4G1QA 2ZM6J 5KFRA 1GXUA 1SQFA 1SB6A 4LIWA 1SJ3P 4JI8J 4AXJA 4I2QB 1R0AB 1YX2A 1U6ZA 1R6VA 3FEYB 1R3NA 4M5MA 1VQ9S 2JH3A 5HBMB 1HIYA 2MGZB 3HT0A 3QT7A 2ZHAA 1DQ9A 1S77D 5AXNA 1QSYA 1KQSR 1AZSA 5ETSA 1EQ0A 4B9UA 2CQGA 1DTQB 3D3CJ 3W2VA 3B8HA 2CVIA 2D3ZA 3MD3A 2MKHA 1LWCA 1PILA 4RZRA 4OV1A 3U1MA 5F8MA 2HQFA 4JOUA 3CC7S 4WTOB 3TNVA 1XQIA 4KC5A 5KT2A 3MF5A 2FVRA 3RRGA 1SVDA 3ZO7A 1Q7LB 2ADBA 3MM7A 1YGYA 1LXNA 4WYWA 2OGUA 1VISA 3HVRA 4DX8H 2OEJA 3IP0A 4PG6A 2E5LF 3RB0A 1VK3A 1RSCA 3RG6A 3Q23A 2AJQA 2EFQA 4YMEA 4HH1A 5HVGA 4OI1A 2DISA 4USVA 5KFOA 1WSRA 4K4TA 5EWGA 3D54A 3NLCA 2Z2LA 5JMNA 3C8YA 4LF6J 2H5JB 1UZHA 2FJAB 3D6TB 5CH7B 3DRSB 1TAUA 4RR5A 2F63A 5E3AA 4B3RF 3GG0A 4CO4A 1U2CA 4U7CA 3ENQA 3MUVP 3SQOP 3MAQA 3Q8QB 1S12A 4I6AA 4YUDA 2WBMA 2V9KA 5LMNJ 1RHRB 4NZ6A 4RW6B 2IRYA 2AGOA 4LFAF 4N76A 3IA0A 5CD4H 4J7CA 6FD1A 2FDNA 2CPDA 3DLKB 2DNZA 3V2UC 2DGTA 4OJ1A 1RXOB 2IM3A 1SH2A 2XCPA 1VQ6S 2QYGA 2PFDA 1KFSA 1FXRA 5D0GA 2ZKTA 2YH1A 3MURP 4J9LA 2HZAA 3FUYA 3I55S 4DR2F 2G0JA 1NAQA 4HH0A 3HSDA 1ULRA 4I0WA 2NUUG 5H9FK 3I6PA 2E1AA 4MTPA 1TMJA 2AHOB 1MMLA 1X4HA 2ZH2A 2KZZA 1RT1A 1KBRA 2GVZB 4FYVB 2ZNYA 2P8IA 3NWRA 3O2IA 3SXLA 1X4GA 2XB2D 4PUOB 4FKXA 3BGFA 2JZ5A 1CJKB 1SL0A 2XC9A 1Q8BA 1YLXA 3LWMA 4F2RA 1R8HA 4KY3A 4F67A 3VAKA 4ZJLA 4KB7A 3W9JA 3OR1A 4EEYA 4K7QA 1UWBB 1IKXB 2DNRA 4NZ7A 1F9HA 3TP2A 3ITHB 1S0OA 1X0FA 3TJ8A 2N3LA 1FRXA 2M52A 4ZHRB 1N33J 4EBCA 5F8JA 3Q8PB 1V6HA 1B99A 2BVZA 3OHBA 1N88A 2BKNA 3MI7X 2LQ5A 5DGAA 3MTJA 3NS5A 2G5DA 4YB1P 5K8PA 4Q45A 3UFCX 1RT4A 2E29A 4LF8F 3AD9C 2L48A 1BQMA 3I0SA 2MHEA 1YJVA 3NNHA 1IM6A 2CQ2A 2W4DA 1ZM9A 4X4PA 4NLGA 1WORA 2VFVA 4U95A 1IN0A 2FVCA 1TL1B 4DCJB 2DXFA 1WJ9A 2Z56B 4FF1A 4LF9J 4AE5A 4Y2IA 4PYAA 2Z2YB 4GO7X 4ZVHA 2ZJPQ 5IZNA 4CRJA 4EYIB 1M1GA 3AY0A 4RNMA 3HSJA 3CE8A 2ACMA 4KAIA 1J5EJ 2V6AA 4C97A 3RB4A 1SQGA 3O1LA 5C42A 3PX6A 2ZOFA 4EYHB 1E6VA 3AQPA 1MW7A 1GMWD 3J7ZV 2V9WA 4XO0A 4MT1A 1LWFB 5M2UA 2O5DA 1VQ7S 2ATLA 4C6AA 1U7LA 4RL1A 1FVSA 1F2HA 4AT1B 4IH5A 4C48A 3GJQB 3IR5B 1WDDA 2HKEA 1D1UA 2IM1A 1TKDA 2OJ3A 5HO4A 3G6XA 5J1NA 4N47A 3S01A 2RUGA 3H8YA 3BKTA 1Z2ZA 2DNHA 2HVZA 3PFOA 1XERA 1WI6A 3FFIB 4RUHA 3MPDA 4FP9A 4K0KJ 4KSEB 1HNVB 2BABA 5JVHS 5AXMA 2DNOA 2Y3YA 2PMWA 1G6BA 5F0UA 4JV1A 1LFPA 1NCLA 3HJVA 3VGSA 4K4SA 5F8HA 2HSEB 3NGSA 3TWZA 3LPYA 2J5AA 1NK7A 2HGMA 2NUHA 1NRKA 5BR8J 4KTQA 4QWBA 2LEPA 5JXSA 2A2CA 1SV5B 4FVMA 3TAMA 2X1AA 2DNLA 3AAWB 1PG5B 2V2KA 5DG8A 4QIFA 1RT6B 2I8EA 1IBKF 1Q4RA 3UVJB 4X4TA 1DHMA 2PA3A 3JQMA 1S6PA 3MFIA 4IR9A 2PI4A 1ICEB 1FTRA 3PEJA 3U1NA 1BLUA 1RWUA 4P75A 4TLQA 3EX7B 4F4XA 2MLYA 5AJ3J 2XYPB 1RTDB 1OS5A 1W25A 3DI6B 4J9RA 1ZPVA 2MKKA 5ETLA 1VRUB 4O3OA 2J0WA 1VBXA 1VI7A 2DNQA 5CYJA 2DJWA 2IBOA 3KMSA 2N82B 1RWXB 4OI0A 1VQMS 2NR0A 2G1HA 5C7PA 5A76A 2LFVA 3MMCA 3FBEA 4GKJJ 3UDLA 1QD1A 2F4VF 1WHWA 2ZH7A 5LSRA 4DMZA 3RBDA 2QA2A 3EZOA 1JLFA 2BE2A 3QQCD 3WQPA 4AFFA 2C3OA 3O8WA 4FXDA 2KYZA 4HTIA 5D0HA 1CJVB 4WBFA 4ID5A 2MKCA 2HHTA 4B3TF 4DR4F 3ZTSA 4DBQA 2J8AA 1D3WA 5DO2A 4USKA 3R5JB 2PI5A 3TA0A 2WVDA 1OQ3A 3A4TA 4V194 3NAIA 1R0AA 3CDBA 3PW7A 1R8BA 3GJTB 1UW4A 4MK7A 1FEUA 5HBMA 2MGZA 3R9LA 1GMUA 4K4ZA 2YKOA 1FXLA 3BV8A 2R2TA 2C2EA 4CO0A 4K4WA 2HS3A 1DTQA 1XN9A 4GKKJ 1RWKB 3MCOA 1FRKA 3N4WA 4USHA 2AWZA 5J2QB 3CJ3A 5GAGU 2R7XA 2A6MA 2ADCA 4WKRA 2CQ3A 1KVJA 3DRXA 2GGPB 5J2PA 2HFUA 5KT3A 1ELOA 3BDEA 3QT5A 2YX7A 4L69A 2I5JB 5AXKA 4O23A 1XR6A 1FO1A 1LFWA 1TL4A 1QSLA 4FYYB 2FY1A 3GTYX 2G4BA 1RYRA 2DNNA 3SV4A 2F4FA 2XHWA 1VRQC 2VBXA 4WK3A 4K4XA 2EFPA 3H2VE 3I82A 2R8HA 4ZP7A 3J7AN 1P27B 3QYYA 3BQ1A 2NXJA 1EKRA 4WP9A 3DRSA 4RKUC 4CNZA 2C3PA 4IYQA 3MM9B 2CQCA 1MN7A 5FDLB 2KZMA 1WSVA 3MMAB 9RUBA 5KFLA 4RW6A 2P9EA 3OBIA 5I42B 4F26A 3QRRA 3AJDA 1AFIA 5HP1A 4DR5J 2RT3A 4K59A 3WX8A 4U67Q 3DLKA 1Q8LA 2M8DB 4JI7F 1F5AA 2BKPA 1ROFA 5K9FA 5DJBA 1FJGJ 3OL9A 1IQTA 4IFYB 1DFDA 2FJVA 5AXLA 5D3GB 4PQAA 1VC5A 1F0XA 2XNQA 1T9UA 2B9YA 2A3JA 2C42A 3HJFA 1KWMA 4Z2XA 1DAXA 5JVGQ 4DR3F 2OFGX 4KGMA 2C2MB 4LF2A 4OJ3A 1NHUA 4RU2A 2AE0X 4ZJQA 2IC3B 3F44A 1RWNB 4DV1F 4Y2AA 2B43A 1GTRA 1RTJB 4KGVB 2XWYA 3MXHP 3BBCA 2IJNA 4M5DB 4P7TA 4PUOA 4X84A 3A1YG 4X66F 1EX8A 2QIFA 2UXDF 2GJFA 2G2ZA 2DGUA 4PG5A 1TL3B 1NKBA 3VV2B 2V8VA 2D3UA 3RJMB 3GFYA 1KSPA 2XGPA 3GSIA 5JJBA 2UXCJ 3G2XA 3D7SB 3M6VA 3W9HA 3ISNC 1UWBA 1IKXA 1U26A 2JNJA 4B02A 4BHQA 3ITHA 2QJ3A 2K7KA 4CO3A 3KDNA 1WOOA 1RHQB 3PRVA 1FDBA 4ZHRA 1N32F 3MUTP 3HO1A 3R5BA 2AW0A 4TYAA 1AW0A 3G8SA 2IFXA 4DF8A 5AE3A 2IVYA 1XTZA 2BRKA 1EETB 4HI1A 3CJ2A 4J5OA 2IM0A 4M5LA 2HZ7A 3QGPA 2FIUA 3TVZA 2MKYA 5DGBA 4ZPVR 5HANA 1SJ1A 3HM9A 2OD4A 5KG0A 4KYZA 2VG6B 2M3DA 4JV0A 2GAGC 4A8XA 4B3MJ 2PI8A 3NCQA 4CLTA 3OXLA 3DRYA 1ZZFA 4QIGA 3TAQA 2QLFB 4H3SA 4ZIVA 3KNAA 5CQGA 4ECUA 2H65B 3VZHA 3ZZRA 2HBYB 3CCJS 3BJYA 4PKDB 3SMZA 4RO0A 5CYMB 3CJKA 1PJ5A 3NG8A 2VA2A 2CPYA 1BHNA 4H54A 2KXHA 3J7ZT 2WHOA 4JB8B 2KXNB 2OLWA 2KH9A 1K8AT 2ZOMA 2RJZA 2VKZG 5KG2A 2VQFJ 2X1GA 2BOPA 3IXQA 1YZ6A 1BMQB 3OL7A 1LWFA 2R7SA 3FK4A 5ADZA 2FPHX 4FBUA 4ZPWR 2GAHC 2HPUA 1UEKA 4KHRA 2DR6A 4G3IA 3JTNA 5KFCA 3AJ1A 4R25A 1KQFB 4K2XA 3G96A 3N6MA 1YWXA 4ZVEA 2YQ3A 5KFWA 2B4UA 2SXLA 1S9GB 3NAHA 3N79A 4O3NA 1R31A 4OZ5A 1KLNA 3PRDA 2GA7A 3VAFA 2HFVA 2CPEA 2HNDB 3AOBA 2DRDA 3VVUA 2M8HA 2O67A 3FFIA 3RAMA 2R7VA 3QZ7A 1E6YB 1DLOB 3MGJA 3IBCB 2WVBA 4LUBA 1HNVA 5DG7A 1SCJB 1YBUA 3D67A 5IQ6A 5D77A 4NZ0A 3PACA 3CMAS 2AF6A 4QU6A 3JTPA 4EK2A 5D8HB 2D74B 4JYAJ 5GAGW 1JK9B 3TW0A 4P2FA 3V6DB 1SV5A 3EWGA 3K17A 3SCIE 3JAMY 2QSFA 4I67A 4OJHA 1GTSA 5A0YB 1XK8A 4ZPDA 3J80U 4HR2A 3BH6B 4ED7A 4IO9Q 2MEWA 2XI3A 5B0FA 4DL2A 3PG9A 4CT9A 2IIHA 2PE8A 5F9LA 2CJQA 1JKHA 5KOWA 3IWLA 1SH3A 3EICA 5IM0A 1R0CB 1UVLA 2HBRB 1HW8A 4QPTA 1BY9A 1RTDA 3QSYB 1QJHA 3DI6A 4OYMA 4YQWA 2ZHBA 1VRUA 1UVMA 4DUZF 3BZQA 1T02A 1RACB 3PVXA 4ELVA 2QA4S 1HD0A 1RAAB 1TL7B 2YWHA 2HIYA 1ZAWA 1FD2A 3P4UB 4UY88 2J7WA 1DZ5A 1IJFB 4LQ3A 2E5LJ 1D9DA 2WSEC 1F3FA 4DV0F 1RAOA 4OZ2A 4ECSA 1HR0J 3RB3A 1SQEA 1OPZA 3HZEA 3SQGB 4F2SA 4V19X 4Q7AA 5J2MB 3MM6A 3KWMA 2JC0A 2C2DA 3H20A 2NSCA 3VAIA 1HI0P 4UT4A 2YTCA 4JI2J 2B56A 2MDAA 4ECWA 1NM2A 4LBPA 1WEYA 1CJVA 3KYLA 3PO5A 3UCGA 3QAUA 5B0GA 2FYXA 4CO2A 3UN3A 1NO8A 4I6YA 4H4OA 1VQPS 2CJAA 3L95X 1KR4A 4OZ0A 2LA6A 3HKWA 2YKNB 4Z37A 4CI0B 2BJ9A 4ZCLA 2P5VA 1VQLS 3KJVB 1QRTA 2FHJA 3HULA 2IYGA 3EZUA 4MIBA 4F04B 1B7YB 3OFEA 4I64A 2KT3A 3FMBA 2E5GA 2ZBPA 2DCLA 1L5UA 4DL4A 4NEZA 4DS4A 5DQGA 3CD7A 5BXIA 2VJUA 2VZ9A 4OZ3A 2DNKA 3U02A 2NXCA 3QWUA 5HVFA 4Q8FA 5EUHA 5J2QA 3DLLQ 2I1RA 2GGPA 2IJRA 4G1PA 1TKXB 1RHKB 4ED4A 1AFJA 2YQ1A 4OQJA 2I5JA 4M5GA 3G8TA 5E3PA 3SDEB 3CZBA 3A8IA 5CD4A 1XWLA 2HLUA 2WTFA 1HNIB 1U2RA 1PCAA 2QG9B 4C8ZA 3NBPB 3WZ0A 3G86A 1MMNA 3RYLA 1TFYA 1FWLA 1JLCB 4DPOA 3CCRS 1VQSA 4F4YA 2HNYB 4XPCA 4IH7A 4J9OA 1UVKA 2VHGA 2W8KA 4QYZJ 5IV3A 1AXQA 3MM9A 3VCDA 3CC2S 3EPIA 3MMAA 2VASA 3DXSX 1R27B 4MFBB 2CJ9A 2BUNA 5I42A 4I7FB 2OMLA 1IKVB 2M0GB 4KH0B 3DLHA 1JMTA 4RNOA 3M7VA 3MEDB 4W98A 4WU3A 4UF4A 3CCWA 4P2MA 1L3TA 2F65A 5GAEI 3E2EA 3UN5A 2FZGB 2BE9B 3C6TB 4C11B 4PPZA 4IFYA 5D3GA 1FERA 2PC6A 1FJCA 2XY6A 1Z85A 1BGXT 3D9BA 1HA1A 3LUYA 2Z8QA 2APOA 2BA9A 3KMQA 4OX9F 1TUWA 1N36J 1XEZA 4DQPA 1RBOB 2IC3A 4LR8A 4DPYA 1RAIB 2KJVA 3MAAB 3UD5A 3WDOA 1RTJA 2HRUA 1CSJA 2RF2B 1RJJA 1RLDA 2E7WA 5F0WA 1TL3A 3GE9A 2D3O1 3VALA 4ZA1A 1QM9A 1UJ6A 2W25A 2GCFA 5GMDA 3DU5A 2YNIB 4DSLA 1VHKA 3C16B 3CNQP 2W2OP 3UD3P 2LEBA 2EBGA 4CCHA 2H3EB 2VPWB 2A10A 1XBWA 2HHWA 1FRLA 1Y11A 1UJ5A 1ZTTA 4WFAQ 1EETA 3CF5Q 3UCZP 3MM8B 2R9LA 1IKWB 4E98A 2ZBRA 2ZDPA 5ETMA 4BWMA 3POTB 2ZJPS 1FESA 1AYEA 2ZDOA 4GC7A 1LW2B 3L9ZA 1T9VA 2IRXA 2VG6A 3M1VA 3CO0P 3MCMA 2MJUA 2DYAA 2GV1A 2HURA 2QLBB 3A8JA 5T7LA 3D0HE 2BJ3A 2I38A 1JLBB 2H5IB 1HNWJ 1DARA 3KUHA 3PKYA 2AT1B 3PRBA 1AROP 1GAOA 2X3GA 1XIQA 4I69A 3VAMA 5AE2A 1X9MA 3CCTA 3UDEA 5KFQA 4TQRA 4OMFG 1W7WA 2RKIB 1NKCA 2NXEA 4IQXA 1FRHA 5IT9Y 2NQPA 4USJC 4YN3B 1IBKJ 2JFDA 4FZVA 3IR6B 1OYDA 5KG4A 4M8LA 2HBZB 2CAJA 4MYUA 1VHIA 2CZ9A 4KGXB 2HVHA 4G1IA 3OFFA 2QMXA 3B4MA 3M9OB 3NEKA 3PZPA 3W5YA 1NLKL 1FX4A 2I0XA 5C24B 1RT5B 1FRMA 2MB0B 2ROEA 4NYZA 4A48A 1S9GA 2GO8A 3MD1A 2RSQA 4URSA 2AV5A 4UOCA 5DZ6A 2LP4A 2NZ4A 3P5BP 2YPZA 3UO0A 3VQTA 2DVIA 2HNDA 3BB5A 1IWGA 1NK0A 2QL9B 4WWSA 1Q81T 3H0PA 1EIYB 1F5CA 1E6YA 1DLOA 1NK5A 4IG3B 2V2ZA 2BJ1A 2F4VJ 3NGKA 4U9RA 1OPIA 2HS4A 3M2VB 4MKVA 2UXBF 1VBKA 4NE9C 4DZ6A 4R5PB 5CA5A 2QA4G 5IT0A 1G3OA 2UV8G 2MQMA 3KG4A 3H42A 5HVHA 5K5MA 3S1TA 4LFBF 3V6DA 3BH7B 2NREA 3V4MA 4DR4J 1YKWA 4DR6F 2QO3A 4JI5F 1SJFA 1VJQA 1SKRA 1GX5A 5AT1B 3JYTA 4RW4B 1U48A 3N0VA 1B0PA 4XDCA 4DHVA 2UV8A 1EUQA 4MJKA 2K8GA 3FBCA 1RWVB 3PW2A 5B0AA 1Y5IB 4A8WA 3B6BA 3HVAA 2FJEB 4DSEA 4D3HA 2NPFA 4H4MA 5D4OA 3H5YA 3TR5A 3MPYA 4FXVA 1F60B 4ZVTB 2MMYA 2HK2A 3DXBA 3RBZA 1TL7A 3AJ2A 4CWBA 1SJQA 1LOUA 3PHEA 1T9YA 2OMOA 1J2VA 2PN6A 5HLFB 4Y65A 1WC4A 4OHYA 2J0XA 5GADU 4BC9A 3QMQA 2QA1A 3JQKA 4KHMA 4LRBA 3SQGA 4NRUA 4OYZA 1WG1A 4YB6A 4B17A 5J2MA 3BGUA 5KT6A 3HHLB 5GADI 3DLBA 1S7HA 3ZTOA 2XQCA 1URNA 3BN7A 1S10A 2KKHA 1SKUB 2VV5A 2XYHB 3R97A 1T95A 3EDRB 1P1LA 1WC5A 1B75A 3JTOA 3KTQA 2NWAA 1WNEA 4X4SA 1PJ6A 2YKNA 2YKQA 2FQQB 4JI7J 4E2FB 3DM2B 2A1BA 2HVIA 3KJVA 1FF2A 3GIIA 1PO6A 4CLFA 3DOMB 2MZSA 4ED6A 3OD2A 3THVA 4L6V3 3FBBA 1NXIA 2FHMA 3IO1A 3ISZA 3UCUP 2VBYA 1G4CA 4ETXA 2ZD1B 3GZ7A 3VAGA 1GXLA 1VCTA 2MKSA 3D1QA 1S6QB 2OSRA 4RW7B 2IDLA 5E7OB 2R7OA 4J9VA 1NDKA 4KHPF 4DV1J 3CEDA 5IC6B 4HL9A 1TKXA 1S4EA 4HYKA 1QAYA 1VMBA 4TKTA 1S6UA 1MMDA 4IUFA 5HI7A 3SDEA 1VQYA 5D4LA 2RQ4A 2HAFA 1HW9A 5HQLA 4QW8A 4C8YA 5KFYA 2EFGA 1HNIA 4QOTA 2DRBA 2A6OA 4TYBA 1M1KT 1JLCA 2M9KA 3DKDA 4U67S 4X2BA 1FKPA 2HNYA 5A6WA 1N32J 3NCRA 2V8PA 4HHUA 2W2MP 2ZHOA 2OKQA 5KAKA 1REGX 4A8FA 4A8OA 2CPXA 2E7XA 4TQSA 2YXLA 4JBCA 4PCQA 3F41A 2CQIA 1VIXA 4MFBA 1XMBA 1TL5A 3SSQA 4I7FA 2KG0A 1IKVA 1S99A 5JVGS 1U2FA 3G8QA 4DV5J 3MEDA 2FGCA 3ILIA 3TUJC 3DRRB 4IFVB 4C11A 4CIOA 5IS2A 4PZVA 2HK3A 2FJXA 3TUIC 3OFGA 4UUXA 3PYGA 5E5NA 4LF9F 3US5A 1RABB 2O01C 2EK6A 2V4JB 5KFAA 1AA1B 4TY8A 4WFNQ 1IBMJ 5THWA 3WHIA 2VG7B 4F4ZA 4DEZA 3UI3A 1WI8A 2BRLA 4AUKA 4LF4F 2RF2A 1J5EF 5HK4A 4OX8A 4NLSA 1SUQB 4ED1A 3GIRA 4QU7A 2UUWA 5DM6S 3HX9A 3DRPA 1N54B 3H4DA 3ZZYA 2W2QP 3C16A 3OTCA 4X62F 3GR0A 4TU7A 4PQUB 2VQEJ 2ZVIA 2OEMA 3GYXB 4V19J 3NNAA 2KFZA 4QCLA 2N7YA 1F5BA 1XJWB 4IDKB 3EZ5A 2QZ8A 3UPFA 3MM8A 3ZNUA 1CULB 2ZEJA 1D8ZA 4WF9Q 3DLJA 4WFBQ 1O6XA 3IAS9 3W5XA 4K0KF 2EI5A 2V69A 5KG6A 1S48A 1F1BB 2VA3A 4BDPA 2FLLA 2CQBA 1QTQA 2YWWA 1JLBA 2FZKB 3BO4A 4YDDB 2JEFA 1MSWD 3T1HF 2HG4A 1VQ4S 3MFHA 2DT9A 2RKIA 4NCAA 3SEOA 4CLLA 3RB6A 4USMA 1NSQA 4G6VB 5GADW 3SCKE 2LQJA 2RH3A 2XY7A 4DR7J 4DG1B 4CTAB 3JXOA 1RI7A 3O44A 1RUSA 3FSIA 3M2RB 1ZAVA 3R2CJ 1A9NB 2Y1RI 4F8RA 4NA3A 1VLYA 4CLKA 4F3MA 3W8PA 1NXZA 3G87A 1OY9A 1UPPA 4K4YA 2Y8WA 1S0NA 3PM9A 3M8ZA 1RQ0A 3IMQJ 2ZC3A 4FPIA 1D9AA 1H3DA 3H25A 2B0GA 1UW9A 2VKRA 2ZBQA 5C24A 5A8WB 1RT5A 4TNOA 1B64A 2VF3A 2ZH3A 1JNZB 4DUZJ 1FJEB 3N5FA 5CXTA 1Q78A 3QSIA 4CLZA 1MROB 4ZMMA 3QT6A 4J9PA 3HHNB 2RQMA 4UQTA 2Q43A 3EGNA 3D4JA 3W64A 4L75A 2OUGA 3UE2A 4YHHJ 3FKBA 3N01A 4KIAA 4DV0J 3L7PA 4IG3A 2HMIA 4PRFA 4GKJF 2R3VA 1HL6A 5LSLA 3M2VA 3K5MA 1NUEA 1KP6A 1T3NA 4R5PA 2ZH8A 1T8EA 1RAEB 1YJ9S 5LOQA 2NCKL 4N41A 4C0BA 5BNZA 3AB2B 3H98A 1S76D 3H59A 3VQSA 2ZWOA 4MAKA 4N8OA 2OPQB 4TU9A 2G2OA 1H72C 2DO0A 3ENVA 3FQKA 4DV3F 1U1KA 4XAKA 4DL6A 4PWDA 3I4HX 3V81B 4RW4A 2ZUAA 1PAUB 1TR0A 1AUDA 4U7UK 5DDQC 2HGLA 3UNGC 2L9DA 3MR2A 4ALZA 4NLVA 3IN5A 3D0GE 1ZTWA 3A3OB 4OIXA 1DQAA 2J0SD 5L1JA 4IOCS 3M2UB 2BW7A 2G2YA 5DG9A 3BR9A 5L39A 1FFGB 4A4JA 2YWGA 1SKSA 2EG2A 5I3PA 2N7CA 4TY9A 3HHEA 4GKKF 1CBKA 1GX6A 1NZ8A 5E0OA 1N5SA 3HFZB 3HHLD 3IS9B 3H5XA 2F40A 2VPYB 3FC9A 2UP1A 2F9JA 5HLFA 4C0HA 2RAQA 3M6XA 1PKUA 1BWEA 4PXBA 2F8MA 2PA8D 3PYFA 2HIQA 3CDWA 2GZOA 4IRCA 4DFPA 3CPWR 4HHHA 1HBNA 3GU0A 4QWAA 1SIZA 3EJMA 2VOOA 4UTGA 4I4BA 1CJTB 2MSTA 2J7KA 1N6QA 1RLCL 1U47A 2JLEA 2WVFA 4OHWA 1TKZB 2VICA 3HHLA 4ATNA 1K0VA 2JJ4D 2F8EX 2DHHA 3NOGA 1HWLA 1NU4A 4RUAA 2FUG9 1QRUA 3W7BA 2CJYB 1RTZA 3GILA 2V4QA 2CFXA 3CCQS 2KU7A 3EXCX 2F7VA 4J91A 3J81j 1Y9OA 3BREA 2R4FA 1FDAA 2XULA 1K47A 3BPSP 1U1OA 1I3OB 1S9EA 3AHPA 4DR5F 3CJ4A 3ZZUA 3DLLS 1XMQF 1FJGF 3DOMA 2KJWA 1KFDA 5D0RA 1PYSB 2RRAA 3KDOA 4G65A 3K57A 1AUSL 2G1DA 4ZDNA 3OFHA 5T14A 4DN0A 4WZMA 2NYIA 4L76A 4WP3A 4OX9J 3N6LA 3OXFA 3PIOQ 1YQHA 1RT3B 1S6QA 4I68A 4RW7A 3MEKA 3C15B 1UFWA 2H51B 1PSDA 4NLOA 2CPIA 4F3QA 2Z2ZA 1ZYQA 4XPEA 1Y3JA 5GAHU 4DLGA 1DJ0A 3DMJB 3JSBA 4NXMF 1P9QC 4LVNP 3A13A 5K14B 3DOKA 4HVZA 1VBYA 3DOLB 3DDNA 4M5KA 3DLGB 5GAHI 3PX0A 1NK4A 3IRXB 2MKIA 2VFRA 5C2GA 2ATCB 1ZOTA 2J6UA 4C8NA 2R8KA 2EG1A 4QW9A 3KKFA 2Y9HA 2IVFB 1X60A 3OUYB 2NZCA 2WVEA 1PBAA 3NP5A 2W2NP 4OYPA 3H40A 2RQKA 4ZVSB 3RAQA 3M8SA 2OFHX 1D0EA 4JI1J 1WOSA 3F0NA 3GWCA 3W62A 1M5HA 4N7TA 3NKYA 1HPZA 2EPIA 4JV5F 5HMWA 4ZCIA 3JSRA 4NXNF 2HS0A 2W7PA 2RQCA 4B3MF 4ZKAA 4DL0C 1XR7A 3PX4A 3BGRB 2IDEA 3DRRA 4IFVA 1IBLF 3KLFB 4YP3A 4DUTA 3GYNA 4M5HA 2VL1A 3K5PA 3D3BJ 3ZZOA 1QUVA 4Y0FA 3OQ2A 3T9ZA 1SBRA 3DLEB 4PPDA 4ED3A 3HZGA 2V4JA 3BSCA 4RUCA 4WFYA 3HP6A 1OYEA 2VFTA 2B4PA 5A8KB 1MN9A 2KRBA 2JWNA 2IYIA 3K58A 3LANA 2VG7A 1YRXA 5CHCB 2F9DA 1MNEA 2HZCA 4U8VA 1SJRA 5ETVA 3ZZTA 5KFTA 2VQFF 1SUQA 1V3SA 1IKYB 4JI4J 4WFAS 4O3QA 4F50A 1NPKA 3CF5S 2CNLB 2JRSA 4GRSA 4B3SF 3OSNA 5ETTA 2XMAA 5E3RA 4C7QA 4UOFA 2HFNA 2E5HA 3MCSA 1H74A 3N28A 1U0SA 2E9ZA 4YOEA 2E5JA 5B0BA 4MKYA 2G13A 4I1TA 2WONB 2DNGA 4DSJA 3G82B 4AYBD 4R0EA 4IDKA 5HMZA 4ZLLA 1EQMA 4KH1B 3MPVA 3SFUA 1WKLA 3I9V9 3QO9B 4NMXA 1YJWS 3BN4A 1F6TA 3JS9A 2UXBJ 1N8RT 2GFFA 5KT7A 4LJMA 3KLIB 2V2QA 1OJ4A 1UFKA 4JYAF 1PYTA 2C2OB 4OHZA 4URGA 3W3SA 5FLXU 1Q86T 2DTJA 3HFKA 2DNPA 1CQMA 1DFUP 1X31C 1NJIT 3CDUA 1Y10A 5HQMA 2DK2A 2QLXA 1YBAA 3OTBA 3H90A 5L9NA 2NXNA 2CQHA 3R5GA 1N5QA 4TN2A 2DITA 3VR1A 1RAHB 3LAMA 5DLGA 5FIIA 2RDDA 4WK1A 4KKOB 4DG1A 4F36A 2JLFA 4CTAA 2DO4A 1S6OA 4URQU 3FBFA 2GO9A 4KR0B 2B6AB 3HI9A 3ZXWA 2JEGA 2EVZA 4P74A 4DOZA 4OZ1A 5DDPC 2N3OA 4KGKA 2XMKA 4ID8A 3GIJA 3BQ2A 1RKJA 2ZZNA 2RUSA 4Q2MA 2HNZA 2QV6A 4PAAA 3FNNA 1UWAA 4C4WA 2FVQA 1UZDA 3CWJA 1B70B 1MROA 5BYSA 1U1NA 1XMOJ 5D0EA 4ED2A 4LQ9A 1WACA 3IM8A 2Z58B 2Q79A 2G9OA 3HLUA 2ZITA 4BCAA 1HR0F 4P7VA 3SV3A 2POKA 4DUYF 4WE1B 1WHXA 3BF4A 1UA1A 2V50A 2H1YA 2DHSA 2X7IA 2E1PA 3KLHB 5KG7A 4P2BA 2CNKB 3CXCR 4JI2F 4ZN3A 2CKWA 1JLAB 3CB4A 1EB0A 5KFJA 4O3PA 2R7QA 2BBEA 2OPQA 1I94F 1TK8A 1D9FA 2YKPA 1HKAA 5GAHW 2OHDA 1Q5VA 3TVKA 1EKSA 3V4IB 3C46A 4YDXA 4NLDA 3PHTA 4BWJA 2B8PA 1Z1ZA 3JSMA 5LMUF 3V81A 3EVMA 4L73A 3IC1A 4MH8A 4YR3A 4RBTA 3T5LA 5F9NA 3ILLA 1I51B 4FNIA 1RWOB 4P10A 5IOLA 3R7SB 1NSAA 4OI2A 2OIHA 1RGVA 2RNEA 3PKMA 4DR1F 4WTYA 3SSRA 3M2UA 3N5BA 4OZNA 2WAQD 4DLEA 4ED5A 4QJVA 3BSNA 3MEEA 4FYXB 3I0RA 1X5PA 4OL8A 2QSWA 2BQ3A 3DN9A 3IFEA 4X64J 3QIDA 1X4CA 1SH0A 3IS9A 5D15A 3CMQA 5F8IA 4KHPJ 2WOMB 2R2RA 1M5SA 3I96A 4OZJA 2D1CA 3W2WB 1S0VA 2KO1A 2YKAA 2D41A 3PFEA 1WELA 5I4MA 2XO7A 1VQ8S 4ECRA 3WIUA 2OAUA 5KFBA 1IR2A 1I1GA 4QWEA 1PJ7A 1CJTA 2PFFB 2KXFA 1JJHA 4NMLA 1TKZA 4IR1A 1F9FA 4GVBB 4DI6A 2HFOA 2YNHB 4FS1A 2HHHF 3EPGA 3CJ8A 2XLJA 4RU9A 1ZETA 2FD2A 4ZP6A 2P6SA 4ZP8A 1D09B 5DQIA 1K0TA 5IZHA 3W5ZA 1H7XA 2KHCA 4NLWA 4DV6F 3SYZA 1T94A 2L9NA 2UUBF 3A12A 3OXGA 3I9ZA 5CCMA 3W9IA 5IWAJ 2IAJB 4HDHA 4PABA 3TUZC 3DU6A 4KFBA 4J9QA 2XS5A 4B9VA 2WCXA 4PXDA 3RR7A 3R2DJ 3MM5A 1IR0A 3Q0AA 2BDPA 3CDAA 3GB0A 4IH6A 3CT9A 2XMUA 4OX7A 3RTVA 2YH0A 2MZQA 1RT3A 1FWKA 2V8GA 1N36F 3N9UC 5HJXA 3C15A 2CG4A 3K8VA 1C0TB 2GAEA 2YWKA 1ZM3A 1GMVA 3AOAA 2EKNA 3LOUA 2D9OA 4MIAA 4LF4J 4J9SA 2EGVA 4WCEQ 1LWXA 3DMJA 1HD1A 3HD1A 2QRRA 2VFUA 4EFAC 1KOOA 3GV7B 3DOLA 5K8NA 2PMHA 3C3LA 3IG1A 1WKKA 2HFZA 1NDLA 3KK3B 3ZTRA 3DLGA 2WW4A 2W7OA 4ANCA 3M8QB 4C8LA 3IRXA 2WSCC 1K1SA 4X62J 2MXYA 4N5SA 1S1WB 2GHWA 5M2PA 3QRQA 2OPPB 1O0BA 2R7RA 2C3UA 4AL6A 3M8WA 1U1PA 3MECB 4NL5A 4U7UD 2EFNA 3FVYA 4NLRA 2HHVA 5L1KA 4U96A 2ASJA 2LA4A 2ALYB 1I5OB 5C2CA 3LAKA 1U45A 1GMWA 3ILOA 5HSPA 3UWTA 1WOPA 4KBIA 1N52B 3VGUA 1FJ7A 3KLEB 4QYRA 2HQGA 4Z7YA 4WFNS 1BE4A 1KQGB 4ED0A 5FD1A 4M5IA 3OVSA 2CQ1A 2AMCB 4AQYF 5KFXA 2Q6CA 3BGRA 4DQRA 4B9TA 2VBZA 3KLFA 4EWTA 1HNWF 1RCOB 1JLQB 3ENWA 2NSBA 1JB0C 3KK2B 1DBDA 1FX2A 3T1HJ 3DLEA 4NOHA 3RRKA 3GYGA 1X4AA 5A8KA 3TZYA 1JXLA 2GMHA 3NWGA 4WP8A 4K2JA 2EKYA 4NLQA 2XM3A 1PC5A 3CCES 3GV5B 2IMOA 5HJYA 2WSFC 2RB7A 3M9NB 1S7IA 1IUJA 2P9GA 2MLZA 1YBTA 2B8QA 4DU7A 3ZZ0A 3ADAC 3K59A 3I5CA 3J80Y 4MKAA 2ZH5A 4WF9S 1N5YB 4WFBS 2UVUA 3X1LB 5F8LA 1GQEA 2IVMA 4USWA 4NPOA 4PWWA 2AEMA 2UUAF 2ILZA 3K7RA 3M6WA 2WONA 2XMJA 3KK1B 4NCGB 1N48A 4C98A 2ASLA 1NK8A 2R8GA 1QDUB 3PJXA 1LW0A 1YJNS 3E3XA 3QO9A 3H4BA 1FE4A 1UFLA 2YQ0A 1OY6A 4NCBA 2ROPA 3R1LA 4P6QA 1XR5A 3I31A 1U09A 1M5OC 4Y2MA 3KLIA 4ZITA 2W4PA 3SBMA 4JI6J 3O6QA 3SCJE 3BYPA 2F3JA 4GMKA 8ATCB 1HNXF 4IKAA 2J76E 4DV3J 2LMIA 3FJ2A 4YR0A 3JB9k 5AE1A 1R8AA 1SC4B 4KKOA 4YS2A 1TTHB 1WD6A 2VFSA 2CADA 4I2QA 4LRCA 1TU0B 1SKWA 5HL7S 2B6AA 3GONA 3PJ9A 3I4PA 1JIHA 4OLOA 1SPBP 3QJPA 2VJVA 2RRBA 2AGPA 1X4BA 5E3CA 4EO8A 2BJEA 3H5SA 2KT2A 5A8RB 2F1FA 4ZK7M 1FRIA 4RW8B 4GVLA 3PTWA 1Q16B 5L9XA 2FJBB 2DY1A 1ZAXA 1WF2A 4ICLB 4C3LA 4DZDA 7FDRA 1UCNA 3TEHB 5KFKA 4IRDA 3L09A 1VR6A 1ZS6A 1X8DA 4B3OB 3KLVA 5KT5A 4JI0J 4WE1A 1YK9A 3MOJB 3IR7B 1VQOS 4Y2CA 1F9EB 4ZVFA 2KVIA 2BXJA 5B08A 4DFJA 4UY8T 1UETA 1QE1B 3TUPA 1JLAA 2XGQA 1Y5LB 2X1FA 3W60A 1XC9A 2RD2A 3HHDA 1JJ2R 3OVBA 4CLYA 1RWWB 3V4IA 5DDRC 3MOZA 2GMJA 3CIZA 4U8YA 1HHQA 1YJTA 2KN4A 2YKMB 4JUZA 3P8BB 1YIJS 1RT4B 1XMQJ 1BQMB 1KQKA 2ZKUA 2XO6A 4EBEA 3FQLA 3BKUA 3THPA 4HACB 2DHXA 4JV2A 2EGWA 4OYOA 4N8NA 4DJBA 3TZXA 2QLJB 3CJ0A 1SXLA 1ACMB 4Q2LA 5K8OA 3THTA 2WOMA 3GCWP 3NGTA 3HFVA 3W2WA 2ASDA 2GVZA 2A2DA 4LVOP 3AOCA 3DHWC 3LP2B 2CNOB 4N56A 3HPOA 4NXMJ 5GMEA 3Q8RB 2CJKA 4O0IA 2RHQB 1H0HB 1CJKA 2LECA 1U24A 4J37A 1FD8A 1U25A 4O3RA 2VC0A 2K3KA 3DGVA 3TANA 3QPIA 1RP5A 1TVRB 2NS1B 2L9WA 3I5BA 3M8YA 2YY3A 4DV7F 1Y5NB 2CQPA 2KM8B 1HBMB 1LK5A 4ILRA 2XLIA 2JOQA 4GVBA 1VHYA 2HQDA 2AEJA 2YNHA 5HMYA 2CZVC 3OR2B 5E33A 1NYLA 3FCVA 4LRDA 4C8KA 3HHLC 2BEFA 5DM6Q 3VGTA 2J0QD 4Y00A 3H2UB 4JV5J 2PSZA 1RBLA 4DWIA 1YDLA 3PIOS 2IAJA 4NXNJ 5EX3A 4DV5F 4QQBA 3OV7A 1UVNA 2EWHA 3M32B 1IBLJ 4WFZA 2HHXA 4I2PB 3WX4A 1TL1A 3GR1A 4P2XA 3AA8A 1V3ZA 2ZJRS 3J81U 1KS2A 3T19A 2Q1LA 3R6GB 1G2EA 1WEXA 4QIWD 1IBMF 1N5TA 1M1HA 3OHAA 1O0CA 4C8MA 1TZ0A 4JXXA 4BS2A 5KFVA 3TA1A 3ET6B 3DNCA 2GMLA 1HNZF 2DR9A 3QBCA 1YZ7A 1Q53A 3C14B 2Y8YA 2HLTA 4PG4A 3CTRA 4ZVRB 4B3SJ 5D78A 3KK3A 2OSQA 1T05B 1W2BR 3M8QA 1S1WA 2VQEF 5F8NA 1VLOA 1S1XB 4ZPTR 2OPPA 3LPEA 1TUVA 3P45B 3AD8C 2CQ0A 3MECA 4I56A 1REVB 4OHVA 5KG1A 1U8WA 1K73T 3WIVA 3IBFB 3G6YA 2G6GA 4K8RA 4KT0C 2WBRA 2MQ8A 3JSYA 3B54A 2QFJA 1A0OB 4HLBA 1EZZB 5J1EB 3MR6A 1Q95G 4P72A 1JLQA 3KK2A 1RT2B 1M5PC 4J9NA 1CVJA 1U6FA 4ECVA 1OO0B 3RRHA 3IRWP 2FGOA 4EUVA 3RGIA 1N34F 3QAEA 4EZ9A 2JSXA 1S97A 1HWIA 2BJDA 2RU3A 4YFUA 1RT6A 1MU2B 1UP1A 4DR7F 1LK7A 3UVJA 3W61A 2CX8A 3P6YC 4OYIA 5U47A 3MWBA 1CPZA 4FF2A 2LQ8A 1S1TB 1T9XA 4CO1A 1N5YA 3KJNB 2O1PA 2Y1JA 2UU9J 3CJQA 2QGFB 3IAM9 3KK1A 4IOCQ 4NCGA 4DX5A 4IG0B 3DDIA 4KPCA 4QYZK 3IWXA 2MQOA 2EFVA 1CJUB 5CZXA 1R6YA 4YHHF 2KVQE 5J2PB 4K5RA 1ZZNA 4DUYJ 4DQSA 1X7VA 2YX4A 3TZZA 1JLGB 1NDCA 1T03B 1EXDA 2QEXS 1FEEA 4ZCMA 2CDRB 3ETMA 2YVSA 1Q7YT 1JQGA 4QIEA 2XHCA 2BV3A 1L3UA 1S4FA 4EO6A 3AT1B 2C1EB 5KT4A 1I94J 4GO5X 5KFIA 1HQUB 1OSCA 5JUMA 4U6PA 4X65J 4WJBA 3T1AA 2GC8A 5LMUJ 1R7IA 2BYCA 3Q22A 1YSJA 3NGRA 3GG1A 1UVIA 4LF5J 1BQNB 5B0EA 1OY8A 1SIWB 5HQ8A 5HP1B 1GK8A 4LF7F 2CA9A 5KFDA 2C22A 1X9WA 4DR1J 2RU9A 2FTRA 1LXJA 3M30B 4Y2KA 1CS4B 5CCLA 1RISA 4WIQA 5A8RA 2Z30B 3PR4A 2RE8A 4RW8A 3NCPA 4C0OC 1JJCB 2YPYA 2QLWA 3QLHB 2DGXA 1APSA 4F4WA 4RJVA 4ICLA 2QMUB 3UW1A 5EX0A 1HWJA 2K2PA 4B3OA 4RNFA 4QZVB 2R2SA 4YR2A 3I5AA 4QPXA 3FZ2A 1WUUA 1Q5YA 3M9MB 1NMEB 2W24A 1V3RA 1BQXA 1IVZA 5C25B 1R8PA 4DL3A 3L4BC 1H2TZ 4IOBA 4DSIA 4ER8A 1QE1A 4P52A 2DHGA 4NLUA 3KHRA 5I3QA 2O66A 2HHHJ 1U4BA 1UAWA 5FDLA 1NBEB 4EGLA 1N56A 2DEIA 5GAEU 4KO0B 2LXUA 2M7SA 4F4AA 4DV6J 3AQOA 1EARA 2UUBJ 2NXUA 2YKMA 5H1SV 2FC9A 5BYQA 3ZTPA 2DXEA 2DD8S 4FPRA 4DN9A 2M4MA 2WK4A 1RA7A 4RUBA 2NPIA 3S7RA 4DQIA 2IMWP 4HACA 1YJ7A 2J6SA 1C4AA 5L1LA 2CXEA 2FJDB 3WC2A 2MKJA 3DGPB 1Y4ZB 4UQGA 3ZZZA 3FSXA 1IM4A 3T1YJ 1RE1B 4DFKA 2XEXA 3CCLS 3TOQA 3D1HA 2YX1A 4FS2A 4O4GB 5HATA 1QY7A 3CJKB 3NY0A 1FNXH 1EJ7L 4KQZA 1S49A 2HWIA 3LP2A 3MR5A 2GW8A 4M5DA 2W01A 2X3DA 1N0UA 2E5IA 3VAJA 1NJXA 3D2WA 1IBCB 5K20B 2CWKA 3I87A 2KFYA 1HQ2A 1SC1B 1NSKL 1TVRA 1Q0NA 3VAHA 3PJWA 2B9WA 3AXKA 5H9FJ 1HBMA 3PO4A 3OR2A 2XLKA 3MR7A 2BQUA 3M6UA 2BE7D 1RHJB 2H54B 5KTQA 2ASYA 1ZJWA 2BOAA 2MQNA 4JI1F 1FA0A 4IO1A 4HHJA 3U7JA 1U6BA 3TJAA 3CC4S 2R8IA 2HHSA 3K5NA 4YEAA 3M32A 2E9TA 1U02A 5ETNA 4AQYJ 3FGVA 2VUGA 1TAQA 1S59A 2KG1A 4I2PA 3ELHA 3KG1A 4WCES 2XCAA 5IQQA 4ZP9A 3OLAA 1JX4A 4ZPCA 2FY8A 3DFEA 3LWLA 2RS8A 2DIUA 3B4DA 5CYMA 5B0CA 1VDHA 3SFGA 3KJQB 4F0HA 3V6HA 2Z0GA 4P9SA 5DS7A 1KRPA 3TYTA 3KXDA 3BDPA 2AZ1A 4ETZA 3ET6A 1LWEB 1L3KA 4RPFA 3V6KA 3LP0B 1HI1A 1FXDA 2XZDB 3C14A 1N4LA 4LBIA 4JI4F 5E41A 1QSSA 1SI9A 4CLSA 1RWPB 4ZN1A 3E01B 1JKHB 1T05A 5IM0B 1KD1T 4TLRA 2YWFA 2EC0A 2QMWA 1DTTB 4FXWA 3MMJA 1S1XA 2Z2MA 1JLEB 2UUAJ 3O3LA 1AT1B 5M2RA 4X4UA 3HVTB 1TK0A 1REVA 5KFHA 4A8QA 2DR8A 2DCUB 2BX6A 2DGSA 3CMES 3C19A 4RWXA 2L41A 4M5JA 2QX0A 4UZCA 4LSNB 1B3TA 4L3NA 2CNNB 3EYZA 1CC8A 2W1BA 3QIPB 4NEYA 5J1EA 2K3IA 3MM6B 3T6BA 3HT3A 1RT7B 1S1VB 3PNIA 1V5VA 2PEHA 1RT2A 2GS8A 1H98A 1HNXJ 1LKZA 2U2FA 4DX7A 4RX6A 3KFWX 2IY5B 2KFNA 1S9FA 4LMZA 5A0YA 3BKFA 2LVWA 2ZJQS 1C1CB 4WKYA 1VQ5S 3CJRA 4N77A 3TZWA 5A2QY 1F3VA 4D3GA 5L38A 3HMJG 1MU2A 4H4OB 5KFEA 1QAJA 1X5TA 4CM0A 2HHQA 1FT8A 1WTBA 3A3NB 4OZLA 5IV4A 1S1TA 2E1MC 4DL5A 2HAIA 2DB1A 3D68A 5DRKA 3PR5B 1S1UB 4LF1A 1SC6A 4WZQA 2JEJA 1T11A 3HSZA 1IXKA 4FYDA 3UR0A 5GAEW 1QVGR 4DXLA 3RBEA 2VDHA 5F8GA 5KFZA 3GJRB 3MEGB 1XMOF 4IG0A 4CH0S 1N0VC 3G6ES 2V0NA 4A8SA 1CJUA 3OLBA 4QR2A 4ZVUB 4BBYA 1EP4B 2B5JB 1V6ZA 1RK8A 2V8HA 3CDEA 3S6EA 1J5OB 5GAGI 2GVDB 2HQ3A 4J9UE 1WC1A 1JLGA 4FKYA 3OW2R 2VC1A 1T03A 1Y3KA 3N6NA 3IGVA 3FRYA 5GVQA 3SCLE 2GHVC 3O5TB 3TVYA 2KYXA 3G6VA 4YY3J 2JLGA 4DSFA 2ACYA 1HQUA 2K7JA 3SIPB 1CC7A 4B9MA 2M5YA 4UZBA 2HVDA 1O0PA 3A8EA 5CABA 3EMTA 1K1QA 2UUTA 1FNOA 3TEGA 1RADB 1BQNA 1BUXA 5C5JA 2AX1A 3FZBA 5F41A 3HDSA 2J9CA 1T9TA 3R1HA 5DQHA 2J6TA 3UR3C 4NA1A 2I6WA 3L7UA 3M30A 1CS4A 3R7BB 3SSSA 3OTDA 1N5VA 3QFHA 2K06A 1TK5A 3F73A 3RZAA 2E1RA 2Y0SD 4MMOA 2LQBA 2EEYA 1P9YA 4X64F 1OQ6A 3QLHA 4AL7A 2DGVA 2UVRA 1AB8A 2N4DA 3KHGA 3G4SS 1QRSA 4Y28C 2PNWA 2OI2A 4F0MA 1BD6A 5IC4B 1T0TV 4ES2A 3R7NB 3LALA 5SUHA 4DPTA 2I9SA 3X3UA 2V94A 3CVKA 3W63A 2AEFA 2V68A 3G71S 2D3OR 5DLFA 1UL3A 2ZH1A 3E8OA 1QLNA 3NBPA 4DV7J 5LJ5Y 5C25A 3GFHA 5DETA 4RNHA 1JWWA 2XY5A 1P6TA 2HQIA 2DH8A 1V9OA 4NRTA 2HWHA 1HBOB 3TI0A 2V67A 3MR3A 6AT1B 3ZNJ1 3FEZA 3EXYA 1XNRF 2XS2A 5KFMA 1GNKA 4LIRA 2C3YA 3M8RA 2LCWA 1KTVA 4KO0A 3UQSA 3D0IE 1BWVA 4NLPA 1C0UB 2AIRB 1KHWA 1P1TA 3NGDA 2LQ9A 1XNQJ 4NYPA 4NWBA 3RU0A 5LM7E 1VJWA 5IWAF 1H38A 2ZH4A 2FB0A 3R5DA 2J9DE 1W26A 4YB7A 2CUYA 3Q8SB 3C6TA 1TP7A 4NLYA 3M1VB 3KUEA 1TKTB 1RU1A 4YB5A 2XS7A 2MY8A 2H9ZA 3CO9A 2BM1A 2PJJA 2LEAA 5T7LB 1C1BB 4X4RA 3BEGB 3DGPA 3Q8UA 2OP5A 2JX2A 4OI6A 2Q6BA 4XTTA 2U1AA 3E51A 3GFZA 3Q83A 2B7BB 4O4GA 1U1LA 4CLUA 1HI8A 2XMMA 3MAAA 1MG7A 2H5EA 4DS5A 8AT1B 3K8WA 3P3DA 3CCMS 1YHQS 2CIMA 1HNZJ 3GJSB 3TJ9A 4CYUB 1VHFA 2ALZA 2OPRB 2H4WB 1FCAA 4XDDA 1HWKA 1ZM4A 1RB0A 1KVKA 1W2IA 4UY85 5D4NA 1HYSB 4B9SA 2YNIA 1PBUA 4KJIA 1Q1KA 3LP1B 1VGYA 2MYFA 3V6JA 1DY3A 1KVIA 3UNYA 1SC3B 4M1KA 2Y1IA 3DC2A 2OPSB 1RAGB 1KTQA 2PT0A 3R6LB 1G7CB 1S57A 3GQCA 2OTLS 2Q3PA 4MKBA 2GHPA 1PC4A 2C2ZB 1IKWA 2O3DA 5CAAA 3NMRA 1GTEA 2W9BB 3V5RA 1YJRA 1ZPWX 3AD7C 3POTA 4CNYA 5DDOC 1LW2A 1TQLA 1X0PA 3NRBA 3M4XA 2QL7B 2J8SA 1M5VC 4K5SA 2JVRA 1YRUA 1HWUA 1UTAA 4WPAA 4A8MP 2L3MA 3LF0A 2EK1A 2CYYA 4EMDA 3Q89A 3KOAA 3D6HB 3CCUS 2PDAA 2PGCA 3LQVA 3GMGA 1N34J 5KFPA 4CQ1A 3OT9A 4DV2F 2DNYA 3GP9A 3R5CA 4PEOA 3FCWA 1CG2A 5KG5A 2ZNZA 3JYTB 1LWEA 3T5KA 1DQ8A 3K89A 5FLXY 1UJ4A 3LP0A 1T7PA 4Y3CA 3S8SA 4E8UA 3PYEA 1Q82T 8RUCA 3EE3A 2W9AA 1KLMB 3E01A 5HAOA 1SL1A 1KNZA 1B0TA 2QT7A 1H2VZ 3ONQA 2P2CB 3EGVA 1WF1A 2C3MA 4ZVQB 1DTTA 1NK6A 4K4UA 2C2NA 4H4MB 2BACA 3BSOA 2KI2A 2AGQA 2QFIA 1JLEA 5HL7Q 2UUCF 4XK8C 3HVTA 3LO3A 1X9SA 3C6UB 2MZTA 1ZA1B 2VDIA 3EVOA 4OI4A 1TV6B 4UW2A 5KOXA 3BGLA 4DPUA 2CPZA 4O3SA 1FK9B 4LSNA 1PAEX 2K1RB 2ZH6A 2BJ8A 3QIPA 1KEKA 1VQKS 1FHTA 5A2QU 2R42A 1Q79A 3IWNC 2WB1D 3I56S 1RT7A 2FHJD 4JI6F 1S1VA 4ED8A 2DGWA 3FMWA 2COLA 3VF0B 3LH2S 2MPUA 4C2MA 1WTFA 1U1MA 4B3RJ 1HBUB 2LYVA 3FDSA 4W4MA 1Z4UA 3J7A1 2V4RA 1C1CA 5DM7Q 4ZJOA 5J2NB 2RRNA 4LFAJ 3VGVA 3I32A 1UEVA 1B7FA 1U1RA 4LF7J 3IM9A 2CVEA 2B7CB 4A8YA 1UA0A 3NOCA 1IR1A 1L3VA 5ITHA 4CLWA 5B7WA 1S1UA 4NI2B 4OYAA 2EXUA 4ZVOB 4HDGA 1HMVB 2IBKA 4DR2J 5EDWA 2CZ4A 1A6LA 3CSKA 6FDRA 1S79A 3CW2C 1GFWB 4MK9A 3BBFA 4HT7A 2E9RX 1M90T 5L8RC 2IM2A 2ZVSA 3MEGA 2HYIB 4JXZA 1RWMB 2ZFHA 4LSLB 2YNGB 3CULA 3OL8A 2XI2A 2GX8A 2J9EA 1M0SA 1EP4A 3QNWB 2B5JA 5EHHA 4ZPAA 4H4KA 2CJXB 4M5NA 4JI0F 1J5OA 2GVDA 2GJIA 5E2QA 4O0NA 1ZA2B 3MMBB 4UOGA 3BBBA 5J1PA 4DL7A 4PG8A 3HHKA 3RUBL 3VZIA 1CEZA 3OJSA 3LTOA 2ABYA 2PD1A 3P5TL 3GCXP 4RW9B 4DQQA 3ZZPA 2RVJA 1FKPB 2DEJA 2MJNA 2AQ4A 2HGNA 3GSDA 4DCOB 2HVEA 3KW2A 3P49B 1IJEB 2GQ2A 4PXCA 5G0RB 2B4VA 1DRZA 2G0IA 4QIVA 1VRTB 5IFMA 1HFEL 4X4VA 2FVSA 1HHSA 2AD9A 1BXNA 3DM2A 2RS2A 4LF8J 1RTHB 4QR1A 3PIPQ 3TQ1A 2ZBIA 5CYQB 3DCAA 4IOAQ 4R8UB 2YBVA 1U0HB 3T5HA 2XMVA 1WF0A 4ZVGA 5HMXA 4KPYA 4FN5A 4X4OA 4CO5A 1O8BA 2ZD1A 3UDCA 3CD5A 1FNMA 1EHWA 2XG8A 5MLCV 4DFMA 4ES1A 3D1OA 2XSFA 4TY8B 2V63A 4OFZA 3VWSA 3ETOA 3CUNA 1IWAA 1RAJA 2D7SA 5L46A 2XWXA 1C4CA 4I6WA 4ZLNA 2ZH9A 3KLGB 2ZJRQ 1YVFA 3DYAB 2WRMA 5L1IA 5LJ3Y 1RA6A 4WIIA 4MYTA 4JYZA 3RR8A 3QGGA 2E1CA 4EU0A 4Q5VA 3DRPB 2HEKA 3TARA 2V8DA 3U1LA 1KDNA 1X5OA 2HZVA 3IBWA 1HBOA 5I3UB 1VIOA 4J90A 4Q0BB 1VK8A 4ECXA 5ETQA 3PCOB 1C0UA 3EDQB 1KC8T 1YJUA 1CLFA 4JI3F 1Z2LA 4KGZB 3AH6A 3DDKA 4S0MA 3TAPA 3MPUB 2MHNA 1D6KA 2CPJA 1HHTP 2AX0A 2MQLA 2D69A 2RE1A 2V5HG 1TKTA 3CD6S 1M5KC 3OTOF 4Q8EA 2W8LA 3Q8YA 5KFUA 1WHVA 3EGZA 1R43A 2HBQB 3IGNA 1C1BA 1WC0A 3FRZA 3BPDA 4O44B 5ETOA 1LEOA 3PEHA 4HEA9 1F2GA 4LREA 3B82A 1R8CA 2MQQA 4ZVPB 3BR8A 4DV4F 4AXIA 5KFGA 3BO2A 4E8BA 1NK9A 4LBHA 3QFWA 2DIVA 4NYOA 4LT6A 1TMMA 2IPOB 4CYUA 2OPRA 3MAHA 2XZWA 2XZTB 1S0MA 1YITS 2Y1LB 2AJFE 3QWPA 1HYSA 2HFSA 1HQEB 5LXYA 3LP1A 1WEZA 4PQUA 3R3TA 2PIIA 3CIMA 2WW8A 5EWEA 1FKOB 1FDNA 3UN2A 2OPSA 2NLWA 5IT4A 2OO4A 2KM8C 3VHQA 1CULA 2OTJS 2H4YB 2AKWB 3PW0A 2W9BA 4ANEA 4QWCA 3QZ8A 5KG3A 4L74A 1NHKL 2HMIB 3JAMU 2OH2A 2BM0A 2Z4PA 1U8SA 1TELA 2ZE2B 4WXOA 4HKQA 4M95A 1WWHA 3CJTA 2R7TA 2IA0A 4ZOSA 2MZRA 2ROGA 1NH7A 3KG0A 2AYBA 5KFSA 2W7AA 2KT5A 4OHXA 4LFCF 2V34A 1TUGB 2CPFA 2LU2A 4B3TJ 5G4DA 1NH8A 4USTA 4P71A 4ECTA 1NHVA 4ILLA 2ZM6F 1JXEA 3B78A 4OYXA 4PWDB 4ECZA 3M2RA 2W9CB 2QYCA 2RIJA 4AL5A 4LSZB 4JI8F 4ES3A 2HW3A 3L3CA 1VOMA 4NX9A 3GFXA 3TA2A 1KLMA 3LGMA 1Y00A 2PO4A 4DSKA 1RKIA 3MUMP 3HCXA 2BMBA 5A8WA 3PV8A 1MWZA 2Z0YA 1WC3A 3ILJA 2EW9A 3PXGa 2UU9F 2DR5A 1HARA 1JNRB 2WB4A 2DH9A 1BC6A 4F25A 3NL0A 3UDVA 1WDTA 4CLPA 2Q66A 2KB2A 2MTLA 3C6UA 3RBXA 1MWQA 3CGIA 1TV6A 4DPWA 2XSJB 2C2RA 1QUPA 4CH7A 2YNFB 1FK9A 1U49A 4EZ6A 3FEXB 2K1RA 5CZVA 5LXRA 3TX8A 2XYGB 1HBNB 2WZ1A 3GIKA 4FVCA 5KFNA 2FJWA 1Q8KA 4CZCA 2FLOA 1N6QB 2B3TB 3WC0A 1KHVA 5ETKA 4LF6F 2BKOA 2AJ0A 3QGIA 5E3QA 2VIHA 4NLTA 1HBUA 3KHLA 4X65F 4NASA 3FSYA 4TU8A 2BANB 3PY8A 1EUYA 3HVWA 4Y34A 5J2NA 2MSSA 2LDIA 3LW5C 5LMNF 1K44A 4LF5F 2CDQA 2DRAA 1GTHA 2VB6A 1S9EB 1GH8A 3H7HB 1VYAA 1MWYA 2GIFA 2ZZTA 3NNCA 4NI2A 1X4DA 4KE5A 2AJ2A 2UVVA 4ZS6A 2AJ1A 1HMVA 4W90B 4Y6IA 2FLNA 3GLJA 3FCHA 3HXMA 4PXEA 2AZ3A 3A3PB 4WYLA 4F0KA 2DGQA 4DR3J 5LL6d 1ZBTA 2JEIA 1R0BG 4KV8B 4OYBA 1NJZA 2ZBCA 3M05A 5HN0A 4K50A 2QL5B 3QT8A 3D6FB 2DKOB 5EWFA 4L72B 4LSLA 2YNGA 1OSDA 2CPHA 3RAXA 4X66J 1B4SA 4OV6A 2UXDJ 4USUA 3DOKB 2DXDA 2FHOB 3MMBA 2QE5A 2J7UA 2CWXA 1IQZA 2LLZA 2M88A 4RW9A 1Y7PA 5F3TA 4ZCKA 3F56A 1XNRJ 3SZ2A 2DHAA 1OMSA 2XNRA 1N33F 5G0RA 4RNNA 1VRTA 3R5AA 1OWXA 4X4NA 2VONA 5ETRA 1RTIB 5H9EK 1QTNB 2F5GA 5GMKa 1HPZB 4ILMA 4Z7CA 1WKJA 1RTHA 4ZIWA 2JHEA 2MLXA 3MDFA 5CYQA 2M70A 4R8UA 5A6PA 1U0HA 3AB4B 4X4QA 1RCXB 3KHHA 3CCVS 4EBDA 2P9CA 1FKAF 2DR7A 1FI4A 2AYGA 3T1YF 2DPIA 1RYSA 2Z57B 2GNKA
chains in the Genus database with same CATH topology
2VG6B 3NP5A 2M3DA 4QWDA 4JV0A 4A8XA 3H40A 2RQKA 3RAQA 3M8SA 3NCQA 2OFHX 1D0EA 5JVHQ 1TVRA 3OXLA 4M63A 3DRYA 4XIUA 1ZZFA 2JL9A 3VAHA 1UVJA 4QR0A 3GWCA 4QIGA 3PJWA 3TAQA 2B9WA 1NEEA 4H3SA 1QVFR 1M5HA 5H9FJ 1R89A 1HBMA 3OVAA 3NKYA 1B0VA 3KNAA 2F8HA 1D8YA 3GV8B 3PO4A 5CQGA 4ECUA 3T3FA 3QJLA 5K14A 1HPZA 2EPIA 4JV5F 3VZHA 3ZZRA 3KLGA 3J81Y 3CCJS 5HMWA 3OR2A 3JSRA 4ZCIA 4NXNF 2AP6A 2XLKA 3DYAA 3BJYA 4PKDB 3SMZA 2XMWA 2BQUA 5CYMB 3M6UA 2HS0A 2W7PA 5KTQA 2RQCA 1JJ4A 2ASYA 4B3MF 4ZKAA 1ZJWA 4DL0C 1XR7A 3CJKA 3PX4A 3BGRB 3NG8A 5HROB 3G9CA 2VA2A 3DRRA 2MQNA 4IFVA 1FA0A 4JI1F 2CPYA 1IBLF 4IO1A 3KLFB 4ECQA 4HHJA 4H54A 4YP3A 2KXHA 3U7JA 3J7ZT 2WHOA 1U6BA 3GYNA 2PMZD 3RW7A 1ZH5A 2KXNB 2VL1A 2OLWA 2KH9A 3K5PA 3CC4S 2B51A 3J7YU 3ZZOA 3OUYA 2R8IA 4UUWA 1K8AT 2HHSA 1QUVA 2ZOMA 4Y0FA 4RWWA 3OQ2A 3T9ZA 3K5NA 2RJZA 3BQ0A 1SBRA 3DLEB 4PPDA 4ED3A 2VKZG 5KG2A 2BOPA 2X1GA 3HZGA 1VFJA 1FVQA 2V4JA 3BSCA 3IXQA 4RUCA 5I3UA 4YEAA 3M32A 4WFYA 3HP6A 1S72S 2E9TA 1NB7A 4Q0BA 3FGVA 3BO3A 2VFTA 2B4PA 3OL7A 5A8KB 2VUGA 1TAQA 2KRBA 1LWFA 2R7SA 2JWNA 2ZC4A 5ADZA 4OI3A 2IYIA 2KG1A 3LANA 3K58A 2FPHX 4I2PA 4FBUA 2VG7A 1YRXA 5CHCB 4ZPWR 1KN6A 3H2LA 3KG1A 4WCES 2HPUA 3J7YI 2XCAA 5IQQA 2F9DA 4KHRA 4ZP9A 1MNEA 3OLAA 1JX4A 4G3IA 2HZCA 3JTNA 4ZPCA 5IXUA 5KFCA 3AJ1A 4R25A 1KQFB 2LKZA 3DFEA 4QBUA 4K2XA 2RS8A 1SJRA 3LWLA 3G96A 3N6MA 1YWXA 2DIUA 4ZVEA 2YQ3A 5KFWA 2B4UA 3B4DA 1H2UX 2SXLA 5CYMA 1S9GB 5KFTA 3ZZTA 1SUQA 5B0CA 2VQFF 3NAHA 3N79A 1U1QA 4O3NA 1V3SA 1IKYB 3SFGA 5SZTA 1R31A 4OZ5A 4WFAS 4O3QA 4F50A 3CF5S 1KLNA 3V6HA 2JRSA 3PRDA 2GA7A 4B3SF 3M8PB 3VAFA 3OSNA 2Z0GA 5E3RA 2GQCA 4C7QA 5DS7A 1KRPA 1O51A 1UKUA 2CPEA 2HFNA 3TYTA 2E5HA 2HNDB 3MCSA 2DH7A 3N28A 3BDPA 4ETZA 2M8HA 2E9ZA 4YOEA 1LWEB 2W4CA 2O67A 3FFIA 1L3KA 4C3KA 5D4PA 2E5JA 5B0BA 2B9XA 3V6KA 3RAMA 3LP0B 1PGZA 4MKYA 2R7VA 1HI1A 1FXDA 3QZ7A 1E6YB 3NS6A 1DLOB 2CJBA 4O44A 5BR8F 3MGJA 1QAXA 2BZ2A 2G13A 1TFWA 1N4LA 4K4VA 4LUBA 2VG5B 1HNVA 4JI4F 4I1TA 5E41A 1QSSA 4ELUA 2WONB 5DG7A 1SI9A 5B0DA 5H9EJ 2DNGA 4DSJA 3CD0A 3E01B 1JKHB 4AYBD 1WG5A 5IQ6A 4R0EA 4NZ0A 5D77A 3PACA 1T05A 4IDKA 3CMAS 5IM0B 4FBTA 2AF6A 1T3OA 5LSOA 4G1QB 4QU6A 5B09A 2BW2A 3H5UA 5HMZA 3JTPA 1KD1T 4TLRA 5D8HB 2D74B 2YWFA 3MPVA 3SFUA 2EC0A 2QMWA 1DTTB 3I9V9 2GQQA 2B4OA 4FXWA 3QO9B 4OLPA 2XMTA 5GAGW 4O4RA 2UZAA 4B08A 1JK9B 3MMJA 3TW0A 1S1XA 2Z2MA 1JLEB 1YJWS 3O3LA 2GIQA 5M2RA 4X4UA 1IKYA 3V6DB 3BN4A 5MAOA 1SV5A 3SCIE 4OJGA 4F3OA 3HVTB 3JAMY 2QSFA 1TK0A 1N8RT 1REVA 4I67A 2GFFA 5KFHA 2MY7A 5KT7A 4A8QA 4LJMA 4OJHA 2DR8A 2DCUB 3EUNA 3KLIB 1GTSA 2ZJQQ 5A0YB 1XK8A 1HQEA 2MZ1A 5T41A 4ZPDA 2RD5C 5AJ3F 2DGSA 4A47A 3CMES 2HNZB 4RBUA 4JYAF 3UD4P 4ED7A 4RWXA 4OHZA 2VBWA 2L41A 4URGA 4IO9Q 2XI3A 3W3SA 5B0FA 4DL2A 1Q86T 3W2VB 1K9MT 1FKOA 2DTJA 3HFKA 4LSNB 2DNPA 1CQMA 4CT9A 3PW4A 1DFUP 1LWCB 4L3NA 1NJIT 3CDUA 2PE8A 5F9LA 3EYZA 2DK2A 1CC8A 2CJQA 2ZOGA 2QLXA 1YBAA 1JKHA 4PR6A 3OTBA 3GIMA 2R7UA 3QIPB 5KOWA 3IWLA 5L9NA 1SH3A 5J1EA 2CQHA 5IM0A 2RMLA 1N5QA 4TN2A 2DITA 3VR1A 2K3IA 2AYEA 1DURA 3MM6B 2GJ2A 1UVLA 1HW8A 4QPTA 1BY9A 2L08A 3LAMA 3T6BA 5DLGA 1RTDA 4RBVA 5FIIA 3HT3A 3MM7B 1RT7B 4WK1A 4KKOB 4DG1A 1QJHA 2JLFA 3DI6A 1S1VB 2M2BA 3MPWA 3PNIA 4CTAA 2DO4A 1S6OA 4URQU 2PEHA 2I2YA 1RT2A 4YQWA 2RILA 1H98A 1LKZA 2ZHBA 1VRUA 2GO9A 2U2FA 4KR0B 2VOPA 2B6AB 3HI9A 4Q44A 1UVMA 4DUZF 4RX6A 2JEGA 2EVZA 3BZQA 1T02A 4KRWA 3KFWX 1SJ4P 4DOZA 3PVXA 4ELVA 2QA4S 2KFNA 4OZ1A 5DDPC 1S9FA 2N3OA 4KGKA 1HD0A 2ZZMA 4LMZA 2XMKA 4ID8A 4OX6A 3GIJA 3BQ2A 1RKJA 2ZZNA 5A0YA 2YWHA 2CQ4A 2LVWA 2ZJQS 1C1CB 4WKYA 1VQ5S 5BJRA 4N77A 1ZAWA 1FD2A 4Q2MA 2ZE2A 2HNZA 5A2QY 5L38A 4D3GA 4UY88 2QV6A 3HMJG 2JDJA 2J7WA 3ZFVA 1MU2A 1X4EA 1NJYA 3FNNA 1DZ5A 4H4OB 5KG0A 4B9NA 3BM7A 5KFEA 1QAJA 1X5TA 1IJFB 4IO9S 4LQ3A 4C4WA 1D9DA 4HT5A 2FVQA 2WSEC 4DV0F 2HHQA 4ECSA 3RB3A 1FT8A 2X51A 3CWJA 1WTBA 1SQEA 2CQDA 1OPZA 1SL2A 3HZEA 4OZLA 3SQGB 4F2SA 1MROA 5BYSA 1S1TA 2E1MC 4DL5A 4V19X 2HAIA 1U1NA 2DB1A 3PR5B 5DRKA 4Q7AA 5J2MB 3J7Z5 3MM6A 3MTKA 2AU0A 1S1UB 3KWMA 4ED2A 5LT5A 4LQ9A 1SC6A 1WACA 4WZQA 2JC0A 2C2DA 7FD1A 3H20A 2JEJA 2KHDA 2NSCA 3VAIA 1HI0P 3JSMB 2YTCA 2Q79A 3U27A 2B56A 1IXKA 1LV5A 4NA2A 2G9OA 4A46A 2W9CA 4FYDA 3HLUA 2MDAA 3UR0A 4ECWA 4A8KA 2ZITA 5GAEW 4BCAA 1HR0F 4P7VA 3SV3A 1QVGR 1WEYA 2POKA 4DUYF 4WE1B 3RBEA 1WHXA 3BF4A 5F8GA 5KFZA 1UA1A 3KYLA 3PO5A 3ISND 3UCGA 4FF4A 2YWEA 2OD6A 3QAUA 5B0GA 3MEGB 4HTJA 1XMOF 2HHUA 4IG0A 4CH0S 4CO2A 1NJWA 2DHSA 4MIWA 1QAIA 1N0VC 3G6ES 3KLHB 2ERRA 5KG7A 4F02A 2V0NA 1NO8A 4P2BA 2JVOA 3K2YA 3CXCR 4A8SA 4I6YA 3OLBA 4H4OA 4BC7A 4QR2A 1VQPS 4ITSA 2CJAA 3C2PA 4JI2F 3L95X 1KR4A 3MEEB 5EGYA 4OZ0A 2CKWA 1JLAB 2LA6A 4BBYA 1EP4B 3CB4A 3HKWA 2B5JB 2YKNB 4Z37A 3I0RB 5KFJA 1RK8A 4O3PA 2R7QA 4ZCLA 2V8HA 4CI0B 2P5VA 2BBEA 1UMJA 1VQLS 3D28A 3CDEA 2OPQA 3S6EA 1I94F 1J5OB 5GAGI 2HQ3A 3KJVB 1QRTA 1TK8A 1D9FA 2YKPA 1JLGA 2FHJA 2LXIA 3OW2R 5GAHW 2VC1A 1WHYA 1T03A 1Y3KA 2IYGA 3EZUA 3TVKA 3N6NA 4MIBA 3IGVA 3V4IB 1O5JA 3C46A 3FRYA 3T5JA 4YDXA 4NLDA 3OFEA 4ELTA 5GVQA 1RT1B 4I64A 2KT3A 3FMBA 2E5GA 4BWJA 1Z1ZA 3SCLE 3JSMA 2DCLA 5LMUF 1L5UA 3V81A 4DL4A 4DS4A 5DQGA 2P6TA 3CD7A 3IC1A 2GHVC 4MH8A 4YR3A 3O5TB 4RBTA 3TVYA 2XSJA 2LDYA 2VZ9A 5F9NA 3T5LA 4IRKA 1VQNS 2YNFA 2DNKA 1VS3A 2KYXA 3G6VA 3U02A 4FNIA 2JLGA 2KTQA 4DSFA 1VBZA 2ACYA 2GIRA 1HQUA 3KNGA 2K7JA 4WU2A 1CC7A 3QWUA 1P8GA 2ILYA 4Q8FA 5EUHA 5J2QA 4OI2A 4B9MA 2OIHA 3DLLQ 1RGVA 2RNEA 3TRGA 2UVWA 2M5YA 2I1RA 3PKMA 4DR1F 4WTYA 5DM7S 3SSRA 2GGPA 3M2UA 3N5BA 5KFFA 4OZNA 3KLHA 2DPJA 2WAQD 3OR1B 4DLEA 3PX0A 1O0PA 1VC0A 1WG4A 4ED5A 3A8EA 4G1PA 4QJVA 1TKXB 3BSNA 4F4KA 3MEEA 2JFKA 1AFJA 1K1QA 2UUTA 3EGWB 1FNOA 1Y0HA 3CCSS 3I0RA 4OQJA 1X5PA 2I5JA 1BQNA 2QSWA 4DF4A 4OL8A 2BQ3A 1KOHA 2AX1A 1URRA 3DN9A 5C5JA 3FZBA 3IFEA 3G8TA 3QGHA 4B9LA 5F41A 5E3PA 4YY3F 3QIDA 3SDEB 1YTYA 1X4CA 2DBBA 1SH0A 3HDSA 2J9CA 3IS9A 3CCZA 3R1HA 5F8IA 5DQHA 4GC6A 2J6TA 2WOMB 1XWLA 3UR3C 1M5SA 2HLUA 3I96A 4NA1A 3TO8A 3VTIA 4OZJA 2WTFA 2R2RA 2D1CA 2HHPA 3W2WB 1S0VA 2KO1A 1HNIB 1U2RA 4FF3A 2YKAA 3M30A 2BANA 2EFOA 2D41A 3PFEA 4C8ZA 3NBPB 3WZ0A 3G86A 3K0JA 3SSSA 3OTDA 1MMNA 3RYLA 1N5VA 1TFYA 1TK5A 4NLXA 4J9KA 3F73A 4WXWA 3RZAA 2E1RA 2Y0SD 4ZLPA 1JLCB 2HWTA 3CJ5A 1WELA 4MMOA 4DPOA 5I4MA 1FDDA 1VQSA 2XO7A 3CCRS 4F4YA 2LQBA 1VQ8S 2HNYB 4ECRA 4X64F 4USIA 1OQ6A 3QLHA 4AL7A 2OAUA 3OTEA 3T6JA 4XPCA 2DGVA 3HF5A 3I0SB 5KFBA 4IH7A 4J9OA 1UVKA 2UVRA 1I1GA 4C8OA 2W8KA 4QYZJ 1AXQA 1UEUA 2N4DA 3MM9A 4KFBB 3VCDA 3KHGA 3CC2S 4QWEA 3G4SS 1QRSA 4Y28C 3MMAA 3EPIA 3D5MA 2VASA 3DXSX 2PFFB 1Q8IA 2KXFA 3OL6A 1R27B 4FNHA 3MM5B 1JJHA 4MFBB 4NMLA 2CJ9A 1BD6A 1TKZA 2BUNA 5I42A 4RLEA 4IR1A 2VPXB 3OPKA 4I7FB 2OMLA 1F9FA 1IKVB 4ES2A 2X1BA 2M0GB 3DLHA 4P2SA 1JMTA 4RNOA 2HFOA 3LALA 3WBZA 1YI2S 2YNHB 5SUHA 4ECYA 1L3SA 3MEDB 4WU3A 4FS1A 3CCWA 2I9SA 3X3UA 2HHHF 2V94A 1L3TA 2VH7A 3CVKA 3EPGA 5GAEI 2XLJA 3E2EA 4RU9A 1ZETA 3G71S 2FD2A 4KV8A 2D3OR 4ZP6A 1UL3A 2P6SA 1FRJA 3C6TB 5K8MA 5DLFA 4C11B 4PPZA 2ZH1A 3E8OA 4IFYA 4ZP8A 1QLNA 3NBPA 5DQIA 1H7WA 3OJUA 5LJ5Y 5C25A 5D3GA 1K0TA 1FERA 3Q24A 5IZHA 3GFHA 1KONA 2PC6A 4M94A 1H7XA 1FJCA 5DETA 2XY6A 2KHCA 4RNHA 1JWWA 1ZM2A 4NLWA 1BGXT 4DV6F 1T94A 3SYZA 2L9NA 2XY5A 2UUBF 3Q2TC 1P6TA 2HQIA 3OXGA 3I9ZA 2C28A 3NMAA 5CCMA 2DH8A 1V9OA 2IAJB 2ZUGA 4HDHA 3C66A 4NRTA 3TUZC 1HA1A 3HKZD 2Z8QA 2APOA 2BA9A 2HWHA 3LUYA 3KMQA 3DU6A 1FTCA 2CRLA 5C42B 1HBOB 4OX9F 1E6VB 2MZJA 3TI0A 4KFBA 3MR3A 4J9QA 2FHKA 3ULHA 2XS5A 1XEZA 4B9VA 4DQPA 3FEZA 3EXYA 1XNRF 2XS2A 5KFMA 2J9DA 2DNMA 3IG1B 1GNKA 2WCXA 4PXDA 2IC3A 3RR7A 3DHXA 1I6JA 4LIRA 3MM5A 2C3YA 3M8RA 2EBEA 2LCWA 1KTVA 1IR0A 4KO0A 3Q0AA 4E0DA 2KJVA 2BDPA 3CDAA 4J9MA 3UQSA 3GB0A 2UXCF 4WFXA 1QTMA 4IH6A 3D0IE 2D9PA 2G0CA 4NLPA 1C0UB 3CT9A 3WDOA 1RTJA 2HRUA 1KHWA 1P1TA 2XMUA 3NGDA 2LQ9A 2VD3A 1CSJA 2RF2B 4H4KC 4NYPA 1NZAA 4NWBA 4OX7A 1RJJA 3RU0A 3RTVA 1VJWA 5IWAF 1H38A 2IHR1 3AA9A 2ZH4A 2YH0A 2FB0A 3R5DA 4MK8A 3PIPS 2J9DE 2MZQA 1RT3A 2E7WA 2V8GA 5F0WA 4YB7A 1N36F 1TL3A 3N9UC 3AIIA 3GE9A 4IOAS 4C3MA 2CG4A 3VALA 3K8VA 3C6TA 3Q8SB 4ZA1A 1C0TB 1QM9A 2YWKA 1UJ6A 1ZM3A 1TP7A 4NLYA 2IJFA 2DGOA 2W25A 2GCFA 3M1VB 3HK2A 2AJ4A 4C9DA 3DU5A