2GAEA

Crystal structure of mlta from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
333
structure length
333
Chain Sequence
KPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Lytic Transglycosylase MltA from N.gonorrhoeae and E.coli: Insights into Interdomain Movements and Substrate Binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 89
structure length 333
sequence length 333
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2gaeA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2gaeA02
4ENGA 3CZBA 4FG2A 2PI8A 3X2JA 1N10A 1BW4A 2PNWA 1L8FA 2ENGA 4FERA 1HD5A 4JS7A 2AE0X 4JJOA 4JP7A 4L48A 3M3GA 2PICA 4JCWA 2BH0A 5GLXA 1OA9A 3X2KA 2PJJA 3SUKA 3X2HA 1WC2A 3X2MA 2HCZX 3X2IA 2KQAA 4AVRA 3ENGA 5H4UA 3X2OA 5GLYA 3X2PA 1BW3A 2G6GA 5GM9A 3X2GA 3SUJA 4FFTA 3SULA 2G5DA 3X2LA 3SUMA 4FG4A 3D30A 4JP6A 2GAEA 1OA7A 3X2NA 4ZM7A
chains in the Genus database with same CATH superfamily
1K83A 2EGWA 5GAHW 4FG2A 2Z0YA 4JXZA 3QC8A 5JVHS 4V194 1PT0A 1PQEA 1Y1VA 1B75A 1H0HA 1TMOA 1UHEA 2YU9A 1OGYA 1GTRA 1FDIA 3HU3A 3KW2A 5HL7S 5EPPA 2CW0D 1WLFA 5C18A 4WFAS 5FTJA 4UY88 2RE8A 3J7ZV 5DM7S 1DMSA 1OA9A 4AONB 2Y0SA 2PJHB 3QQ7A 1WC2A 1G8JA 4RV0A 4GA5A 5DYIA 2IV2X 2KQAA 3X2MA 2ZJQS 3ENGA 3QQ8A 5FTLA 3DLLS 3X2OA 2B63A 2VPYA 3X1LB 4KLNA 1Z85A 3HU1A 4DMRA 5GLFA 2ZJRS 1WCMA 2E2IA 5T5ID 3IR7A 1I50A 3IR5A 3PLXB 3GTQA 1O0CA 4ZM7A 2WAQA 1QRTA 1QRSA 2PI8A 1KQFA 1TWCA 2A68D 2NVYA 5DYGA 1BW4A 2PNWA 1L8FA 2ENGA 2PMZA 1HD5A 2VPZA 3PIOS 2NAPA 1YNND 2AE0X 3PIPS 1ZJWA 1AW8B 4QIWA 1EUYA 4JP7A 4H4KA 4KODA 4KO8A 2E7ZA 1UDXA 3M3GA 2ZJPS 1IW7D 2E2HA 4JCWA 1E32A 1CZ4A 2BH0A 3W2WB 1EU1A 1E60A 3SUKA 1E61A 1CR5A 2HZ7A 3X2IA 1SFOA 4AVRA 1CZ5A 1NYLA 4L69A 2KI8A 4AYBA 1R7RA 4D7ZB 1BW3A 2G6GA 2JIQA 5GM9A 1D6KA 2G5DA 2VPXA 1PYUB 1Y4ZA 2JA6A 3SUMA 2A6HD 1TWAA 3D30A 2R93A 4JP6A 4AOKB 4IO9S 2A69D 1G8KA 1S3SA 2DMRA 1VHKA 5FTMA 3AIIA 3X2NA 1TWGA 2V3VA 4ENGA 2NWAA 3CF5S 2RD2A 2C45A 2VUMA 2JIRA 3HKZA 1N10A 1KQGA 3GTOA 2R92A 3W2VB 3GTLA 1PT1A 1SMYD 4FERA 4JS7A 3TM7B 5B6CA 4WF9S 4JJOA 1QTQA 4JXXA 3TIWA 4L48A 3GTKA 3GTGA 1ZC1A 1TWHA 1DMRA 2PICA 2NYAA 1UHDA 3FKIA 4KDIA 5FTNA 5GLXA 4AAYA 2PJJA 1H5NA 1Y1WA 5DM6S 4WCES 3QWZA 2NVXA 2V45A 3DMRA 2JA5A 4NOHA 1E5VA 1DFUP 4KDLA 5H4UA 1FEUA 3X2GA 4JYZA 4FFTA 1Q16A 5GAEW 1I3QA 1ZYRD 4AZDA 3GTMA 3H0GA 1QDNA 1VHYA 2YUJA 2JIPA 1OA7A 2WB1A 1PQHA 4GA6A 5BNZA 3CZBA 3X2JA 1NXZA 1TWFA 3X2HA 1QCSA 1FDOA 1YLEA 1YNJD 1R27A 3IR6A 1PPYA 1PQFA 1E18A 4C2MA 5T5MD 3OUGA 5FTKA 2JIMA 1EUQA 3HU2A 5C1BA 5GADW 3CQZA 3GTJA 2O5JD 5GAGW 2EEOB 4E8BA 4CS0A 3ML1A 1EXDA 4IOAS 2JA7A 3X2KA 4U67S 3GTPA 3CF2A 1GTSA 1Y5IA 2CX8A 1PYQA 2HCZX 2VPWA 4CRYG 2JIOA 4WFNS 2BE5D 3O5AA 1R9TA 2R7ZA 5IZNA 5GLYA 3X2PA 4P2BA 5JVGS 4IOCS 4H3SA 3SUJA 1O0BA 3SULA 3X2LA 1VC3B 4FG4A 4WFBS 2EGVA 1QRUA 1SIWA 2GAEA 2A6ED 4J3CA 4CRZA 1V6ZA 1AA6A
chains in the Genus database with same CATH topology
1K83A 4FG2A 3QC8A 1PT0A 1PQEA 1Y1VA 1H0HA 1TMOA 1UHEA 2YU9A 1OGYA 1FDIA 3HU3A 5EPPA 2CW0D 1WLFA 5C18A 5FTJA 1DMSA 1OA9A 4AONB 3X2HA 2PJHB 2Y0SA 1WC2A 3X2MA 1G8JA 3QQ7A 4GA5A 4RV0A 2KQAA 5DYIA 2IV2X 3ENGA 3QQ8A 5FTLA 3X2OA 2B63A 2VPYA 4KLNA 3HU1A 4DMRA 5GLFA 1WCMA 2E2IA 5T5ID 3IR7A 1I50A 3IR5A 3PLXB 3GTQA 4ZM7A 2WAQA 2PI8A 1KQFA 1TWCA 2A68D 2NVYA 5DYGA 1BW4A 2PNWA 1L8FA 2ENGA 2PMZA 1HD5A 2VPZA 2NAPA 1YNND 2AE0X 1AW8B 4QIWA 4JP7A 4KODA 4KO8A 2E7ZA 3M3GA 1IW7D 2E2HA 4JCWA 1CZ4A 2BH0A 1E32A 1EU1A 1E60A 3SUKA 1E61A 1CR5A 3X2IA 1SFOA 4AVRA 1CZ5A 2KI8A 4AYBA 1R7RA 4D7ZB 1BW3A 2G6GA 5GM9A 2JIQA 2G5DA 2VPXA 1PYUB 1Y4ZA 2JA6A 3SUMA 2A6HD 3D30A 1TWAA 2R93A 4JP6A 4AOKB 2A69D 1G8KA 1S3SA 2DMRA 5FTMA 3X2NA 1TWGA 2V3VA 4ENGA 2C45A 2VUMA 2JIRA 3HKZA 1N10A 1KQGA 3GTOA 2R92A 3GTLA 1PT1A 4FERA 4JS7A 1SMYD 3TM7B 5B6CA 4JJOA 3TIWA 4L48A 3GTKA 3GTGA 1ZC1A 1TWHA 2PICA 1DMRA 2NYAA 5GLXA 1UHDA 3FKIA 4KDIA 5FTNA 4AAYA 2PJJA 1H5NA 1Y1WA 3QWZA 2NVXA 2V45A 3DMRA 2JA5A 4NOHA 1E5VA 5H4UA 4KDLA 3X2GA 4FFTA 1Q16A 1I3QA 1ZYRD 4AZDA 3GTMA 3H0GA 1QDNA 2YUJA 1OA7A 2JIPA 2WB1A 1PQHA 4GA6A 3CZBA 3X2JA 1TWFA 1QCSA 1FDOA 1R27A 1YLEA 1YNJD 3IR6A 1PPYA 1PQFA 1E18A 4C2MA 5T5MD 3OUGA 5FTKA 2JIMA 3HU2A 5C1BA 3CQZA 3GTJA 2O5JD 2EEOB 4CS0A 3ML1A 2JA7A 3X2KA 3GTPA 3CF2A 1Y5IA 1PYQA 2HCZX 2VPWA 4CRYG 2JIOA 2BE5D 3O5AA 1R9TA 2R7ZA 5GLYA 3X2PA 3SUJA 3SULA 3X2LA 4FG4A 1VC3B 1SIWA 2GAEA 2A6ED 4CRZA 1AA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENG A;  3CZB A;  4FG2 A;  2PI8 A;  3X2J A;  1N10 A;  1BW4 A;  2PNW A;  1L8F A;  2ENG A;  4FER A;  1HD5 A;  4JS7 A;  2AE0 X;  4JJO A;  4JP7 A;  4L48 A;  3M3G A;  2PIC A;  4JCW A;  2BH0 A;  5GLX A;  1OA9 A;  3X2K A;  2PJJ A;  3SUK A;  3X2H A;  1WC2 A;  3X2M A;  2HCZ X;  3X2I A;  2KQA A;  4AVR A;  3ENG A;  5H4U A;  3X2O A;  5GLY A;  3X2P A;  1BW3 A;  2G6G A;  5GM9 A;  3X2G A;  3SUJ A;  4FFT A;  3SUL A;  2G5D A;  3X2L A;  3SUM A;  4FG4 A;  3D30 A;  4JP6 A;  2GAE A;  1OA7 A;  3X2N A;  4ZM7 A; 
#chains in the Genus database with same CATH topology
 1K83 A;  2EGW A;  5GAH W;  4FG2 A;  2Z0Y A;  4JXZ A;  3QC8 A;  5JVH S;  4V19 4;  1PT0 A;  1PQE A;  1Y1V A;  1B75 A;  1H0H A;  1TMO A;  1UHE A;  2YU9 A;  1OGY A;  1GTR A;  1FDI A;  3HU3 A;  3KW2 A;  5HL7 S;  5EPP A;  2CW0 D;  1WLF A;  5C18 A;  4WFA S;  5FTJ A;  4UY8 8;  2RE8 A;  3J7Z V;  5DM7 S;  1DMS A;  1OA9 A;  4AON B;  2Y0S A;  2PJH B;  3QQ7 A;  1WC2 A;  1G8J A;  4RV0 A;  4GA5 A;  5DYI A;  2IV2 X;  2KQA A;  3X2M A;  2ZJQ S;  3ENG A;  3QQ8 A;  5FTL A;  3DLL S;  3X2O A;  2B63 A;  2VPY A;  3X1L B;  4KLN A;  1Z85 A;  3HU1 A;  4DMR A;  5GLF A;  2ZJR S;  1WCM A;  2E2I A;  5T5I D;  3IR7 A;  1I50 A;  3IR5 A;  3PLX B;  3GTQ A;  1O0C A;  4ZM7 A;  2WAQ A;  1QRT A;  1QRS A;  2PI8 A;  1KQF A;  1TWC A;  2A68 D;  2NVY A;  5DYG A;  1BW4 A;  2PNW A;  1L8F A;  2ENG A;  2PMZ A;  1HD5 A;  2VPZ A;  3PIO S;  2NAP A;  1YNN D;  2AE0 X;  3PIP S;  1ZJW A;  1AW8 B;  4QIW A;  1EUY A;  4JP7 A;  4H4K A;  4KOD A;  4KO8 A;  2E7Z A;  1UDX A;  3M3G A;  2ZJP S;  1IW7 D;  2E2H A;  4JCW A;  1E32 A;  1CZ4 A;  2BH0 A;  3W2W B;  1EU1 A;  1E60 A;  3SUK A;  1E61 A;  1CR5 A;  2HZ7 A;  3X2I A;  1SFO A;  4AVR A;  1CZ5 A;  1NYL A;  4L69 A;  2KI8 A;  4AYB A;  1R7R A;  4D7Z B;  1BW3 A;  2G6G A;  2JIQ A;  5GM9 A;  1D6K A;  2G5D A;  2VPX A;  1PYU B;  1Y4Z A;  2JA6 A;  3SUM A;  2A6H D;  1TWA A;  3D30 A;  2R93 A;  4JP6 A;  4AOK B;  4IO9 S;  2A69 D;  1G8K A;  1S3S A;  2DMR A;  1VHK A;  5FTM A;  3AII A;  3X2N A;  1TWG A;  2V3V A;  4ENG A;  2NWA A;  3CF5 S;  2RD2 A;  2C45 A;  2VUM A;  2JIR A;  3HKZ A;  1N10 A;  1KQG A;  3GTO A;  2R92 A;  3W2V B;  3GTL A;  1PT1 A;  1SMY D;  4FER A;  4JS7 A;  3TM7 B;  5B6C A;  4WF9 S;  4JJO A;  1QTQ A;  4JXX A;  3TIW A;  4L48 A;  3GTK A;  3GTG A;  1ZC1 A;  1TWH A;  1DMR A;  2PIC A;  2NYA A;  1UHD A;  3FKI A;  4KDI A;  5FTN A;  5GLX A;  4AAY A;  2PJJ A;  1H5N A;  1Y1W A;  5DM6 S;  4WCE S;  3QWZ A;  2NVX A;  2V45 A;  3DMR A;  2JA5 A;  4NOH A;  1E5V A;  1DFU P;  4KDL A;  5H4U A;  1FEU A;  3X2G A;  4JYZ A;  4FFT A;  1Q16 A;  5GAE W;  1I3Q A;  1ZYR D;  4AZD A;  3GTM A;  3H0G A;  1QDN A;  1VHY A;  2YUJ A;  2JIP A;  1OA7 A;  2WB1 A;  1PQH A;  4GA6 A;  5BNZ A;  3CZB A;  3X2J A;  1NXZ A;  1TWF A;  3X2H A;  1QCS A;  1FDO A;  1YLE A;  1YNJ D;  1R27 A;  3IR6 A;  1PPY A;  1PQF A;  1E18 A;  4C2M A;  5T5M D;  3OUG A;  5FTK A;  2JIM A;  1EUQ A;  3HU2 A;  5C1B A;  5GAD W;  3CQZ A;  3GTJ A;  2O5J D;  5GAG W;  2EEO B;  4E8B A;  4CS0 A;  3ML1 A;  1EXD A;  4IOA S;  2JA7 A;  3X2K A;  4U67 S;  3GTP A;  3CF2 A;  1GTS A;  1Y5I A;  2CX8 A;  1PYQ A;  2HCZ X;  2VPW A;  4CRY G;  2JIO A;  4WFN S;  2BE5 D;  3O5A A;  1R9T A;  2R7Z A;  5IZN A;  5GLY A;  3X2P A;  4P2B A;  5JVG S;  4IOC S;  4H3S A;  3SUJ A;  1O0B A;  3SUL A;  3X2L A;  1VC3 B;  4FG4 A;  4WFB S;  2EGV A;  1QRU A;  1SIW A;  2GAE A;  2A6E D;  4J3C A;  4CRZ A;  1V6Z A;  1AA6 A; 
#chains in the Genus database with same CATH homology
 1K83 A;  4FG2 A;  3QC8 A;  1PT0 A;  1PQE A;  1Y1V A;  1H0H A;  1TMO A;  1UHE A;  2YU9 A;  1OGY A;  1FDI A;  3HU3 A;  5EPP A;  2CW0 D;  1WLF A;  5C18 A;  5FTJ A;  1DMS A;  1OA9 A;  4AON B;  3X2H A;  2PJH B;  2Y0S A;  1WC2 A;  3X2M A;  1G8J A;  3QQ7 A;  4GA5 A;  4RV0 A;  2KQA A;  5DYI A;  2IV2 X;  3ENG A;  3QQ8 A;  5FTL A;  3X2O A;  2B63 A;  2VPY A;  4KLN A;  3HU1 A;  4DMR A;  5GLF A;  1WCM A;  2E2I A;  5T5I D;  3IR7 A;  1I50 A;  3IR5 A;  3PLX B;  3GTQ A;  4ZM7 A;  2WAQ A;  2PI8 A;  1KQF A;  1TWC A;  2A68 D;  2NVY A;  5DYG A;  1BW4 A;  2PNW A;  1L8F A;  2ENG A;  2PMZ A;  1HD5 A;  2VPZ A;  2NAP A;  1YNN D;  2AE0 X;  1AW8 B;  4QIW A;  4JP7 A;  4KOD A;  4KO8 A;  2E7Z A;  3M3G A;  1IW7 D;  2E2H A;  4JCW A;  1CZ4 A;  2BH0 A;  1E32 A;  1EU1 A;  1E60 A;  3SUK A;  1E61 A;  1CR5 A;  3X2I A;  1SFO A;  4AVR A;  1CZ5 A;  2KI8 A;  4AYB A;  1R7R A;  4D7Z B;  1BW3 A;  2G6G A;  5GM9 A;  2JIQ A;  2G5D A;  2VPX A;  1PYU B;  1Y4Z A;  2JA6 A;  3SUM A;  2A6H D;  3D30 A;  1TWA A;  2R93 A;  4JP6 A;  4AOK B;  2A69 D;  1G8K A;  1S3S A;  2DMR A;  5FTM A;  3X2N A;  1TWG A;  2V3V A;  4ENG A;  2C45 A;  2VUM A;  2JIR A;  3HKZ A;  1N10 A;  1KQG A;  3GTO A;  2R92 A;  3GTL A;  1PT1 A;  4FER A;  4JS7 A;  1SMY D;  3TM7 B;  5B6C A;  4JJO A;  3TIW A;  4L48 A;  3GTK A;  3GTG A;  1ZC1 A;  1TWH A;  2PIC A;  1DMR A;  2NYA A;  5GLX A;  1UHD A;  3FKI A;  4KDI A;  5FTN A;  4AAY A;  2PJJ A;  1H5N A;  1Y1W A;  3QWZ A;  2NVX A;  2V45 A;  3DMR A;  2JA5 A;  4NOH A;  1E5V A;  5H4U A;  4KDL A;  3X2G A;  4FFT A;  1Q16 A;  1I3Q A;  1ZYR D;  4AZD A;  3GTM A;  3H0G A;  1QDN A;  2YUJ A;  1OA7 A;  2JIP A;  2WB1 A;  1PQH A;  4GA6 A;  3CZB A;  3X2J A;  1TWF A;  1QCS A;  1FDO A;  1R27 A;  1YLE A;  1YNJ D;  3IR6 A;  1PPY A;  1PQF A;  1E18 A;  4C2M A;  5T5M D;  3OUG A;  5FTK A;  2JIM A;  3HU2 A;  5C1B A;  3CQZ A;  3GTJ A;  2O5J D;  2EEO B;  4CS0 A;  3ML1 A;  2JA7 A;  3X2K A;  3GTP A;  3CF2 A;  1Y5I A;  1PYQ A;  2HCZ X;  2VPW A;  4CRY G;  2JIO A;  2BE5 D;  3O5A A;  1R9T A;  2R7Z A;  5GLY A;  3X2P A;  3SUJ A;  3SUL A;  3X2L A;  4FG4 A;  1VC3 B;  1SIW A;  2GAE A;  2A6E D;  4CRZ A;  1AA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...