2GAEA

Crystal structure of mlta from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
333
structure length
333
Chain Sequence
KPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Lytic Transglycosylase MltA from N.gonorrhoeae and E.coli: Insights into Interdomain Movements and Substrate Binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
total genus 89
structure length 333
sequence length 333
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2gaeA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2gaeA02
3X2GA 2GAEA 4ZM7A 1OA9A 2BH0A 3X2KA 2PNWA 3X2IA 4AVRA 4JP6A 5GLXA 3X2JA 3M3GA 4JJOA 3X2OA 1BW4A 4FG2A 5H4UA 4ENGA 1L8FA 2HCZX 4JS7A 3X2MA 1HD5A 3D30A 4FFTA 2AE0X 3SUKA 1N10A 2ENGA 5GM9A 2G5DA 2PI8A 3X2NA 3ENGA 4JP7A 3X2HA 3X2LA 4L48A 4FERA 4JCWA 3SULA 1BW3A 2PJJA 2KQAA 3CZBA 1OA7A 2G6GA 4FG4A 1WC2A 3SUJA 5GLYA 2PICA 3SUMA 3X2PA
chains in the Genus database with same CATH superfamily
4AAYA 2E2IA 2JA6A 4J3CA 4P2BA 3IR5A 3M3GA 3X2JA 4JJOA 1EU1A 1EUQA 1KQFA 4AOKB 1YNJD 2KI8A 1PQHA 2JA7A 4E8BA 1YLEA 2A6HD 4JS7A 1HD5A 4H4KA 4KODA 1SFOA 3SUKA 4CS0A 5GADW 1Y1VA 5FTNA 4IOAS 4WFBS 1CR5A 2PI8A 3X2HA 3CF5S 3W2WB 1Y4ZA 1GTRA 4AONB 1FDOA 1UHDA 1BW3A 2KQAA 1PQEA 1PQFA 1R7RA 3CZBA 1R27A 4KDLA 5FTMA 2ZJPS 1K83A 1WC2A 1NYLA 2RE8A 1D6KA 3KW2A 1E32A 3X2OA 2B63A 1R9TA 1V6ZA 3X2PA 2EGVA 5GAGW 3X2GA 3J7ZV 2GAEA 1UDXA 1G8KA 3X2KA 1Y1WA 3PIPS 4AVRA 1I3QA 3CQZA 3IR6A 5FTLA 1QRUA 3GTLA 2E7ZA 1OGYA 1TWCA 4GA5A 3TIWA 1BW4A 4V194 3HU2A 4L69A 3QQ7A 4NOHA 2VPZA 5FTJA 2AE0X 4KO8A 5EPPA 1PPYA 2YU9A 3GTPA 4UY88 4D7ZB 3X1LB 2G5DA 1TMOA 2VPYA 3W2VB 4JYZA 1CZ4A 4KDIA 1Y5IA 4QIWA 3QQ8A 1ZYRD 2O5JD 1CZ5A 2ZJRS 1DMSA 2PJJA 5C1BA 4WFAS 1WLFA 1AA6A 1OA7A 2VPWA 2G6GA 4FG4A 5DM6S 1B75A 5HL7S 3GTOA 1S3SA 2R93A 1TWHA 4ZM7A 3GTKA 1OA9A 2NYAA 2ZJQS 2PNWA 1FEUA 3X2IA 3H0GA 1O0CA 3OUGA 2JA5A 3HU3A 2EGWA 2V3VA 3HU1A 4WFNS 4GA6A 5JVGS 2EEOB 4FG2A 5H4UA 3HKZA 3CF2A 5T5ID 2HCZX 4ENGA 5GAHW 1I50A 2Z0YA 4IO9S 1ZJWA 2DMRA 1QRSA 1H5NA 3DMRA 1SIWA 3D30A 4FFTA 2JIRA 4U67S 5GLFA 1N10A 3PIOS 4JXZA 1DFUP 4WF9S 4AYBA 5GM9A 2A68D 3O5AA 1AW8B 3GTMA 1WCMA 3ENGA 4JP7A 2NVXA 2JIOA 2WB1A 1QDNA 2NVYA 2A69D 2Y0SA 4L48A 2VUMA 3DLLS 4FERA 4CRZA 3SULA 3GTGA 2RD2A 5JVHS 2VPXA 3TM7B 2R92A 5DM7S 3GTQA 1QRTA 1E60A 2CW0D 2PMZA 1IW7D 5BNZA 3ML1A 1H0HA 3SUJA 2PICA 4DMRA 1EXDA 1Z85A 3PLXB 4CRYG 1SMYD 4IOCS 2BH0A 1KQGA 1PYUB 2IV2X 4JXXA 1TWAA 3QWZA 4AZDA 1DMRA 4JP6A 5DYIA 5GLXA 4H3SA 4C2MA 1E61A 1QCSA 2JIQA 4KLNA 1ZC1A 2JIMA 3QC8A 5B6CA 5C18A 3FKIA 2E2HA 2V45A 2NAPA 1UHEA 1GTSA 1E5VA 5IZNA 1L8FA 5FTKA 3X2MA 1NXZA 1O0BA 1PT0A 2JIPA 1Q16A 1QTQA 1FDIA 2ENGA 1PT1A 2PJHB 2C45A 4RV0A 1VC3B 3X2NA 2YUJA 2R7ZA 2A6ED 3X2LA 3IR7A 3GTJA 2NWAA 4JCWA 1EUYA 5DYGA 1VHKA 4WCES 2CX8A 5T5MD 5GAEW 1G8JA 2HZ7A 1TWFA 1PYQA 2BE5D 2WAQA 3AIIA 5GLYA 1TWGA 1YNND 3SUMA 1E18A 1VHYA
chains in the Genus database with same CATH topology
4AAYA 2E2IA 2JA6A 3X2JA 3M3GA 3IR5A 4JJOA 1EU1A 1KQFA 4AOKB 1YNJD 2KI8A 1PQHA 2JA7A 1YLEA 4JS7A 2A6HD 1HD5A 4KODA 1SFOA 3SUKA 4CS0A 1Y1VA 5FTNA 2PI8A 1CR5A 3X2HA 1Y4ZA 4AONB 1FDOA 1BW3A 1UHDA 2KQAA 1PQEA 1PQFA 1R7RA 3CZBA 1R27A 4KDLA 5FTMA 1K83A 1WC2A 1E32A 3X2OA 2B63A 1R9TA 3X2PA 3X2GA 2GAEA 3X2KA 1G8KA 1Y1WA 4AVRA 1I3QA 3CQZA 3IR6A 5FTLA 3GTLA 2E7ZA 1OGYA 1BW4A 1TWCA 4GA5A 3TIWA 3HU2A 3QQ7A 4NOHA 2VPZA 5FTJA 2AE0X 4KO8A 5EPPA 1PPYA 2YU9A 3GTPA 4D7ZB 2G5DA 1TMOA 2VPYA 1CZ4A 4KDIA 1Y5IA 4QIWA 3QQ8A 1ZYRD 2O5JD 1CZ5A 1DMSA 2PJJA 5C1BA 1WLFA 1AA6A 1OA7A 2VPWA 2G6GA 4FG4A 3GTOA 1S3SA 2R93A 4ZM7A 1TWHA 3GTKA 1OA9A 2NYAA 2PNWA 3X2IA 3H0GA 3OUGA 2JA5A 3HU3A 2V3VA 3HU1A 4GA6A 2EEOB 4FG2A 5H4UA 3HKZA 4ENGA 3CF2A 2HCZX 5T5ID 1I50A 2DMRA 1H5NA 3DMRA 1SIWA 3D30A 4FFTA 2JIRA 5GLFA 1N10A 4AYBA 5GM9A 2A68D 3O5AA 1AW8B 3GTMA 1WCMA 3ENGA 4JP7A 2NVXA 2JIOA 2WB1A 1QDNA 2NVYA 2A69D 2Y0SA 4L48A 2VUMA 4FERA 4CRZA 3SULA 3GTGA 2VPXA 3TM7B 2R92A 3GTQA 1E60A 2CW0D 2PMZA 1IW7D 3ML1A 1H0HA 3SUJA 2PICA 4DMRA 3PLXB 4CRYG 1SMYD 2BH0A 1KQGA 1PYUB 2IV2X 1TWAA 3QWZA 4AZDA 1DMRA 4JP6A 5GLXA 5DYIA 4C2MA 1E61A 1QCSA 2JIQA 4KLNA 1ZC1A 2JIMA 3QC8A 5B6CA 5C18A 3FKIA 2E2HA 2V45A 2NAPA 1UHEA 1E5VA 1L8FA 5FTKA 3X2MA 1PT0A 2JIPA 1Q16A 1FDIA 2ENGA 1PT1A 2PJHB 2C45A 4RV0A 1VC3B 3X2NA 2YUJA 2R7ZA 3X2LA 2A6ED 3IR7A 3GTJA 4JCWA 5DYGA 5T5MD 1G8JA 1TWFA 1PYQA 2BE5D 2WAQA 5GLYA 1TWGA 1YNND 3SUMA 1E18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2G A;  2GAE A;  4ZM7 A;  1OA9 A;  2BH0 A;  3X2K A;  2PNW A;  3X2I A;  4AVR A;  4JP6 A;  5GLX A;  3X2J A;  3M3G A;  4JJO A;  3X2O A;  1BW4 A;  4FG2 A;  5H4U A;  4ENG A;  1L8F A;  2HCZ X;  4JS7 A;  3X2M A;  1HD5 A;  3D30 A;  4FFT A;  2AE0 X;  3SUK A;  1N10 A;  2ENG A;  5GM9 A;  2G5D A;  2PI8 A;  3X2N A;  3ENG A;  4JP7 A;  3X2H A;  3X2L A;  4L48 A;  4FER A;  4JCW A;  3SUL A;  1BW3 A;  2PJJ A;  2KQA A;  3CZB A;  1OA7 A;  2G6G A;  4FG4 A;  1WC2 A;  3SUJ A;  5GLY A;  2PIC A;  3SUM A;  3X2P A; 
#chains in the Genus database with same CATH topology
 4AAY A;  2E2I A;  2JA6 A;  4J3C A;  4P2B A;  3IR5 A;  3M3G A;  3X2J A;  4JJO A;  1EU1 A;  1EUQ A;  1KQF A;  4AOK B;  1YNJ D;  2KI8 A;  1PQH A;  2JA7 A;  4E8B A;  1YLE A;  2A6H D;  4JS7 A;  1HD5 A;  4H4K A;  4KOD A;  1SFO A;  3SUK A;  4CS0 A;  5GAD W;  1Y1V A;  5FTN A;  4IOA S;  4WFB S;  1CR5 A;  2PI8 A;  3X2H A;  3CF5 S;  3W2W B;  1Y4Z A;  1GTR A;  4AON B;  1FDO A;  1UHD A;  1BW3 A;  2KQA A;  1PQE A;  1PQF A;  1R7R A;  3CZB A;  1R27 A;  4KDL A;  5FTM A;  2ZJP S;  1K83 A;  1WC2 A;  1NYL A;  2RE8 A;  1D6K A;  3KW2 A;  1E32 A;  3X2O A;  2B63 A;  1R9T A;  1V6Z A;  3X2P A;  2EGV A;  5GAG W;  3X2G A;  3J7Z V;  2GAE A;  1UDX A;  1G8K A;  3X2K A;  1Y1W A;  3PIP S;  4AVR A;  1I3Q A;  3CQZ A;  3IR6 A;  5FTL A;  1QRU A;  3GTL A;  2E7Z A;  1OGY A;  1TWC A;  4GA5 A;  3TIW A;  1BW4 A;  4V19 4;  3HU2 A;  4L69 A;  3QQ7 A;  4NOH A;  2VPZ A;  5FTJ A;  2AE0 X;  4KO8 A;  5EPP A;  1PPY A;  2YU9 A;  3GTP A;  4UY8 8;  4D7Z B;  3X1L B;  2G5D A;  1TMO A;  2VPY A;  3W2V B;  4JYZ A;  1CZ4 A;  4KDI A;  1Y5I A;  4QIW A;  3QQ8 A;  1ZYR D;  2O5J D;  1CZ5 A;  2ZJR S;  1DMS A;  2PJJ A;  5C1B A;  4WFA S;  1WLF A;  1AA6 A;  1OA7 A;  2VPW A;  2G6G A;  4FG4 A;  5DM6 S;  1B75 A;  5HL7 S;  3GTO A;  1S3S A;  2R93 A;  1TWH A;  4ZM7 A;  3GTK A;  1OA9 A;  2NYA A;  2ZJQ S;  2PNW A;  1FEU A;  3X2I A;  3H0G A;  1O0C A;  3OUG A;  2JA5 A;  3HU3 A;  2EGW A;  2V3V A;  3HU1 A;  4WFN S;  4GA6 A;  5JVG S;  2EEO B;  4FG2 A;  5H4U A;  3HKZ A;  3CF2 A;  5T5I D;  2HCZ X;  4ENG A;  5GAH W;  1I50 A;  2Z0Y A;  4IO9 S;  1ZJW A;  2DMR A;  1QRS A;  1H5N A;  3DMR A;  1SIW A;  3D30 A;  4FFT A;  2JIR A;  4U67 S;  5GLF A;  1N10 A;  3PIO S;  4JXZ A;  1DFU P;  4WF9 S;  4AYB A;  5GM9 A;  2A68 D;  3O5A A;  1AW8 B;  3GTM A;  1WCM A;  3ENG A;  4JP7 A;  2NVX A;  2JIO A;  2WB1 A;  1QDN A;  2NVY A;  2A69 D;  2Y0S A;  4L48 A;  2VUM A;  3DLL S;  4FER A;  4CRZ A;  3SUL A;  3GTG A;  2RD2 A;  5JVH S;  2VPX A;  3TM7 B;  2R92 A;  5DM7 S;  3GTQ A;  1QRT A;  1E60 A;  2CW0 D;  2PMZ A;  1IW7 D;  5BNZ A;  3ML1 A;  1H0H A;  3SUJ A;  2PIC A;  4DMR A;  1EXD A;  1Z85 A;  3PLX B;  4CRY G;  1SMY D;  4IOC S;  2BH0 A;  1KQG A;  1PYU B;  2IV2 X;  4JXX A;  1TWA A;  3QWZ A;  4AZD A;  1DMR A;  4JP6 A;  5DYI A;  5GLX A;  4H3S A;  4C2M A;  1E61 A;  1QCS A;  2JIQ A;  4KLN A;  1ZC1 A;  2JIM A;  3QC8 A;  5B6C A;  5C18 A;  3FKI A;  2E2H A;  2V45 A;  2NAP A;  1UHE A;  1GTS A;  1E5V A;  5IZN A;  1L8F A;  5FTK A;  3X2M A;  1NXZ A;  1O0B A;  1PT0 A;  2JIP A;  1Q16 A;  1QTQ A;  1FDI A;  2ENG A;  1PT1 A;  2PJH B;  2C45 A;  4RV0 A;  1VC3 B;  3X2N A;  2YUJ A;  2R7Z A;  2A6E D;  3X2L A;  3IR7 A;  3GTJ A;  2NWA A;  4JCW A;  1EUY A;  5DYG A;  1VHK A;  4WCE S;  2CX8 A;  5T5M D;  5GAE W;  1G8J A;  2HZ7 A;  1TWF A;  1PYQ A;  2BE5 D;  2WAQ A;  3AII A;  5GLY A;  1TWG A;  1YNN D;  3SUM A;  1E18 A;  1VHY A; 
#chains in the Genus database with same CATH homology
 4AAY A;  2E2I A;  2JA6 A;  3X2J A;  3M3G A;  3IR5 A;  4JJO A;  1EU1 A;  1KQF A;  4AOK B;  1YNJ D;  2KI8 A;  1PQH A;  2JA7 A;  1YLE A;  4JS7 A;  2A6H D;  1HD5 A;  4KOD A;  1SFO A;  3SUK A;  4CS0 A;  1Y1V A;  5FTN A;  2PI8 A;  1CR5 A;  3X2H A;  1Y4Z A;  4AON B;  1FDO A;  1BW3 A;  1UHD A;  2KQA A;  1PQE A;  1PQF A;  1R7R A;  3CZB A;  1R27 A;  4KDL A;  5FTM A;  1K83 A;  1WC2 A;  1E32 A;  3X2O A;  2B63 A;  1R9T A;  3X2P A;  3X2G A;  2GAE A;  3X2K A;  1G8K A;  1Y1W A;  4AVR A;  1I3Q A;  3CQZ A;  3IR6 A;  5FTL A;  3GTL A;  2E7Z A;  1OGY A;  1BW4 A;  1TWC A;  4GA5 A;  3TIW A;  3HU2 A;  3QQ7 A;  4NOH A;  2VPZ A;  5FTJ A;  2AE0 X;  4KO8 A;  5EPP A;  1PPY A;  2YU9 A;  3GTP A;  4D7Z B;  2G5D A;  1TMO A;  2VPY A;  1CZ4 A;  4KDI A;  1Y5I A;  4QIW A;  3QQ8 A;  1ZYR D;  2O5J D;  1CZ5 A;  1DMS A;  2PJJ A;  5C1B A;  1WLF A;  1AA6 A;  1OA7 A;  2VPW A;  2G6G A;  4FG4 A;  3GTO A;  1S3S A;  2R93 A;  4ZM7 A;  1TWH A;  3GTK A;  1OA9 A;  2NYA A;  2PNW A;  3X2I A;  3H0G A;  3OUG A;  2JA5 A;  3HU3 A;  2V3V A;  3HU1 A;  4GA6 A;  2EEO B;  4FG2 A;  5H4U A;  3HKZ A;  4ENG A;  3CF2 A;  2HCZ X;  5T5I D;  1I50 A;  2DMR A;  1H5N A;  3DMR A;  1SIW A;  3D30 A;  4FFT A;  2JIR A;  5GLF A;  1N10 A;  4AYB A;  5GM9 A;  2A68 D;  3O5A A;  1AW8 B;  3GTM A;  1WCM A;  3ENG A;  4JP7 A;  2NVX A;  2JIO A;  2WB1 A;  1QDN A;  2NVY A;  2A69 D;  2Y0S A;  4L48 A;  2VUM A;  4FER A;  4CRZ A;  3SUL A;  3GTG A;  2VPX A;  3TM7 B;  2R92 A;  3GTQ A;  1E60 A;  2CW0 D;  2PMZ A;  1IW7 D;  3ML1 A;  1H0H A;  3SUJ A;  2PIC A;  4DMR A;  3PLX B;  4CRY G;  1SMY D;  2BH0 A;  1KQG A;  1PYU B;  2IV2 X;  1TWA A;  3QWZ A;  4AZD A;  1DMR A;  4JP6 A;  5GLX A;  5DYI A;  4C2M A;  1E61 A;  1QCS A;  2JIQ A;  4KLN A;  1ZC1 A;  2JIM A;  3QC8 A;  5B6C A;  5C18 A;  3FKI A;  2E2H A;  2V45 A;  2NAP A;  1UHE A;  1E5V A;  1L8F A;  5FTK A;  3X2M A;  1PT0 A;  2JIP A;  1Q16 A;  1FDI A;  2ENG A;  1PT1 A;  2PJH B;  2C45 A;  4RV0 A;  1VC3 B;  3X2N A;  2YUJ A;  2R7Z A;  3X2L A;  2A6E D;  3IR7 A;  3GTJ A;  4JCW A;  5DYG A;  5T5M D;  1G8J A;  1TWF A;  1PYQ A;  2BE5 D;  2WAQ A;  5GLY A;  1TWG A;  1YNN D;  3SUM A;  1E18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...