2GAEA

Crystal structure of mlta from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
333
structure length
333
Chain Sequence
KPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Crystal Structures of the Lytic Transglycosylase MltA from N.gonorrhoeae and E.coli: Insights into Interdomain Movements and Substrate Binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 333
sequence length 333
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2gaeA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2gaeA02
2G6GA 2GAEA 4FERA 4ZM7A 4JP6A 3SUMA 3SULA 4JP7A 5H4UA 1BW4A 2KQAA 3X2HA 4JJOA 1HD5A 4FG4A 3X2JA 4ENGA 2BH0A 1WC2A 4AVRA 3ENGA 1OA9A 1L8FA 4JCWA 3X2IA 5GLXA 3SUJA 3D30A 4L48A 3M3GA 3X2NA 3X2MA 5GM9A 3SUKA 2HCZX 5GLYA 3X2KA 2AE0X 2G5DA 4JS7A 2PJJA 3X2GA 1BW3A 3X2OA 1N10A 2PNWA 2ENGA 3CZBA 2PI8A 3X2PA 4FG2A 4FFTA 1OA7A 3X2LA 2PICA
chains in the Genus database with same CATH superfamily
1R27A 5FTKA 4FERA 1GTRA 3IR6A 4JP6A 1YLEA 2VUMA 3PIPS 1R9TA 3SULA 2R7ZA 1PT1A 5DM7S 2VPYA 4H4KA 1BW4A 4JXXA 4RV0A 4H3SA 3X2HA 1VC3B 1V6ZA 4WFNS 5DM6S 4FG4A 1CZ4A 1ZC1A 1CR5A 1WC2A 4AVRA 2B63A 3ENGA 5HL7S 3PLXB 4JCWA 4WCES 3X2IA 3HU2A 1QRUA 4IO9S 1AA6A 1ZJWA 3M3GA 3KW2A 3X2MA 3IR5A 2NWAA 4DMRA 1H0HA 1WLFA 2Y0SA 4L69A 4JXZA 4QIWA 1DMRA 4AAYA 1E61A 5BNZA 1I50A 4V194 1PT0A 1TWGA 3X2GA 1Y1VA 4KDLA 4WFAS 1Z85A 1PQFA 5C18A 4FG2A 3CF5S 2E7ZA 1OA7A 2V3VA 2PICA 1S3SA 1Y1WA 2G6GA 1E60A 1PQEA 1UDXA 2EGVA 2GAEA 5GADW 1QCSA 5C1BA 3SUMA 4WFBS 4JP7A 1NXZA 1Y5IA 2ZJRS 5FTNA 2NYAA 5DYGA 1D6KA 1PYQA 1QRTA 1HD5A 1QDNA 3X2JA 1YNJD 4E8BA 1O0CA 1TWHA 3QWZA 5IZNA 1I3QA 1L8FA 4U67S 5JVGS 4AOKB 3SUJA 2R92A 3D30A 2YUJA 4L48A 3AIIA 3OUGA 4IOCS 1DFUP 3QC8A 1FEUA 2CW0D 1QTQA 5DYIA 5GLYA 1VHYA 2AE0X 3H0GA 2PJJA 3ML1A 4KDIA 2NVXA 1BW3A 3CZBA 5FTLA 4FFTA 1Y4ZA 3J7ZV 3DMRA 1KQGA 1TWFA 1G8KA 2KI8A 3GTLA 2IV2X 1UHEA 1ZYRD 4ZM7A 4C2MA 1AW8B 1OGYA 4D7ZB 5FTMA 2WAQA 1EUQA 4UY88 3W2WB 1IW7D 2KQAA 2HZ7A 1Q16A 1G8JA 5GLFA 2YU9A 3IR7A 2JIPA 4GA6A 4KLNA 4ENGA 2VPZA 5GAEW 1E5VA 1O0BA 1EU1A 3GTOA 2A6HD 5GAGW 5EPPA 3DLLS 1R7RA 1VHKA 2A68D 1B75A 2VPXA 3TIWA 2JIOA 5T5ID 2EEOB 3QQ7A 5T5MD 2VPWA 3HU3A 5GM9A 3X2NA 4CS0A 3GTMA 1E18A 2NAPA 2E2HA 3SUKA 2JA7A 5GAHW 2RD2A 2ZJPS 4KO8A 1DMSA 1PQHA 3HU1A 4JS7A 3O5AA 3X2OA 2ENGA 1PYUB 2PI8A 5FTJA 1SFOA 2A69D 1GTSA 4P2BA 4GA5A 3X2LA 2E2IA 4J3CA 2BE5D 4AONB 2V45A 1EXDA 4CRZA 1YNND 2JA6A 3X1LB 1E32A 1QRSA 1PPYA 1UHDA 2A6ED 1H5NA 3QQ8A 3TM7B 5B6CA 4KODA 5H4UA 2O5JD 3W2VB 3CF2A 2RE8A 2R93A 1FDOA 1FDIA 1TMOA 3PIOS 4WF9S 4JJOA 2JA5A 1TWCA 2PJHB 2BH0A 2JIMA 4CRYG 3GTGA 1NYLA 2EGWA 2WB1A 4AZDA 1OA9A 2CX8A 1K83A 2JIQA 4JYZA 5GLXA 2JIRA 3HKZA 3GTPA 1TWAA 2ZJQS 2C45A 4IOAS 2HCZX 4AYBA 1SIWA 3X2KA 2PMZA 2DMRA 2NVYA 2G5DA 5JVHS 3FKIA 3GTJA 1N10A 2PNWA 1WCMA 1KQFA 3GTKA 3X2PA 3CQZA 1SMYD 3GTQA 4NOHA 1EUYA 2Z0YA 1CZ5A
chains in the Genus database with same CATH topology
1R27A 5FTKA 4FERA 3IR6A 4JP6A 1YLEA 2VUMA 1R9TA 3SULA 2R7ZA 1PT1A 2VPYA 1BW4A 4RV0A 3X2HA 1VC3B 4FG4A 1CZ4A 1ZC1A 1CR5A 1WC2A 4AVRA 2B63A 3ENGA 3PLXB 4JCWA 3X2IA 3HU2A 1AA6A 3M3GA 3X2MA 3IR5A 4DMRA 1H0HA 1WLFA 2Y0SA 4QIWA 1DMRA 4AAYA 1E61A 1I50A 1PT0A 1TWGA 3X2GA 1Y1VA 4KDLA 1PQFA 5C18A 4FG2A 2E7ZA 1OA7A 2V3VA 2PICA 1S3SA 1Y1WA 2G6GA 1E60A 1PQEA 2GAEA 1QCSA 5C1BA 3SUMA 4JP7A 1Y5IA 5FTNA 2NYAA 5DYGA 1PYQA 1HD5A 3X2JA 1QDNA 1YNJD 1TWHA 3QWZA 1I3QA 1L8FA 4AOKB 3SUJA 2R92A 3D30A 4L48A 2YUJA 3OUGA 3QC8A 2CW0D 5DYIA 5GLYA 2AE0X 3H0GA 2PJJA 3ML1A 1BW3A 4KDIA 2NVXA 3CZBA 5FTLA 4FFTA 1Y4ZA 3DMRA 1KQGA 1TWFA 1G8KA 2KI8A 3GTLA 2IV2X 1UHEA 4ZM7A 1ZYRD 4C2MA 1AW8B 1OGYA 4D7ZB 5FTMA 2WAQA 2KQAA 1IW7D 1Q16A 1G8JA 5GLFA 2YU9A 3IR7A 4ENGA 2JIPA 4GA6A 4KLNA 2VPZA 1E5VA 3TIWA 1EU1A 3GTOA 2A6HD 5EPPA 1R7RA 2A68D 2VPXA 3X2NA 2JIOA 5T5ID 2EEOB 3QQ7A 5T5MD 2VPWA 5GM9A 3HU3A 4CS0A 3GTMA 2E2HA 1E18A 2NAPA 2JA7A 3SUKA 4KO8A 1DMSA 1PQHA 3HU1A 4JS7A 3O5AA 3X2OA 2ENGA 1PYUB 2PI8A 5FTJA 1SFOA 2A69D 3X2LA 4GA5A 2E2IA 2BE5D 4AONB 2V45A 4CRZA 1YNND 2JA6A 1E32A 1PPYA 1UHDA 2A6ED 1H5NA 3QQ8A 3TM7B 5B6CA 5H4UA 4KODA 2O5JD 3CF2A 2R93A 1FDOA 1FDIA 1TMOA 4JJOA 2JA5A 1TWCA 2PJHB 2BH0A 2JIMA 4CRYG 3GTGA 2WB1A 4AZDA 1OA9A 1K83A 2JIQA 5GLXA 2JIRA 3HKZA 3GTPA 1TWAA 2C45A 2HCZX 4AYBA 3X2KA 1SIWA 2PMZA 2DMRA 2NVYA 2G5DA 3FKIA 3GTJA 1N10A 2PNWA 1WCMA 1KQFA 3GTKA 3X2PA 3CQZA 1SMYD 3GTQA 4NOHA 1CZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6G A;  2GAE A;  4FER A;  4ZM7 A;  4JP6 A;  3SUM A;  3SUL A;  4JP7 A;  5H4U A;  1BW4 A;  2KQA A;  3X2H A;  4JJO A;  1HD5 A;  4FG4 A;  3X2J A;  4ENG A;  2BH0 A;  1WC2 A;  4AVR A;  3ENG A;  1OA9 A;  1L8F A;  4JCW A;  3X2I A;  5GLX A;  3SUJ A;  3D30 A;  4L48 A;  3M3G A;  3X2N A;  3X2M A;  5GM9 A;  3SUK A;  2HCZ X;  5GLY A;  3X2K A;  2AE0 X;  2G5D A;  4JS7 A;  2PJJ A;  3X2G A;  1BW3 A;  3X2O A;  1N10 A;  2PNW A;  2ENG A;  3CZB A;  2PI8 A;  3X2P A;  4FG2 A;  4FFT A;  1OA7 A;  3X2L A;  2PIC A; 
#chains in the Genus database with same CATH topology
 1R27 A;  5FTK A;  4FER A;  1GTR A;  3IR6 A;  4JP6 A;  1YLE A;  2VUM A;  3PIP S;  1R9T A;  3SUL A;  2R7Z A;  1PT1 A;  5DM7 S;  2VPY A;  4H4K A;  1BW4 A;  4JXX A;  4RV0 A;  4H3S A;  3X2H A;  1VC3 B;  1V6Z A;  4WFN S;  5DM6 S;  4FG4 A;  1CZ4 A;  1ZC1 A;  1CR5 A;  1WC2 A;  4AVR A;  2B63 A;  3ENG A;  5HL7 S;  3PLX B;  4JCW A;  4WCE S;  3X2I A;  3HU2 A;  1QRU A;  4IO9 S;  1AA6 A;  1ZJW A;  3M3G A;  3KW2 A;  3X2M A;  3IR5 A;  2NWA A;  4DMR A;  1H0H A;  1WLF A;  2Y0S A;  4L69 A;  4JXZ A;  4QIW A;  1DMR A;  4AAY A;  1E61 A;  5BNZ A;  1I50 A;  4V19 4;  1PT0 A;  1TWG A;  3X2G A;  1Y1V A;  4KDL A;  4WFA S;  1Z85 A;  1PQF A;  5C18 A;  4FG2 A;  3CF5 S;  2E7Z A;  1OA7 A;  2V3V A;  2PIC A;  1S3S A;  1Y1W A;  2G6G A;  1E60 A;  1PQE A;  1UDX A;  2EGV A;  2GAE A;  5GAD W;  1QCS A;  5C1B A;  3SUM A;  4WFB S;  4JP7 A;  1NXZ A;  1Y5I A;  2ZJR S;  5FTN A;  2NYA A;  5DYG A;  1D6K A;  1PYQ A;  1QRT A;  1HD5 A;  1QDN A;  3X2J A;  1YNJ D;  4E8B A;  1O0C A;  1TWH A;  3QWZ A;  5IZN A;  1I3Q A;  1L8F A;  4U67 S;  5JVG S;  4AOK B;  3SUJ A;  2R92 A;  3D30 A;  2YUJ A;  4L48 A;  3AII A;  3OUG A;  4IOC S;  1DFU P;  3QC8 A;  1FEU A;  2CW0 D;  1QTQ A;  5DYI A;  5GLY A;  1VHY A;  2AE0 X;  3H0G A;  2PJJ A;  3ML1 A;  4KDI A;  2NVX A;  1BW3 A;  3CZB A;  5FTL A;  4FFT A;  1Y4Z A;  3J7Z V;  3DMR A;  1KQG A;  1TWF A;  1G8K A;  2KI8 A;  3GTL A;  2IV2 X;  1UHE A;  1ZYR D;  4ZM7 A;  4C2M A;  1AW8 B;  1OGY A;  4D7Z B;  5FTM A;  2WAQ A;  1EUQ A;  4UY8 8;  3W2W B;  1IW7 D;  2KQA A;  2HZ7 A;  1Q16 A;  1G8J A;  5GLF A;  2YU9 A;  3IR7 A;  2JIP A;  4GA6 A;  4KLN A;  4ENG A;  2VPZ A;  5GAE W;  1E5V A;  1O0B A;  1EU1 A;  3GTO A;  2A6H D;  5GAG W;  5EPP A;  3DLL S;  1R7R A;  1VHK A;  2A68 D;  1B75 A;  2VPX A;  3TIW A;  2JIO A;  5T5I D;  2EEO B;  3QQ7 A;  5T5M D;  2VPW A;  3HU3 A;  5GM9 A;  3X2N A;  4CS0 A;  3GTM A;  1E18 A;  2NAP A;  2E2H A;  3SUK A;  2JA7 A;  5GAH W;  2RD2 A;  2ZJP S;  4KO8 A;  1DMS A;  1PQH A;  3HU1 A;  4JS7 A;  3O5A A;  3X2O A;  2ENG A;  1PYU B;  2PI8 A;  5FTJ A;  1SFO A;  2A69 D;  1GTS A;  4P2B A;  4GA5 A;  3X2L A;  2E2I A;  4J3C A;  2BE5 D;  4AON B;  2V45 A;  1EXD A;  4CRZ A;  1YNN D;  2JA6 A;  3X1L B;  1E32 A;  1QRS A;  1PPY A;  1UHD A;  2A6E D;  1H5N A;  3QQ8 A;  3TM7 B;  5B6C A;  4KOD A;  5H4U A;  2O5J D;  3W2V B;  3CF2 A;  2RE8 A;  2R93 A;  1FDO A;  1FDI A;  1TMO A;  3PIO S;  4WF9 S;  4JJO A;  2JA5 A;  1TWC A;  2PJH B;  2BH0 A;  2JIM A;  4CRY G;  3GTG A;  1NYL A;  2EGW A;  2WB1 A;  4AZD A;  1OA9 A;  2CX8 A;  1K83 A;  2JIQ A;  4JYZ A;  5GLX A;  2JIR A;  3HKZ A;  3GTP A;  1TWA A;  2ZJQ S;  2C45 A;  4IOA S;  2HCZ X;  4AYB A;  1SIW A;  3X2K A;  2PMZ A;  2DMR A;  2NVY A;  2G5D A;  5JVH S;  3FKI A;  3GTJ A;  1N10 A;  2PNW A;  1WCM A;  1KQF A;  3GTK A;  3X2P A;  3CQZ A;  1SMY D;  3GTQ A;  4NOH A;  1EUY A;  2Z0Y A;  1CZ5 A; 
#chains in the Genus database with same CATH homology
 1R27 A;  5FTK A;  4FER A;  3IR6 A;  4JP6 A;  1YLE A;  2VUM A;  1R9T A;  3SUL A;  2R7Z A;  1PT1 A;  2VPY A;  1BW4 A;  4RV0 A;  3X2H A;  1VC3 B;  4FG4 A;  1CZ4 A;  1ZC1 A;  1CR5 A;  1WC2 A;  4AVR A;  2B63 A;  3ENG A;  3PLX B;  4JCW A;  3X2I A;  3HU2 A;  1AA6 A;  3M3G A;  3X2M A;  3IR5 A;  4DMR A;  1H0H A;  1WLF A;  2Y0S A;  4QIW A;  1DMR A;  4AAY A;  1E61 A;  1I50 A;  1PT0 A;  1TWG A;  3X2G A;  1Y1V A;  4KDL A;  1PQF A;  5C18 A;  4FG2 A;  2E7Z A;  1OA7 A;  2V3V A;  2PIC A;  1S3S A;  1Y1W A;  2G6G A;  1E60 A;  1PQE A;  2GAE A;  1QCS A;  5C1B A;  3SUM A;  4JP7 A;  1Y5I A;  5FTN A;  2NYA A;  5DYG A;  1PYQ A;  1HD5 A;  3X2J A;  1QDN A;  1YNJ D;  1TWH A;  3QWZ A;  1I3Q A;  1L8F A;  4AOK B;  3SUJ A;  2R92 A;  3D30 A;  4L48 A;  2YUJ A;  3OUG A;  3QC8 A;  2CW0 D;  5DYI A;  5GLY A;  2AE0 X;  3H0G A;  2PJJ A;  3ML1 A;  1BW3 A;  4KDI A;  2NVX A;  3CZB A;  5FTL A;  4FFT A;  1Y4Z A;  3DMR A;  1KQG A;  1TWF A;  1G8K A;  2KI8 A;  3GTL A;  2IV2 X;  1UHE A;  4ZM7 A;  1ZYR D;  4C2M A;  1AW8 B;  1OGY A;  4D7Z B;  5FTM A;  2WAQ A;  2KQA A;  1IW7 D;  1Q16 A;  1G8J A;  5GLF A;  2YU9 A;  3IR7 A;  4ENG A;  2JIP A;  4GA6 A;  4KLN A;  2VPZ A;  1E5V A;  3TIW A;  1EU1 A;  3GTO A;  2A6H D;  5EPP A;  1R7R A;  2A68 D;  2VPX A;  3X2N A;  2JIO A;  5T5I D;  2EEO B;  3QQ7 A;  5T5M D;  2VPW A;  5GM9 A;  3HU3 A;  4CS0 A;  3GTM A;  2E2H A;  1E18 A;  2NAP A;  2JA7 A;  3SUK A;  4KO8 A;  1DMS A;  1PQH A;  3HU1 A;  4JS7 A;  3O5A A;  3X2O A;  2ENG A;  1PYU B;  2PI8 A;  5FTJ A;  1SFO A;  2A69 D;  3X2L A;  4GA5 A;  2E2I A;  2BE5 D;  4AON B;  2V45 A;  4CRZ A;  1YNN D;  2JA6 A;  1E32 A;  1PPY A;  1UHD A;  2A6E D;  1H5N A;  3QQ8 A;  3TM7 B;  5B6C A;  5H4U A;  4KOD A;  2O5J D;  3CF2 A;  2R93 A;  1FDO A;  1FDI A;  1TMO A;  4JJO A;  2JA5 A;  1TWC A;  2PJH B;  2BH0 A;  2JIM A;  4CRY G;  3GTG A;  2WB1 A;  4AZD A;  1OA9 A;  1K83 A;  2JIQ A;  5GLX A;  2JIR A;  3HKZ A;  3GTP A;  1TWA A;  2C45 A;  2HCZ X;  4AYB A;  3X2K A;  1SIW A;  2PMZ A;  2DMR A;  2NVY A;  2G5D A;  3FKI A;  3GTJ A;  1N10 A;  2PNW A;  1WCM A;  1KQF A;  3GTK A;  3X2P A;  3CQZ A;  1SMY D;  3GTQ A;  4NOH A;  1CZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...