2GAEA

Crystal structure of mlta from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
333
structure length
333
Chain Sequence
b'KPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Crystal Structures of the Lytic Transglycosylase MltA from N.gonorrhoeae and E.coli: Insights into Interdomain Movements and Substrate Binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 333
sequence length 333
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2gaeA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2gaeA02
1BW4A 1OA9A 3CZBA 3ENGA 3X2MA 3SUJA 3X2IA 3SULA 4JP6A 4ENGA 4FG2A 4JS7A 3X2GA 2BH0A 2PNWA 3X2PA 1WC2A 3X2LA 5GLYA 2PI8A 3M3GA 4FERA 4L48A 4ZM7A 2PJJA 3SUKA 1N10A 2G6GA 2AE0X 1L8FA 4JCWA 5H4UA 3X2NA 1BW3A 4JP7A 3X2JA 4JJOA 4FFTA 4AVRA 3X2OA 2HCZX 4FG4A 3X2KA 2GAEA 2G5DA 3X2HA 2PICA 1HD5A 5GLXA 2ENGA 5GM9A 3D30A 3SUMA 1OA7A 2KQAA
chains in the Genus database with same CATH superfamily
4GA5A 2DMRA 2VPWA 1G8KA 3CZBA 1Y5IA 2CX8A 4WF9S 1PYQA 3X2MA 1Q16A 1TWCA 3SUJA 5DM6S 3GTKA 4L69A 1E18A 4QIWA 2R93A 4JP6A 4ENGA 1AW8B 3PLXB 4FG2A 5BNZA 1WC2A 3X2LA 1QRSA 5GLYA 4IOCS 4V194 3CF2A 2PI8A 1I50A 1CR5A 2V45A 1UDXA 4JXXA 1DMRA 3GTGA 2JA6A 1H5NA 1N10A 1GTSA 1E5VA 1TWAA 4JCWA 5H4UA 1Y1WA 2A6ED 1PQHA 4CRYG 1QRTA 4JP7A 1Y1VA 4AVRA 2JIQA 1PPYA 1KQFA 4AZDA 4WFNS 2G5DA 3GTLA 2CW0D 2PICA 5DYIA 3X2HA 5GLXA 5GM9A 2EGVA 1EUQA 3J7ZV 3GTJA 3HU2A 1FDOA 1YLEA 2B63A 1R7RA 2A6HD 2EEOB 3HU3A 5B6CA 1SFOA 4KODA 2VPZA 3GTMA 4P2BA 2VPXA 3SULA 3IR5A 5FTLA 5FTJA 3DLLS 1E61A 1CZ5A 3X1LB 2RD2A 3O5AA 2PMZA 3OUGA 1IW7D 1EU1A 3W2WB 1QRUA 5FTMA 4IOAS 2A69D 4IO9S 5FTKA 2PJJA 2C45A 4ZM7A 1I3QA 3W2VB 2BE5D 4UY88 2G6GA 2O5JD 3PIPS 1Z85A 1EUYA 1CZ4A 2NVYA 3QQ8A 4AONB 3TM7B 1PQFA 3KW2A 1PQEA 1UHEA 1FEUA 3X2JA 3FKIA 4FFTA 5T5ID 1AA6A 1H0HA 1R27A 2HCZX 3HKZA 5C1BA 3GTQA 2RE8A 2JA7A 2A68D 1D6KA 2JIOA 1PT1A 3CQZA 2YU9A 3SUMA 1PT0A 1VHYA 4AOKB 4WFAS 1ZC1A 4AAYA 2ZJRS 4JS7A 3H0GA 4KO8A 5FTNA 1OA9A 3CF5S 5HL7S 1QDNA 4U67S 3DMRA 4H3SA 1TWFA 1ZJWA 1VC3B 3X2IA 5JVGS 1EXDA 2VPYA 2WB1A 2NVXA 4JYZA 2JIRA 2V3VA 1DFUP 4KLNA 3X2GA 2BH0A 2KI8A 3HU1A 1E60A 3X2PA 1YNJD 2E2IA 1KQGA 4AYBA 1NXZA 5GADW 5GLFA 2E7ZA 4FERA 4L48A 1B75A 4JXZA 1NYLA 1UHDA 2AE0X 1E32A 1L8FA 2IV2X 4DMRA 2Z0YA 2ZJQS 1S3SA 2Y0SA 1VHKA 4GA6A 3PIOS 4H4KA 3X2KA 1WCMA 5GAHW 1SMYD 2GAEA 5GAEW 1K83A 5C18A 3GTPA 5T5MD 1FDIA 2R7ZA 3D30A 2E2HA 1G8JA 3ML1A 4D7ZB 2JA5A 2EGWA 1BW4A 3IR6A 3QQ7A 3QWZA 1Y4ZA 5DYGA 1OGYA 3ENGA 4C2MA 2JIMA 5DM7S 4CRZA 4RV0A 4CS0A 3GTOA 2JIPA 4WCES 4KDIA 1QCSA 2PNWA 4NOHA 3QC8A 1V6ZA 1O0BA 1R9TA 2R92A 3AIIA 3TIWA 2PJHB 3M3GA 2NAPA 4WFBS 5JVHS 3SUKA 1DMSA 2NYAA 3X2NA 5IZNA 1BW3A 2ZJPS 4KDLA 1TWHA 4E8BA 3IR7A 1SIWA 1WLFA 4JJOA 1ZYRD 2VUMA 3X2OA 1TMOA 4J3CA 4FG4A 5GAGW 2HZ7A 2WAQA 5EPPA 1O0CA 2NWAA 1TWGA 1QTQA 2YUJA 1HD5A 2ENGA 1GTRA 1YNND 1OA7A 1PYUB 2KQAA
chains in the Genus database with same CATH topology
4GA5A 2DMRA 2VPWA 1G8KA 3CZBA 1Y5IA 1PYQA 3X2MA 1Q16A 3SUJA 1TWCA 3GTKA 1E18A 4QIWA 2R93A 4JP6A 4ENGA 4FG2A 1AW8B 3PLXB 1WC2A 3X2LA 5GLYA 3CF2A 2PI8A 1I50A 1CR5A 2V45A 1DMRA 3GTGA 2JA6A 1H5NA 1N10A 1E5VA 1TWAA 4JCWA 5H4UA 1Y1WA 2A6ED 1PQHA 4CRYG 4JP7A 1Y1VA 4AVRA 2JIQA 1PPYA 1KQFA 4AZDA 2G5DA 3GTLA 3X2HA 2PICA 2CW0D 5DYIA 5GLXA 5GM9A 3GTJA 3HU2A 1FDOA 1YLEA 2B63A 1R7RA 2A6HD 2EEOB 3HU3A 5B6CA 1SFOA 4KODA 2VPZA 3GTMA 2VPXA 3SULA 3IR5A 5FTLA 5FTJA 1E61A 1CZ5A 3O5AA 2PMZA 3OUGA 1IW7D 1EU1A 5FTMA 2A69D 4ZM7A 2PJJA 2C45A 5FTKA 1I3QA 2BE5D 2G6GA 2O5JD 1CZ4A 2NVYA 3QQ8A 4AONB 3TM7B 1PQFA 1PQEA 1UHEA 3X2JA 3FKIA 4FFTA 5T5ID 1AA6A 1H0HA 2HCZX 1R27A 3HKZA 5C1BA 3GTQA 2JA7A 2A68D 2JIOA 1PT1A 3CQZA 2YU9A 3SUMA 1PT0A 4AOKB 1ZC1A 4AAYA 4JS7A 3H0GA 4KO8A 5FTNA 1OA9A 1QDNA 3DMRA 1TWFA 3X2IA 1VC3B 2VPYA 2WB1A 2NVXA 2JIRA 2V3VA 3X2GA 4KLNA 2BH0A 3X2PA 2KI8A 1E60A 3HU1A 1YNJD 2E2IA 1KQGA 4AYBA 5GLFA 2E7ZA 4FERA 4L48A 1UHDA 2AE0X 1L8FA 1E32A 2IV2X 4DMRA 1S3SA 2Y0SA 4GA6A 3X2KA 1WCMA 2GAEA 1SMYD 1K83A 5C18A 3GTPA 5T5MD 1FDIA 2R7ZA 3D30A 2E2HA 1G8JA 3ML1A 4D7ZB 2JA5A 1BW4A 3IR6A 3QQ7A 3QWZA 1Y4ZA 5DYGA 1OGYA 3ENGA 4C2MA 2JIMA 4CRZA 4RV0A 4CS0A 3GTOA 2JIPA 4KDIA 1QCSA 2PNWA 4NOHA 3QC8A 1R9TA 2R92A 3TIWA 2PJHB 3M3GA 2NAPA 3SUKA 1DMSA 2NYAA 3X2NA 1BW3A 4KDLA 1TWHA 3IR7A 1SIWA 4JJOA 1WLFA 1ZYRD 2VUMA 3X2OA 1TMOA 4FG4A 2WAQA 5EPPA 1TWGA 2YUJA 1HD5A 2ENGA 1YNND 1OA7A 1PYUB 2KQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BW4 A;  1OA9 A;  3CZB A;  3ENG A;  3X2M A;  3SUJ A;  3X2I A;  3SUL A;  4JP6 A;  4ENG A;  4FG2 A;  4JS7 A;  3X2G A;  2BH0 A;  2PNW A;  3X2P A;  1WC2 A;  3X2L A;  5GLY A;  2PI8 A;  3M3G A;  4FER A;  4L48 A;  4ZM7 A;  2PJJ A;  3SUK A;  1N10 A;  2G6G A;  2AE0 X;  1L8F A;  4JCW A;  5H4U A;  3X2N A;  1BW3 A;  4JP7 A;  3X2J A;  4JJO A;  4FFT A;  4AVR A;  3X2O A;  2HCZ X;  4FG4 A;  3X2K A;  2GAE A;  2G5D A;  3X2H A;  2PIC A;  1HD5 A;  5GLX A;  2ENG A;  5GM9 A;  3D30 A;  3SUM A;  1OA7 A;  2KQA A; 
#chains in the Genus database with same CATH topology
 4GA5 A;  2DMR A;  2VPW A;  1G8K A;  3CZB A;  1Y5I A;  2CX8 A;  4WF9 S;  1PYQ A;  3X2M A;  1Q16 A;  1TWC A;  3SUJ A;  5DM6 S;  3GTK A;  4L69 A;  1E18 A;  4QIW A;  2R93 A;  4JP6 A;  4ENG A;  1AW8 B;  3PLX B;  4FG2 A;  5BNZ A;  1WC2 A;  3X2L A;  1QRS A;  5GLY A;  4IOC S;  4V19 4;  3CF2 A;  2PI8 A;  1I50 A;  1CR5 A;  2V45 A;  1UDX A;  4JXX A;  1DMR A;  3GTG A;  2JA6 A;  1H5N A;  1N10 A;  1GTS A;  1E5V A;  1TWA A;  4JCW A;  5H4U A;  1Y1W A;  2A6E D;  1PQH A;  4CRY G;  1QRT A;  4JP7 A;  1Y1V A;  4AVR A;  2JIQ A;  1PPY A;  1KQF A;  4AZD A;  4WFN S;  2G5D A;  3GTL A;  2CW0 D;  2PIC A;  5DYI A;  3X2H A;  5GLX A;  5GM9 A;  2EGV A;  1EUQ A;  3J7Z V;  3GTJ A;  3HU2 A;  1FDO A;  1YLE A;  2B63 A;  1R7R A;  2A6H D;  2EEO B;  3HU3 A;  5B6C A;  1SFO A;  4KOD A;  2VPZ A;  3GTM A;  4P2B A;  2VPX A;  3SUL A;  3IR5 A;  5FTL A;  5FTJ A;  3DLL S;  1E61 A;  1CZ5 A;  3X1L B;  2RD2 A;  3O5A A;  2PMZ A;  3OUG A;  1IW7 D;  1EU1 A;  3W2W B;  1QRU A;  5FTM A;  4IOA S;  2A69 D;  4IO9 S;  5FTK A;  2PJJ A;  2C45 A;  4ZM7 A;  1I3Q A;  3W2V B;  2BE5 D;  4UY8 8;  2G6G A;  2O5J D;  3PIP S;  1Z85 A;  1EUY A;  1CZ4 A;  2NVY A;  3QQ8 A;  4AON B;  3TM7 B;  1PQF A;  3KW2 A;  1PQE A;  1UHE A;  1FEU A;  3X2J A;  3FKI A;  4FFT A;  5T5I D;  1AA6 A;  1H0H A;  1R27 A;  2HCZ X;  3HKZ A;  5C1B A;  3GTQ A;  2RE8 A;  2JA7 A;  2A68 D;  1D6K A;  2JIO A;  1PT1 A;  3CQZ A;  2YU9 A;  3SUM A;  1PT0 A;  1VHY A;  4AOK B;  4WFA S;  1ZC1 A;  4AAY A;  2ZJR S;  4JS7 A;  3H0G A;  4KO8 A;  5FTN A;  1OA9 A;  3CF5 S;  5HL7 S;  1QDN A;  4U67 S;  3DMR A;  4H3S A;  1TWF A;  1ZJW A;  1VC3 B;  3X2I A;  5JVG S;  1EXD A;  2VPY A;  2WB1 A;  2NVX A;  4JYZ A;  2JIR A;  2V3V A;  1DFU P;  4KLN A;  3X2G A;  2BH0 A;  2KI8 A;  3HU1 A;  1E60 A;  3X2P A;  1YNJ D;  2E2I A;  1KQG A;  4AYB A;  1NXZ A;  5GAD W;  5GLF A;  2E7Z A;  4FER A;  4L48 A;  1B75 A;  4JXZ A;  1NYL A;  1UHD A;  2AE0 X;  1E32 A;  1L8F A;  2IV2 X;  4DMR A;  2Z0Y A;  2ZJQ S;  1S3S A;  2Y0S A;  1VHK A;  4GA6 A;  3PIO S;  4H4K A;  3X2K A;  1WCM A;  5GAH W;  1SMY D;  2GAE A;  5GAE W;  1K83 A;  5C18 A;  3GTP A;  5T5M D;  1FDI A;  2R7Z A;  3D30 A;  2E2H A;  1G8J A;  3ML1 A;  4D7Z B;  2JA5 A;  2EGW A;  1BW4 A;  3IR6 A;  3QQ7 A;  3QWZ A;  1Y4Z A;  5DYG A;  1OGY A;  3ENG A;  4C2M A;  2JIM A;  5DM7 S;  4CRZ A;  4RV0 A;  4CS0 A;  3GTO A;  2JIP A;  4WCE S;  4KDI A;  1QCS A;  2PNW A;  4NOH A;  3QC8 A;  1V6Z A;  1O0B A;  1R9T A;  2R92 A;  3AII A;  3TIW A;  2PJH B;  3M3G A;  2NAP A;  4WFB S;  5JVH S;  3SUK A;  1DMS A;  2NYA A;  3X2N A;  5IZN A;  1BW3 A;  2ZJP S;  4KDL A;  1TWH A;  4E8B A;  3IR7 A;  1SIW A;  1WLF A;  4JJO A;  1ZYR D;  2VUM A;  3X2O A;  1TMO A;  4J3C A;  4FG4 A;  5GAG W;  2HZ7 A;  2WAQ A;  5EPP A;  1O0C A;  2NWA A;  1TWG A;  1QTQ A;  2YUJ A;  1HD5 A;  2ENG A;  1GTR A;  1YNN D;  1OA7 A;  1PYU B;  2KQA A; 
#chains in the Genus database with same CATH homology
 4GA5 A;  2DMR A;  2VPW A;  1G8K A;  3CZB A;  1Y5I A;  1PYQ A;  3X2M A;  1Q16 A;  3SUJ A;  1TWC A;  3GTK A;  1E18 A;  4QIW A;  2R93 A;  4JP6 A;  4ENG A;  4FG2 A;  1AW8 B;  3PLX B;  1WC2 A;  3X2L A;  5GLY A;  3CF2 A;  2PI8 A;  1I50 A;  1CR5 A;  2V45 A;  1DMR A;  3GTG A;  2JA6 A;  1H5N A;  1N10 A;  1E5V A;  1TWA A;  4JCW A;  5H4U A;  1Y1W A;  2A6E D;  1PQH A;  4CRY G;  4JP7 A;  1Y1V A;  4AVR A;  2JIQ A;  1PPY A;  1KQF A;  4AZD A;  2G5D A;  3GTL A;  3X2H A;  2PIC A;  2CW0 D;  5DYI A;  5GLX A;  5GM9 A;  3GTJ A;  3HU2 A;  1FDO A;  1YLE A;  2B63 A;  1R7R A;  2A6H D;  2EEO B;  3HU3 A;  5B6C A;  1SFO A;  4KOD A;  2VPZ A;  3GTM A;  2VPX A;  3SUL A;  3IR5 A;  5FTL A;  5FTJ A;  1E61 A;  1CZ5 A;  3O5A A;  2PMZ A;  3OUG A;  1IW7 D;  1EU1 A;  5FTM A;  2A69 D;  4ZM7 A;  2PJJ A;  2C45 A;  5FTK A;  1I3Q A;  2BE5 D;  2G6G A;  2O5J D;  1CZ4 A;  2NVY A;  3QQ8 A;  4AON B;  3TM7 B;  1PQF A;  1PQE A;  1UHE A;  3X2J A;  3FKI A;  4FFT A;  5T5I D;  1AA6 A;  1H0H A;  2HCZ X;  1R27 A;  3HKZ A;  5C1B A;  3GTQ A;  2JA7 A;  2A68 D;  2JIO A;  1PT1 A;  3CQZ A;  2YU9 A;  3SUM A;  1PT0 A;  4AOK B;  1ZC1 A;  4AAY A;  4JS7 A;  3H0G A;  4KO8 A;  5FTN A;  1OA9 A;  1QDN A;  3DMR A;  1TWF A;  3X2I A;  1VC3 B;  2VPY A;  2WB1 A;  2NVX A;  2JIR A;  2V3V A;  3X2G A;  4KLN A;  2BH0 A;  3X2P A;  2KI8 A;  1E60 A;  3HU1 A;  1YNJ D;  2E2I A;  1KQG A;  4AYB A;  5GLF A;  2E7Z A;  4FER A;  4L48 A;  1UHD A;  2AE0 X;  1L8F A;  1E32 A;  2IV2 X;  4DMR A;  1S3S A;  2Y0S A;  4GA6 A;  3X2K A;  1WCM A;  2GAE A;  1SMY D;  1K83 A;  5C18 A;  3GTP A;  5T5M D;  1FDI A;  2R7Z A;  3D30 A;  2E2H A;  1G8J A;  3ML1 A;  4D7Z B;  2JA5 A;  1BW4 A;  3IR6 A;  3QQ7 A;  3QWZ A;  1Y4Z A;  5DYG A;  1OGY A;  3ENG A;  4C2M A;  2JIM A;  4CRZ A;  4RV0 A;  4CS0 A;  3GTO A;  2JIP A;  4KDI A;  1QCS A;  2PNW A;  4NOH A;  3QC8 A;  1R9T A;  2R92 A;  3TIW A;  2PJH B;  3M3G A;  2NAP A;  3SUK A;  1DMS A;  2NYA A;  3X2N A;  1BW3 A;  4KDL A;  1TWH A;  3IR7 A;  1SIW A;  4JJO A;  1WLF A;  1ZYR D;  2VUM A;  3X2O A;  1TMO A;  4FG4 A;  2WAQ A;  5EPP A;  1TWG A;  2YUJ A;  1HD5 A;  2ENG A;  1YNN D;  1OA7 A;  1PYU B;  2KQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...