2GAEA

Crystal structure of mlta from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
333
structure length
333
Chain Sequence
KPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Membrane-bound lytic murein transglycosylase A
publication title Crystal Structures of the Lytic Transglycosylase MltA from N.gonorrhoeae and E.coli: Insights into Interdomain Movements and Substrate Binding.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 333
sequence length 333
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03562 MltA MltA specific insert domain
A PF06725 3D 3D domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2gaeA01
2.40.240.50 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Barwin-like endoglucanases 2gaeA02
1BW4A 3SUKA 4JS7A 3D30A 3X2OA 2KQAA 3X2NA 5H4UA 3M3GA 4FFTA 2PI8A 4AVRA 3SUMA 1N10A 2PNWA 5GLYA 3CZBA 4JJOA 4JP7A 1OA9A 4ENGA 3X2KA 3ENGA 4FG2A 1WC2A 3X2IA 4JCWA 1HD5A 2HCZX 3X2HA 2GAEA 1BW3A 1L8FA 4JP6A 4ZM7A 3SUJA 3SULA 4FERA 4L48A 2ENGA 2G5DA 3X2JA 2PJJA 3X2MA 3X2PA 4FG4A 5GLXA 5GM9A 3X2LA 2BH0A 2PICA 1OA7A 2G6GA 3X2GA 2AE0X
chains in the Genus database with same CATH superfamily
1PT0A 1IW7D 4JXXA 1TWAA 1EUQA 1TWFA 1AA6A 3HKZA 4FFTA 1PQHA 5GAEW 5DYIA 1FDOA 1ZYRD 2E7ZA 2PNWA 2V45A 3CZBA 3OUGA 2VUMA 2JA7A 5FTNA 1QRUA 3X1LB 5FTLA 3CQZA 2YUJA 4AOKB 1NXZA 4H3SA 4L69A 5DM7S 1E60A 3W2VB 4WFAS 2Z0YA 2ZJPS 4CRZA 3GTMA 3TIWA 2JIPA 1CR5A 3QC8A 4JP6A 5FTKA 5FTMA 3GTQA 3SULA 3GTPA 3H0GA 4L48A 1WLFA 2ENGA 5GLFA 2IV2X 1V6ZA 3FKIA 3X2MA 3KW2A 1VC3B 2VPZA 2A6HD 5GLXA 1ZC1A 1G8KA 1E61A 1QCSA 1OA7A 2BH0A 2HZ7A 2R7ZA 3X2GA 1EXDA 1S3SA 4WFBS 2JIRA 1BW4A 3J7ZV 3PIPS 5B6CA 1Y1WA 4JS7A 1DMRA 4KODA 2WB1A 4AZDA 1PT1A 1UHEA 2JIMA 3GTGA 2PI8A 2RD2A 4GA6A 1OGYA 1DMSA 1PYUB 4JJOA 5DYGA 1OA9A 1SMYD 2KI8A 3CF2A 3X2KA 1I3QA 3GTLA 4P2BA 3HU2A 4CS0A 3X2IA 2NVYA 1E32A 2JIQA 4H4KA 2HCZX 1PYQA 4WF9S 4WCES 4UY88 2R93A 1BW3A 1GTSA 1PQFA 2E2IA 4ZM7A 1SIWA 4J3CA 1CZ4A 4KDIA 4NOHA 1YLEA 5JVGS 2A6ED 2PJHB 3PLXB 3X2JA 4JXZA 1KQFA 1DFUP 2EGWA 1KQGA 5EPPA 2NWAA 1UDXA 1PPYA 1YNND 4IOAS 2NYAA 5GM9A 2PMZA 1Q16A 1CZ5A 3SUKA 3O5AA 4C2MA 3X2OA 3IR6A 2KQAA 2JA5A 3X2NA 1EU1A 3M3GA 5IZNA 4KO8A 3SUMA 2Y0SA 3IR7A 5GLYA 1QDNA 1Y1VA 1YNJD 2VPXA 4ENGA 2YU9A 5JVHS 3ENGA 2ZJRS 4FG2A 2CW0D 1ZJWA 1R27A 2C45A 3ML1A 2JA6A 1O0BA 5HL7S 1HD5A 2ZJQS 4AONB 1FDIA 1O0CA 1QTQA 3X2HA 1QRSA 5GAGW 2E2HA 1PQEA 2BE5D 5C1BA 3SUJA 1R9TA 4JYZA 4WFNS 4D7ZB 1TWHA 5GADW 3DLLS 2NAPA 1Y5IA 4FERA 1VHYA 1Z85A 3GTOA 1Y4ZA 3X2PA 4IO9S 5DM6S 1WCMA 3PIOS 2B63A 1AW8B 2JIOA 4AAYA 1NYLA 2DMRA 1G8JA 2V3VA 3TM7B 3GTKA 2G6GA 3D30A 5GAHW 4CRYG 3HU1A 5H4UA 1VHKA 1E18A 4AVRA 4U67S 4QIWA 1H5NA 3HU3A 3W2WB 1N10A 4E8BA 1GTRA 4KDLA 1E5VA 4JP7A 2EGVA 5BNZA 1QRTA 2RE8A 1WC2A 1D6KA 2VPWA 3DMRA 3IR5A 3QQ8A 4JCWA 4RV0A 3QQ7A 1I50A 2NVXA 5C18A 2A68D 1TMOA 2GAEA 5T5MD 4V194 1L8FA 3GTJA 1B75A 1R7RA 2CX8A 2O5JD 2G5DA 1TWGA 2VPYA 3CF5S 2R92A 2PJJA 3QWZA 1TWCA 1EUYA 4IOCS 4GA5A 4AYBA 2EEOB 4FG4A 1SFOA 3X2LA 5T5ID 2A69D 5FTJA 1H0HA 2WAQA 1UHDA 4KLNA 2PICA 1K83A 1FEUA 3AIIA 2AE0X 4DMRA
chains in the Genus database with same CATH topology
1PT0A 1IW7D 1TWAA 1TWFA 1AA6A 4FFTA 3HKZA 1PQHA 5DYIA 2PNWA 1FDOA 3CZBA 1ZYRD 2E7ZA 2V45A 3OUGA 2VUMA 2JA7A 5FTNA 5FTLA 3CQZA 2YUJA 4AOKB 1E60A 4CRZA 3GTMA 3TIWA 2JIPA 1CR5A 3QC8A 4JP6A 5FTKA 5FTMA 3GTQA 3SULA 3GTPA 4L48A 3H0GA 2ENGA 1WLFA 5GLFA 2IV2X 3FKIA 3X2MA 1VC3B 2VPZA 2A6HD 5GLXA 1ZC1A 1G8KA 2BH0A 1E61A 1OA7A 1QCSA 2R7ZA 3X2GA 1S3SA 2JIRA 1BW4A 5B6CA 1Y1WA 4JS7A 1DMRA 4KODA 2WB1A 4AZDA 1PT1A 1UHEA 2JIMA 3GTGA 2PI8A 4GA6A 1OGYA 1DMSA 1PYUB 4JJOA 5DYGA 1OA9A 1SMYD 2KI8A 3X2KA 3CF2A 1I3QA 3GTLA 3HU2A 4CS0A 3X2IA 2NVYA 1E32A 2JIQA 2HCZX 1PYQA 2R93A 1BW3A 1PQFA 2E2IA 4ZM7A 1SIWA 1CZ4A 4KDIA 4NOHA 1YLEA 2A6ED 2PJHB 3PLXB 3X2JA 1KQFA 1KQGA 5EPPA 1PPYA 1YNND 2NYAA 5GM9A 2PMZA 1Q16A 1CZ5A 3SUKA 3O5AA 4C2MA 3X2OA 3IR6A 2KQAA 2JA5A 3X2NA 1EU1A 3M3GA 4KO8A 3SUMA 2Y0SA 5GLYA 3IR7A 1QDNA 1Y1VA 1YNJD 4ENGA 2VPXA 2YU9A 3ENGA 4FG2A 2CW0D 1R27A 2C45A 3ML1A 2JA6A 1HD5A 4AONB 1FDIA 3X2HA 2E2HA 1PQEA 2BE5D 5C1BA 3SUJA 1R9TA 4D7ZB 1TWHA 2NAPA 1Y5IA 4FERA 3GTOA 1Y4ZA 3X2PA 1WCMA 2B63A 1AW8B 2JIOA 4AAYA 2DMRA 1G8JA 2V3VA 3TM7B 3GTKA 2G6GA 3D30A 4CRYG 3HU1A 5H4UA 1E18A 4AVRA 4QIWA 1H5NA 3HU3A 1N10A 4KDLA 4JP7A 1E5VA 1WC2A 2VPWA 4JCWA 3DMRA 3IR5A 3QQ8A 4RV0A 3QQ7A 1I50A 2NVXA 5C18A 2A68D 2GAEA 1TMOA 5T5MD 1L8FA 3GTJA 1R7RA 2O5JD 2G5DA 1TWGA 2VPYA 2R92A 2PJJA 3QWZA 1TWCA 4GA5A 4AYBA 2EEOB 4FG4A 1SFOA 3X2LA 5T5ID 2A69D 5FTJA 1H0HA 2WAQA 1UHDA 4KLNA 2PICA 1K83A 2AE0X 4DMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BW4 A;  3SUK A;  4JS7 A;  3D30 A;  3X2O A;  2KQA A;  3X2N A;  5H4U A;  3M3G A;  4FFT A;  2PI8 A;  4AVR A;  3SUM A;  1N10 A;  2PNW A;  5GLY A;  3CZB A;  4JJO A;  4JP7 A;  1OA9 A;  4ENG A;  3X2K A;  3ENG A;  4FG2 A;  1WC2 A;  3X2I A;  4JCW A;  1HD5 A;  2HCZ X;  3X2H A;  2GAE A;  1BW3 A;  1L8F A;  4JP6 A;  4ZM7 A;  3SUJ A;  3SUL A;  4FER A;  4L48 A;  2ENG A;  2G5D A;  3X2J A;  2PJJ A;  3X2M A;  3X2P A;  4FG4 A;  5GLX A;  5GM9 A;  3X2L A;  2BH0 A;  2PIC A;  1OA7 A;  2G6G A;  3X2G A;  2AE0 X; 
#chains in the Genus database with same CATH topology
 1PT0 A;  1IW7 D;  4JXX A;  1TWA A;  1EUQ A;  1TWF A;  1AA6 A;  3HKZ A;  4FFT A;  1PQH A;  5GAE W;  5DYI A;  1FDO A;  1ZYR D;  2E7Z A;  2PNW A;  2V45 A;  3CZB A;  3OUG A;  2VUM A;  2JA7 A;  5FTN A;  1QRU A;  3X1L B;  5FTL A;  3CQZ A;  2YUJ A;  4AOK B;  1NXZ A;  4H3S A;  4L69 A;  5DM7 S;  1E60 A;  3W2V B;  4WFA S;  2Z0Y A;  2ZJP S;  4CRZ A;  3GTM A;  3TIW A;  2JIP A;  1CR5 A;  3QC8 A;  4JP6 A;  5FTK A;  5FTM A;  3GTQ A;  3SUL A;  3GTP A;  3H0G A;  4L48 A;  1WLF A;  2ENG A;  5GLF A;  2IV2 X;  1V6Z A;  3FKI A;  3X2M A;  3KW2 A;  1VC3 B;  2VPZ A;  2A6H D;  5GLX A;  1ZC1 A;  1G8K A;  1E61 A;  1QCS A;  1OA7 A;  2BH0 A;  2HZ7 A;  2R7Z A;  3X2G A;  1EXD A;  1S3S A;  4WFB S;  2JIR A;  1BW4 A;  3J7Z V;  3PIP S;  5B6C A;  1Y1W A;  4JS7 A;  1DMR A;  4KOD A;  2WB1 A;  4AZD A;  1PT1 A;  1UHE A;  2JIM A;  3GTG A;  2PI8 A;  2RD2 A;  4GA6 A;  1OGY A;  1DMS A;  1PYU B;  4JJO A;  5DYG A;  1OA9 A;  1SMY D;  2KI8 A;  3CF2 A;  3X2K A;  1I3Q A;  3GTL A;  4P2B A;  3HU2 A;  4CS0 A;  3X2I A;  2NVY A;  1E32 A;  2JIQ A;  4H4K A;  2HCZ X;  1PYQ A;  4WF9 S;  4WCE S;  4UY8 8;  2R93 A;  1BW3 A;  1GTS A;  1PQF A;  2E2I A;  4ZM7 A;  1SIW A;  4J3C A;  1CZ4 A;  4KDI A;  4NOH A;  1YLE A;  5JVG S;  2A6E D;  2PJH B;  3PLX B;  3X2J A;  4JXZ A;  1KQF A;  1DFU P;  2EGW A;  1KQG A;  5EPP A;  2NWA A;  1UDX A;  1PPY A;  1YNN D;  4IOA S;  2NYA A;  5GM9 A;  2PMZ A;  1Q16 A;  1CZ5 A;  3SUK A;  3O5A A;  4C2M A;  3X2O A;  3IR6 A;  2KQA A;  2JA5 A;  3X2N A;  1EU1 A;  3M3G A;  5IZN A;  4KO8 A;  3SUM A;  2Y0S A;  3IR7 A;  5GLY A;  1QDN A;  1Y1V A;  1YNJ D;  2VPX A;  4ENG A;  2YU9 A;  5JVH S;  3ENG A;  2ZJR S;  4FG2 A;  2CW0 D;  1ZJW A;  1R27 A;  2C45 A;  3ML1 A;  2JA6 A;  1O0B A;  5HL7 S;  1HD5 A;  2ZJQ S;  4AON B;  1FDI A;  1O0C A;  1QTQ A;  3X2H A;  1QRS A;  5GAG W;  2E2H A;  1PQE A;  2BE5 D;  5C1B A;  3SUJ A;  1R9T A;  4JYZ A;  4WFN S;  4D7Z B;  1TWH A;  5GAD W;  3DLL S;  2NAP A;  1Y5I A;  4FER A;  1VHY A;  1Z85 A;  3GTO A;  1Y4Z A;  3X2P A;  4IO9 S;  5DM6 S;  1WCM A;  3PIO S;  2B63 A;  1AW8 B;  2JIO A;  4AAY A;  1NYL A;  2DMR A;  1G8J A;  2V3V A;  3TM7 B;  3GTK A;  2G6G A;  3D30 A;  5GAH W;  4CRY G;  3HU1 A;  5H4U A;  1VHK A;  1E18 A;  4AVR A;  4U67 S;  4QIW A;  1H5N A;  3HU3 A;  3W2W B;  1N10 A;  4E8B A;  1GTR A;  4KDL A;  1E5V A;  4JP7 A;  2EGV A;  5BNZ A;  1QRT A;  2RE8 A;  1WC2 A;  1D6K A;  2VPW A;  3DMR A;  3IR5 A;  3QQ8 A;  4JCW A;  4RV0 A;  3QQ7 A;  1I50 A;  2NVX A;  5C18 A;  2A68 D;  1TMO A;  2GAE A;  5T5M D;  4V19 4;  1L8F A;  3GTJ A;  1B75 A;  1R7R A;  2CX8 A;  2O5J D;  2G5D A;  1TWG A;  2VPY A;  3CF5 S;  2R92 A;  2PJJ A;  3QWZ A;  1TWC A;  1EUY A;  4IOC S;  4GA5 A;  4AYB A;  2EEO B;  4FG4 A;  1SFO A;  3X2L A;  5T5I D;  2A69 D;  5FTJ A;  1H0H A;  2WAQ A;  1UHD A;  4KLN A;  2PIC A;  1K83 A;  1FEU A;  3AII A;  2AE0 X;  4DMR A; 
#chains in the Genus database with same CATH homology
 1PT0 A;  1IW7 D;  1TWA A;  1TWF A;  1AA6 A;  4FFT A;  3HKZ A;  1PQH A;  5DYI A;  2PNW A;  1FDO A;  3CZB A;  1ZYR D;  2E7Z A;  2V45 A;  3OUG A;  2VUM A;  2JA7 A;  5FTN A;  5FTL A;  3CQZ A;  2YUJ A;  4AOK B;  1E60 A;  4CRZ A;  3GTM A;  3TIW A;  2JIP A;  1CR5 A;  3QC8 A;  4JP6 A;  5FTK A;  5FTM A;  3GTQ A;  3SUL A;  3GTP A;  4L48 A;  3H0G A;  2ENG A;  1WLF A;  5GLF A;  2IV2 X;  3FKI A;  3X2M A;  1VC3 B;  2VPZ A;  2A6H D;  5GLX A;  1ZC1 A;  1G8K A;  2BH0 A;  1E61 A;  1OA7 A;  1QCS A;  2R7Z A;  3X2G A;  1S3S A;  2JIR A;  1BW4 A;  5B6C A;  1Y1W A;  4JS7 A;  1DMR A;  4KOD A;  2WB1 A;  4AZD A;  1PT1 A;  1UHE A;  2JIM A;  3GTG A;  2PI8 A;  4GA6 A;  1OGY A;  1DMS A;  1PYU B;  4JJO A;  5DYG A;  1OA9 A;  1SMY D;  2KI8 A;  3X2K A;  3CF2 A;  1I3Q A;  3GTL A;  3HU2 A;  4CS0 A;  3X2I A;  2NVY A;  1E32 A;  2JIQ A;  2HCZ X;  1PYQ A;  2R93 A;  1BW3 A;  1PQF A;  2E2I A;  4ZM7 A;  1SIW A;  1CZ4 A;  4KDI A;  4NOH A;  1YLE A;  2A6E D;  2PJH B;  3PLX B;  3X2J A;  1KQF A;  1KQG A;  5EPP A;  1PPY A;  1YNN D;  2NYA A;  5GM9 A;  2PMZ A;  1Q16 A;  1CZ5 A;  3SUK A;  3O5A A;  4C2M A;  3X2O A;  3IR6 A;  2KQA A;  2JA5 A;  3X2N A;  1EU1 A;  3M3G A;  4KO8 A;  3SUM A;  2Y0S A;  5GLY A;  3IR7 A;  1QDN A;  1Y1V A;  1YNJ D;  4ENG A;  2VPX A;  2YU9 A;  3ENG A;  4FG2 A;  2CW0 D;  1R27 A;  2C45 A;  3ML1 A;  2JA6 A;  1HD5 A;  4AON B;  1FDI A;  3X2H A;  2E2H A;  1PQE A;  2BE5 D;  5C1B A;  3SUJ A;  1R9T A;  4D7Z B;  1TWH A;  2NAP A;  1Y5I A;  4FER A;  3GTO A;  1Y4Z A;  3X2P A;  1WCM A;  2B63 A;  1AW8 B;  2JIO A;  4AAY A;  2DMR A;  1G8J A;  2V3V A;  3TM7 B;  3GTK A;  2G6G A;  3D30 A;  4CRY G;  3HU1 A;  5H4U A;  1E18 A;  4AVR A;  4QIW A;  1H5N A;  3HU3 A;  1N10 A;  4KDL A;  4JP7 A;  1E5V A;  1WC2 A;  2VPW A;  4JCW A;  3DMR A;  3IR5 A;  3QQ8 A;  4RV0 A;  3QQ7 A;  1I50 A;  2NVX A;  5C18 A;  2A68 D;  2GAE A;  1TMO A;  5T5M D;  1L8F A;  3GTJ A;  1R7R A;  2O5J D;  2G5D A;  1TWG A;  2VPY A;  2R92 A;  2PJJ A;  3QWZ A;  1TWC A;  4GA5 A;  4AYB A;  2EEO B;  4FG4 A;  1SFO A;  3X2L A;  5T5I D;  2A69 D;  5FTJ A;  1H0H A;  2WAQ A;  1UHD A;  4KLN A;  2PIC A;  1K83 A;  2AE0 X;  4DMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...