3DLLS

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords rRNA-23S ribosomal RNA
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3dllS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 3dllS02
5HL7S 1FEUA 1B75A 1GTRA 4WCES 4IO9S 4WF9S 4H3SA 4P2BA 1QTQA 1O0BA 5IZNA 4IOCS 1QRUA 3AIIA 2ZJQS 4UY88 1DFUP 5BNZA 4WFNS 2ZJRS 5JVHS 1QRSA 5DM6S 4IOAS 4WFAS 5GAGW 3CF5S 4U67S 3J7ZV 2RD2A 2RE8A 1GTSA 1O0CA 1EUQA 4JYZA 5GAHW 2HZ7A 1EUYA 5GADW 5GAEW 4WFBS 1NYLA 2ZJPS 3PIOS 3PIPS 4JXZA 4JXXA 1EXDA 1QRTA 1ZJWA 5DM7S 1D6KA 3DLLS 5JVGS
chains in the Genus database with same CATH superfamily
4C3IC 4GZYA 2R93C 4A3BC 3GTKC 4BBSC 2PMZD 5TMFA 5TMCA 4A3IC 4H3SA 4OIOA 3EQLA 4P2BA 3PO2C 5D4DA 1O0BA 2NVTC 5IZNA 1QRUA 3CZBA 2A6EA 4UY88 1DFUP 2Z0YA 2PPBA 3HOZC 3M3YC 5BNZA 4IOAS 1SMYA 1QRSA 1I6HC 5DM6S 4X6AC 4WFAS 1Y1VC 2PNWA 3CF5S 2RD2A 1K83C 4ZH4A 1V6ZA 2RE8A 5IYDC 1YNNA 5C4JC 5GAHW 4A3GC 4BXXC 1UDXA 2KXYA 3S1RC 4YG2A 2CX8A 4J3CA 4Q4ZA 4A3JC 4G7OA 3LYWA 1I6VA 4Y7NC 3GTPC 1VHYA 3PIPS 4JXZA 3RZOC 3I4NC 1EXDA 4H4KA 5DM7S 4KN7A 4LJZA 3HOWC 4A3FC 4QJVA 5C4XC 1B75A 1GTRA 3GTMC 4IO9S 4JK1A 2A68A 2R92C 2A69A 2NVQC 3M4OC 2G5DA 3AIIA 3K7AC 1YNJA 4AYBD 4A3KC 1TWCC 5C44C 4XSZA 3HOYC 5GAGW 4V194 4BY7C 1Y1WC 3J7ZV 4XLPA 4LK0A 5IP9C 2AE0X 1EUQA 2L5NA 2PA8D 1EUYA 2WAQD 2HZ7A 2Y0SD 3WODA 4XSXA 4YFXA 4XLNA 2E2IC 5GAEW 2KQ1A 4WFBS 1TWHC 4NOIA 1R9TC 2O5IA 4A3LC 2JA5C 3GTJC 3S16C 4LK1A 1I3QC 3S17C 4BBRC 3H0GC 3S1QC 4A3DC 1D6KA 3DLLS 2JA7C 3S2HC 1IW7A 2EGWA 4WCES 2CW0A 4OIQA 1Z85A 2G6GA 3X1LB 2NVYC 4OIRA 3GTOC 3S14C 3HOUC 2PICA 3S1MC 2R7ZC 5IP7C 5HQHA 4LLGA 3HOVC 5IYBC 2GAEA 2PJJA 2ZJQS 2JA8C 4WFNS 2ZJRS 5JVHS 4L69A 3HOXC 4U67S 2WB1D 1GTSA 1O0CA 4C3HC 2YU9C 4JYZA 3GTLC 3RZDC 3I4MC 2BE5A 4A3EC 5GADW 2E2HC 3KW2A 1TWAC 3GTQC 1NYLA 4MEYA 2NWAA 2ZJPS 4C3JC 2EGVA 2PI8A 4OINA 4Y52C 4A93C 1QRTA 1ZJWA 3GTGC 3S2DC 5JVGS 5HL7S 1TWGC 1BDFA 4KN4A 4WF9S 4YFKA 4C2MC 2VUMC 1HQMA 1QTQA 2O5JA 3FKIC 4Q5SA 4IOCS 3H3VD 1ZYRA 2A6HA 2L3UA 2B63C 4MQ9A 5IYCC 2JA6C 4MEXA 4A3MC 1TWFC 1SFOC 5C3EC 4KMUA 4OIPA 3W2WB 4G7ZA 2E2JC 2KPUA 1WCMC 4BY1C 3CQZC 4A3CC 4QIWD 2NVXC 4G7HA 4YFNA 1I50C 3PIOS 4E8BA 5FLMC 3PO3C 1NXZA 4JXXA 3S1NC 3HKZD 1VHKA 3W2VB 1FEUA 3S15C 3DXJA
chains in the Genus database with same CATH topology
5HL7S 1FEUA 1B75A 1GTRA 4WCES 4IO9S 3X1LB 4WF9S 4H3SA 4P2BA 1QTQA 1O0BA 1D6KA 5IZNA 4IOCS 1QRUA 3AIIA 2ZJQS 4UY88 1DFUP 5BNZA 4WFNS 2ZJRS 5JVHS 1QRSA 5DM6S 4IOAS 4WFAS 5GAGW 4V194 3CF5S 4U67S 3J7ZV 2RD2A 2RE8A 1GTSA 3W2WB 1O0CA 1EUQA 4JYZA 5GAHW 2HZ7A 1EUYA 1UDXA 5GADW 5GAEW 4WFBS 1NYLA 2ZJPS 3PIOS 3PIPS 4JXZA 4JXXA 1EXDA 4H4KA 1ZJWA 1QRTA 5DM7S 3W2VB 3DLLS 5JVGS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL7 S;  1FEU A;  1B75 A;  1GTR A;  4WCE S;  4IO9 S;  4WF9 S;  4H3S A;  4P2B A;  1QTQ A;  1O0B A;  5IZN A;  4IOC S;  1QRU A;  3AII A;  2ZJQ S;  4UY8 8;  1DFU P;  5BNZ A;  4WFN S;  2ZJR S;  5JVH S;  1QRS A;  5DM6 S;  4IOA S;  4WFA S;  5GAG W;  3CF5 S;  4U67 S;  3J7Z V;  2RD2 A;  2RE8 A;  1GTS A;  1O0C A;  1EUQ A;  4JYZ A;  5GAH W;  2HZ7 A;  1EUY A;  5GAD W;  5GAE W;  4WFB S;  1NYL A;  2ZJP S;  3PIO S;  3PIP S;  4JXZ A;  4JXX A;  1EXD A;  1QRT A;  1ZJW A;  5DM7 S;  1D6K A;  3DLL S;  5JVG S; 
#chains in the Genus database with same CATH topology
 4C3I C;  4GZY A;  2R93 C;  4A3B C;  3GTK C;  4BBS C;  2PMZ D;  5TMF A;  5TMC A;  4A3I C;  4H3S A;  4OIO A;  3EQL A;  4P2B A;  3PO2 C;  5D4D A;  1O0B A;  2NVT C;  5IZN A;  1QRU A;  3CZB A;  2A6E A;  4UY8 8;  1DFU P;  2Z0Y A;  2PPB A;  3HOZ C;  3M3Y C;  5BNZ A;  4IOA S;  1SMY A;  1QRS A;  1I6H C;  5DM6 S;  4X6A C;  4WFA S;  1Y1V C;  2PNW A;  3CF5 S;  2RD2 A;  1K83 C;  4ZH4 A;  1V6Z A;  2RE8 A;  5IYD C;  1YNN A;  5C4J C;  5GAH W;  4A3G C;  4BXX C;  1UDX A;  2KXY A;  3S1R C;  4YG2 A;  2CX8 A;  4J3C A;  4Q4Z A;  4A3J C;  4G7O A;  3LYW A;  1I6V A;  4Y7N C;  3GTP C;  1VHY A;  3PIP S;  4JXZ A;  3RZO C;  3I4N C;  1EXD A;  4H4K A;  5DM7 S;  4KN7 A;  4LJZ A;  3HOW C;  4A3F C;  4QJV A;  5C4X C;  1B75 A;  1GTR A;  3GTM C;  4IO9 S;  4JK1 A;  2A68 A;  2R92 C;  2A69 A;  2NVQ C;  3M4O C;  2G5D A;  3AII A;  3K7A C;  1YNJ A;  4AYB D;  4A3K C;  1TWC C;  5C44 C;  4XSZ A;  3HOY C;  5GAG W;  4V19 4;  4BY7 C;  1Y1W C;  3J7Z V;  4XLP A;  4LK0 A;  5IP9 C;  2AE0 X;  1EUQ A;  2L5N A;  2PA8 D;  1EUY A;  2WAQ D;  2HZ7 A;  2Y0S D;  3WOD A;  4XSX A;  4YFX A;  4XLN A;  2E2I C;  5GAE W;  2KQ1 A;  4WFB S;  1TWH C;  4NOI A;  1R9T C;  2O5I A;  4A3L C;  2JA5 C;  3GTJ C;  3S16 C;  4LK1 A;  1I3Q C;  3S17 C;  4BBR C;  3H0G C;  3S1Q C;  4A3D C;  1D6K A;  3DLL S;  2JA7 C;  3S2H C;  1IW7 A;  2EGW A;  4WCE S;  2CW0 A;  4OIQ A;  1Z85 A;  2G6G A;  3X1L B;  2NVY C;  4OIR A;  3GTO C;  3S14 C;  3HOU C;  2PIC A;  3S1M C;  2R7Z C;  5IP7 C;  5HQH A;  4LLG A;  3HOV C;  5IYB C;  2GAE A;  2PJJ A;  2ZJQ S;  2JA8 C;  4WFN S;  2ZJR S;  5JVH S;  4L69 A;  3HOX C;  4U67 S;  2WB1 D;  1GTS A;  1O0C A;  4C3H C;  2YU9 C;  4JYZ A;  3GTL C;  3RZD C;  3I4M C;  2BE5 A;  4A3E C;  5GAD W;  2E2H C;  3KW2 A;  1TWA C;  3GTQ C;  1NYL A;  4MEY A;  2NWA A;  2ZJP S;  4C3J C;  2EGV A;  2PI8 A;  4OIN A;  4Y52 C;  4A93 C;  1QRT A;  1ZJW A;  3GTG C;  3S2D C;  5JVG S;  5HL7 S;  1TWG C;  1BDF A;  4KN4 A;  4WF9 S;  4YFK A;  4C2M C;  2VUM C;  1HQM A;  1QTQ A;  2O5J A;  3FKI C;  4Q5S A;  4IOC S;  3H3V D;  1ZYR A;  2A6H A;  2L3U A;  2B63 C;  4MQ9 A;  5IYC C;  2JA6 C;  4MEX A;  4A3M C;  1TWF C;  1SFO C;  5C3E C;  4KMU A;  4OIP A;  3W2W B;  4G7Z A;  2E2J C;  2KPU A;  1WCM C;  4BY1 C;  3CQZ C;  4A3C C;  4QIW D;  2NVX C;  4G7H A;  4YFN A;  1I50 C;  3PIO S;  4E8B A;  5FLM C;  3PO3 C;  1NXZ A;  4JXX A;  3S1N C;  3HKZ D;  1VHK A;  3W2V B;  1FEU A;  3S15 C;  3DXJ A; 
#chains in the Genus database with same CATH homology
 5HL7 S;  1FEU A;  1B75 A;  1GTR A;  4WCE S;  4IO9 S;  3X1L B;  4WF9 S;  4H3S A;  4P2B A;  1QTQ A;  1O0B A;  1D6K A;  5IZN A;  4IOC S;  1QRU A;  3AII A;  2ZJQ S;  4UY8 8;  1DFU P;  5BNZ A;  4WFN S;  2ZJR S;  5JVH S;  1QRS A;  5DM6 S;  4IOA S;  4WFA S;  5GAG W;  4V19 4;  3CF5 S;  4U67 S;  3J7Z V;  2RD2 A;  2RE8 A;  1GTS A;  3W2W B;  1O0C A;  1EUQ A;  4JYZ A;  5GAH W;  2HZ7 A;  1EUY A;  1UDX A;  5GAD W;  5GAE W;  4WFB S;  1NYL A;  2ZJP S;  3PIO S;  3PIP S;  4JXZ A;  4JXX A;  1EXD A;  4H4K A;  1ZJW A;  1QRT A;  5DM7 S;  3W2V B;  3DLL S;  5JVG S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...