4V194

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
total genus 4
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.120 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4v19400
4V194
chains in the Genus database with same CATH superfamily
2EGWA 2G5DA 4IO9S 4P2BA 5GAGW 1NYLA 1VHKA 3PIOS 4WFNS 5GAHW 1VHYA 3W2WB 4L69A 1EUYA 2NWAA 3AIIA 2EGVA 2PNWA 3CZBA 5GAEW 4JYZA 4JXXA 1EUQA 4J3CA 5BNZA 3X1LB 4IOAS 3KW2A 4JXZA 4H3SA 4U67S 3DLLS 4IOCS 1QRSA 4WF9S 2Z0YA 1D6KA 2RD2A 3J7ZV 1QRUA 2AE0X 2RE8A 1EXDA 2PI8A 5DM7S 3PIPS 2PJJA 4WCES 2G6GA 4E8BA 5IZNA 1QRTA 1B75A 5JVHS 5DM6S 5HL7S 4WFBS 1GTRA 2GAEA 3CF5S 1UDXA 2HZ7A 1GTSA 2ZJPS 1QTQA 2ZJQS 2ZJRS 4WFAS 1O0BA 1NXZA 4UY88 4H4KA 1DFUP 1FEUA 2PICA 1ZJWA 5JVGS 1O0CA 4V194 3W2VB 2CX8A 1Z85A 1V6ZA 5GADW
chains in the Genus database with same CATH topology
4IO9S 4P2BA 5GAGW 1NYLA 3PIOS 4WFNS 5GAHW 3W2WB 1EUYA 3AIIA 4JXXA 4JYZA 1EUQA 5GAEW 3X1LB 5BNZA 4IOAS 4JXZA 4H3SA 4U67S 3DLLS 4IOCS 1QRSA 4WF9S 1D6KA 2RD2A 3J7ZV 1QRUA 2RE8A 1QRTA 5DM7S 3PIPS 4WCES 1B75A 5IZNA 5JVHS 5DM6S 5HL7S 4WFBS 1GTRA 3CF5S 2HZ7A 1UDXA 1GTSA 2ZJPS 1QTQA 2ZJQS 2ZJRS 4WFAS 1O0BA 4UY88 4H4KA 1DFUP 1FEUA 1ZJWA 5JVGS 1O0CA 4V194 3W2VB 1EXDA 5GADW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 4; 
#chains in the Genus database with same CATH topology
 2EGW A;  2G5D A;  4IO9 S;  4P2B A;  5GAG W;  1NYL A;  1VHK A;  3PIO S;  4WFN S;  5GAH W;  1VHY A;  3W2W B;  4L69 A;  1EUY A;  2NWA A;  3AII A;  2EGV A;  2PNW A;  3CZB A;  5GAE W;  4JYZ A;  4JXX A;  1EUQ A;  4J3C A;  5BNZ A;  3X1L B;  4IOA S;  3KW2 A;  4JXZ A;  4H3S A;  4U67 S;  3DLL S;  4IOC S;  1QRS A;  4WF9 S;  2Z0Y A;  1D6K A;  2RD2 A;  3J7Z V;  1QRU A;  2AE0 X;  2RE8 A;  1EXD A;  2PI8 A;  5DM7 S;  3PIP S;  2PJJ A;  4WCE S;  2G6G A;  4E8B A;  5IZN A;  1QRT A;  1B75 A;  5JVH S;  5DM6 S;  5HL7 S;  4WFB S;  1GTR A;  2GAE A;  3CF5 S;  1UDX A;  2HZ7 A;  1GTS A;  2ZJP S;  1QTQ A;  2ZJQ S;  2ZJR S;  4WFA S;  1O0B A;  1NXZ A;  4UY8 8;  4H4K A;  1DFU P;  1FEU A;  2PIC A;  1ZJW A;  5JVG S;  1O0C A;  4V19 4;  3W2V B;  2CX8 A;  1Z85 A;  1V6Z A;  5GAD W; 
#chains in the Genus database with same CATH homology
 4IO9 S;  4P2B A;  5GAG W;  1NYL A;  3PIO S;  4WFN S;  5GAH W;  3W2W B;  1EUY A;  3AII A;  4JXX A;  4JYZ A;  1EUQ A;  5GAE W;  3X1L B;  5BNZ A;  4IOA S;  4JXZ A;  4H3S A;  4U67 S;  3DLL S;  4IOC S;  1QRS A;  4WF9 S;  1D6K A;  2RD2 A;  3J7Z V;  1QRU A;  2RE8 A;  1QRT A;  5DM7 S;  3PIP S;  4WCE S;  1B75 A;  5IZN A;  5JVH S;  5DM6 S;  5HL7 S;  4WFB S;  1GTR A;  3CF5 S;  2HZ7 A;  1UDX A;  1GTS A;  2ZJP S;  1QTQ A;  2ZJQ S;  2ZJR S;  4WFA S;  1O0B A;  4UY8 8;  4H4K A;  1DFU P;  1FEU A;  1ZJW A;  5JVG S;  1O0C A;  4V19 4;  3W2V B;  1EXD A;  5GAD W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...