4V194

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
b'DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 4
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.120 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4v19400
4V194
chains in the Genus database with same CATH superfamily
1O0BA 3CZBA 2NWAA 3J7ZV 1NXZA 2RE8A 1QRUA 4IOCS 1GTRA 1UDXA 1QTQA 4P2BA 1DFUP 2GAEA 4WFNS 2Z0YA 2G6GA 4WFAS 4H3SA 2G5DA 4IO9S 1QRTA 3CF5S 2PI8A 3W2WB 3X1LB 4E8BA 2EGVA 5JVHS 1QRSA 4V194 2CX8A 4H4KA 3W2VB 5JVGS 1GTSA 1V6ZA 1B75A 4IOAS 1EUQA 4U67S 5DM7S 4WFBS 2HZ7A 1VHKA 2AE0X 4J3CA 2ZJQS 2RD2A 1O0CA 4WCES 4L69A 5HL7S 3PIPS 1EXDA 1VHYA 1EUYA 2ZJRS 2ZJPS 2PNWA 5GAHW 3AIIA 5BNZA 1Z85A 5DM6S 2PICA 1ZJWA 2PJJA 5GAGW 5GAEW 4WF9S 4UY88 5GADW 4JXZA 3KW2A 1FEUA 3PIOS 3DLLS 4JYZA 5IZNA 1D6KA 4JXXA 1NYLA 2EGWA
chains in the Genus database with same CATH topology
5DM7S 3CF5S 4WFBS 2HZ7A 1ZJWA 1O0BA 3W2WB 3J7ZV 3X1LB 5GAGW 5GAEW 4WF9S 2RE8A 4UY88 5GADW 2ZJQS 2RD2A 1O0CA 4WCES 1QRUA 5JVHS 4IOCS 4JXZA 5HL7S 3PIPS 1QRSA 4V194 4H4KA 1EUQA 1GTRA 1EXDA 1UDXA 1QTQA 4P2BA 1FEUA 1DFUP 1EUYA 3W2VB 2ZJRS 5JVGS 2ZJPS 3PIOS 1GTSA 4WFNS 4WFAS 5GAHW 4H3SA 3DLLS 4IO9S 3AIIA 1QRTA 4JYZA 5IZNA 4JXXA 1D6KA 4IOAS 5BNZA 1NYLA 1B75A 5DM6S 4U67S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 4; 
#chains in the Genus database with same CATH topology
 1O0B A;  3CZB A;  2NWA A;  3J7Z V;  1NXZ A;  2RE8 A;  1QRU A;  4IOC S;  1GTR A;  1UDX A;  1QTQ A;  4P2B A;  1DFU P;  2GAE A;  4WFN S;  2Z0Y A;  2G6G A;  4WFA S;  4H3S A;  2G5D A;  4IO9 S;  1QRT A;  3CF5 S;  2PI8 A;  3W2W B;  3X1L B;  4E8B A;  2EGV A;  5JVH S;  1QRS A;  4V19 4;  2CX8 A;  4H4K A;  3W2V B;  5JVG S;  1GTS A;  1V6Z A;  1B75 A;  4IOA S;  1EUQ A;  4U67 S;  5DM7 S;  4WFB S;  2HZ7 A;  1VHK A;  2AE0 X;  4J3C A;  2ZJQ S;  2RD2 A;  1O0C A;  4WCE S;  4L69 A;  5HL7 S;  3PIP S;  1EXD A;  1VHY A;  1EUY A;  2ZJR S;  2ZJP S;  2PNW A;  5GAH W;  3AII A;  5BNZ A;  1Z85 A;  5DM6 S;  2PIC A;  1ZJW A;  2PJJ A;  5GAG W;  5GAE W;  4WF9 S;  4UY8 8;  5GAD W;  4JXZ A;  3KW2 A;  1FEU A;  3PIO S;  3DLL S;  4JYZ A;  5IZN A;  1D6K A;  4JXX A;  1NYL A;  2EGW A; 
#chains in the Genus database with same CATH homology
 5DM7 S;  3CF5 S;  4WFB S;  2HZ7 A;  1ZJW A;  1O0B A;  3W2W B;  3J7Z V;  3X1L B;  5GAG W;  5GAE W;  4WF9 S;  2RE8 A;  4UY8 8;  5GAD W;  2ZJQ S;  2RD2 A;  1O0C A;  4WCE S;  1QRU A;  5JVH S;  4IOC S;  4JXZ A;  5HL7 S;  3PIP S;  1QRS A;  4V19 4;  4H4K A;  1EUQ A;  1GTR A;  1EXD A;  1UDX A;  1QTQ A;  4P2B A;  1FEU A;  1DFU P;  1EUY A;  3W2V B;  2ZJR S;  5JVG S;  2ZJP S;  3PIO S;  1GTS A;  4WFN S;  4WFA S;  5GAH W;  4H3S A;  3DLL S;  4IO9 S;  3AII A;  1QRT A;  4JYZ A;  5IZN A;  4JXX A;  1D6K A;  4IOA S;  5BNZ A;  1NYL A;  1B75 A;  5DM6 S;  4U67 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...