4V194

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
total genus 4
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.120 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4v19400
4V194
chains in the Genus database with same CATH superfamily
4IO9S 1GTSA 2HZ7A 2RD2A 1EUQA 4V194 1VHYA 4IOAS 5BNZA 3DLLS 2PICA 1QRSA 1GTRA 3CF5S 4WFNS 1VHKA 4H3SA 4H4KA 1DFUP 4WFAS 1D6KA 2EGVA 1O0BA 1O0CA 5IZNA 2NWAA 3KW2A 4UY88 2G6GA 4WCES 1EUYA 2PJJA 5GAGW 2ZJPS 1UDXA 5GAEW 3PIOS 4WF9S 4JYZA 1NXZA 4JXZA 1EXDA 2AE0X 5GAHW 5JVHS 2CX8A 4U67S 2PI8A 2GAEA 3AIIA 2RE8A 2ZJRS 2ZJQS 2PNWA 3J7ZV 1QRUA 4E8BA 2Z0YA 4WFBS 3CZBA 4P2BA 1ZJWA 3X1LB 4IOCS 3W2WB 4J3CA 4L69A 5JVGS 5DM6S 5HL7S 1QTQA 1NYLA 1QRTA 5GADW 1FEUA 3W2VB 1V6ZA 5DM7S 3PIPS 4JXXA 1Z85A 1B75A 2EGWA 2G5DA
chains in the Genus database with same CATH topology
4IO9S 1EXDA 5JVGS 4UY88 1GTSA 2HZ7A 4WCES 2RD2A 5DM6S 1EUQA 5GAHW 5HL7S 5JVHS 1EUYA 4V194 4U67S 1QTQA 5GAGW 4IOAS 1NYLA 5BNZA 3AIIA 3DLLS 2ZJPS 5GADW 2RE8A 1QRTA 1FEUA 3W2VB 2ZJRS 1QRSA 1UDXA 2ZJQS 1GTRA 3J7ZV 1QRUA 5DM7S 5GAEW 3PIPS 3CF5S 4WFBS 4WFNS 4P2BA 4JXXA 4H3SA 4H4KA 3PIOS 4JXZA 1DFUP 1ZJWA 4WFAS 3X1LB 1B75A 1D6KA 4IOCS 1O0BA 1O0CA 3W2WB 4WF9S 4JYZA 5IZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 4; 
#chains in the Genus database with same CATH topology
 4IO9 S;  1GTS A;  2HZ7 A;  2RD2 A;  1EUQ A;  4V19 4;  1VHY A;  4IOA S;  5BNZ A;  3DLL S;  2PIC A;  1QRS A;  1GTR A;  3CF5 S;  4WFN S;  1VHK A;  4H3S A;  4H4K A;  1DFU P;  4WFA S;  1D6K A;  2EGV A;  1O0B A;  1O0C A;  5IZN A;  2NWA A;  3KW2 A;  4UY8 8;  2G6G A;  4WCE S;  1EUY A;  2PJJ A;  5GAG W;  2ZJP S;  1UDX A;  5GAE W;  3PIO S;  4WF9 S;  4JYZ A;  1NXZ A;  4JXZ A;  1EXD A;  2AE0 X;  5GAH W;  5JVH S;  2CX8 A;  4U67 S;  2PI8 A;  2GAE A;  3AII A;  2RE8 A;  2ZJR S;  2ZJQ S;  2PNW A;  3J7Z V;  1QRU A;  4E8B A;  2Z0Y A;  4WFB S;  3CZB A;  4P2B A;  1ZJW A;  3X1L B;  4IOC S;  3W2W B;  4J3C A;  4L69 A;  5JVG S;  5DM6 S;  5HL7 S;  1QTQ A;  1NYL A;  1QRT A;  5GAD W;  1FEU A;  3W2V B;  1V6Z A;  5DM7 S;  3PIP S;  4JXX A;  1Z85 A;  1B75 A;  2EGW A;  2G5D A; 
#chains in the Genus database with same CATH homology
 4IO9 S;  1EXD A;  5JVG S;  4UY8 8;  1GTS A;  2HZ7 A;  4WCE S;  2RD2 A;  5DM6 S;  1EUQ A;  5GAH W;  5HL7 S;  5JVH S;  1EUY A;  4V19 4;  4U67 S;  1QTQ A;  5GAG W;  4IOA S;  1NYL A;  5BNZ A;  3AII A;  3DLL S;  2ZJP S;  5GAD W;  2RE8 A;  1QRT A;  1FEU A;  3W2V B;  2ZJR S;  1QRS A;  1UDX A;  2ZJQ S;  1GTR A;  3J7Z V;  1QRU A;  5DM7 S;  5GAE W;  3PIP S;  3CF5 S;  4WFB S;  4WFN S;  4P2B A;  4JXX A;  4H3S A;  4H4K A;  3PIO S;  4JXZ A;  1DFU P;  1ZJW A;  4WFA S;  3X1L B;  1B75 A;  1D6K A;  4IOC S;  1O0B A;  1O0C A;  3W2W B;  4WF9 S;  4JYZ A;  5IZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...