4V194

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 4
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.120 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4v19400
4V194
chains in the Genus database with same CATH superfamily
1QRSA 5HL7S 4IOAS 1EXDA 5GADW 3PIOS 1B75A 3CZBA 1V6ZA 4UY88 2CX8A 1QRUA 2HZ7A 2PNWA 4JYZA 3CF5S 4IOCS 3KW2A 2GAEA 2RD2A 2ZJRS 1QRTA 1O0BA 4L69A 2ZJPS 2PI8A 1NYLA 3J7ZV 5BNZA 5DM7S 2EGWA 1DFUP 5DM6S 4WFAS 1QTQA 1ZJWA 2NWAA 3DLLS 1UDXA 2Z0YA 4H3SA 1NXZA 1GTRA 2PICA 3PIPS 4WFBS 1Z85A 4WCES 1VHKA 5IZNA 2RE8A 4JXXA 1EUYA 3AIIA 3X1LB 5JVGS 1FEUA 2AE0X 1EUQA 4WFNS 4V194 4H4KA 4U67S 4J3CA 2G5DA 4JXZA 1GTSA 5JVHS 1VHYA 3W2WB 2ZJQS 4E8BA 5GAHW 5GAGW 3W2VB 1D6KA 4WF9S 1O0CA 2EGVA 2G6GA 5GAEW 4IO9S 2PJJA 4P2BA
chains in the Genus database with same CATH topology
1GTRA 4JXZA 1QRSA 5HL7S 1GTSA 4IOAS 1EXDA 5BNZA 5GADW 3PIPS 5DM7S 4WFBS 5JVHS 3PIOS 1B75A 4WCES 3W2WB 5IZNA 2ZJQS 4UY88 1QRUA 1DFUP 2RE8A 2HZ7A 4JXXA 5DM6S 1EUYA 4JYZA 5GAHW 5GAGW 3W2VB 4WFAS 3CF5S 1D6KA 4IOCS 4WF9S 1O0CA 3AIIA 2RD2A 2ZJRS 3X1LB 1QRTA 1QTQA 5JVGS 1ZJWA 1O0BA 1FEUA 5GAEW 2ZJPS 3DLLS 4IO9S 4P2BA 1EUQA 1NYLA 1UDXA 4WFNS 4V194 4H3SA 4H4KA 3J7ZV 4U67S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 4; 
#chains in the Genus database with same CATH topology
 1QRS A;  5HL7 S;  4IOA S;  1EXD A;  5GAD W;  3PIO S;  1B75 A;  3CZB A;  1V6Z A;  4UY8 8;  2CX8 A;  1QRU A;  2HZ7 A;  2PNW A;  4JYZ A;  3CF5 S;  4IOC S;  3KW2 A;  2GAE A;  2RD2 A;  2ZJR S;  1QRT A;  1O0B A;  4L69 A;  2ZJP S;  2PI8 A;  1NYL A;  3J7Z V;  5BNZ A;  5DM7 S;  2EGW A;  1DFU P;  5DM6 S;  4WFA S;  1QTQ A;  1ZJW A;  2NWA A;  3DLL S;  1UDX A;  2Z0Y A;  4H3S A;  1NXZ A;  1GTR A;  2PIC A;  3PIP S;  4WFB S;  1Z85 A;  4WCE S;  1VHK A;  5IZN A;  2RE8 A;  4JXX A;  1EUY A;  3AII A;  3X1L B;  5JVG S;  1FEU A;  2AE0 X;  1EUQ A;  4WFN S;  4V19 4;  4H4K A;  4U67 S;  4J3C A;  2G5D A;  4JXZ A;  1GTS A;  5JVH S;  1VHY A;  3W2W B;  2ZJQ S;  4E8B A;  5GAH W;  5GAG W;  3W2V B;  1D6K A;  4WF9 S;  1O0C A;  2EGV A;  2G6G A;  5GAE W;  4IO9 S;  2PJJ A;  4P2B A; 
#chains in the Genus database with same CATH homology
 1GTR A;  4JXZ A;  1QRS A;  5HL7 S;  1GTS A;  4IOA S;  1EXD A;  5BNZ A;  5GAD W;  3PIP S;  5DM7 S;  4WFB S;  5JVH S;  3PIO S;  1B75 A;  4WCE S;  3W2W B;  5IZN A;  2ZJQ S;  4UY8 8;  1QRU A;  1DFU P;  2RE8 A;  2HZ7 A;  4JXX A;  5DM6 S;  1EUY A;  4JYZ A;  5GAH W;  5GAG W;  3W2V B;  4WFA S;  3CF5 S;  1D6K A;  4IOC S;  4WF9 S;  1O0C A;  3AII A;  2RD2 A;  2ZJR S;  3X1L B;  1QRT A;  1QTQ A;  5JVG S;  1ZJW A;  1O0B A;  1FEU A;  5GAE W;  2ZJP S;  3DLL S;  4IO9 S;  4P2B A;  1EUQ A;  1NYL A;  1UDX A;  4WFN S;  4V19 4;  4H3S A;  4H4K A;  3J7Z V;  4U67 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...