4V194

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
total genus 4
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.120 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4v19400
4V194
chains in the Genus database with same CATH superfamily
4WCES 4JXZA 4V194 4JXXA 2EGWA 5GADW 4L69A 1ZJWA 1VHKA 2ZJPS 1V6ZA 2RD2A 2CX8A 2HZ7A 1EUYA 2Z0YA 3J7ZV 1DFUP 3DLLS 1GTSA 3W2VB 4WFAS 2ZJRS 1O0CA 1D6KA 1EUQA 1QRUA 1FEUA 4H4KA 2G6GA 2PI8A 1QRTA 5IZNA 1NYLA 3PIPS 3CF5S 2RE8A 5HL7S 1GTRA 1QRSA 4UY88 2PNWA 2G5DA 3CZBA 4WFBS 4IO9S 1EXDA 4P2BA 1UDXA 4JYZA 3X1LB 1NXZA 2PJJA 3KW2A 5DM7S 4E8BA 5GAEW 2ZJQS 3PIOS 4IOCS 2GAEA 5DM6S 5JVGS 5GAGW 2PICA 1QTQA 4WF9S 3AIIA 1O0BA 2EGVA 5JVHS 4J3CA 3W2WB 5BNZA 2NWAA 4U67S 5GAHW 1Z85A 1B75A 1VHYA 4IOAS 4H3SA 2AE0X 4WFNS
chains in the Genus database with same CATH topology
4WCES 4JXZA 4V194 4JXXA 5GADW 1ZJWA 2ZJPS 2RD2A 2HZ7A 1EUYA 3J7ZV 1DFUP 3DLLS 1GTSA 3W2VB 4WFAS 2ZJRS 1O0CA 1D6KA 1EUQA 1QRUA 1FEUA 4H4KA 1QRTA 5IZNA 1NYLA 3PIPS 3CF5S 2RE8A 5HL7S 1GTRA 1QRSA 4UY88 4WFBS 4IO9S 1EXDA 4P2BA 1UDXA 4JYZA 3X1LB 2ZJQS 5DM7S 5GAEW 3PIOS 4IOCS 5JVGS 5DM6S 5GAGW 1QTQA 4WF9S 3AIIA 1O0BA 5JVHS 3W2WB 5BNZA 4U67S 5GAHW 1B75A 4IOAS 4H3SA 4WFNS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 4; 
#chains in the Genus database with same CATH topology
 4WCE S;  4JXZ A;  4V19 4;  4JXX A;  2EGW A;  5GAD W;  4L69 A;  1ZJW A;  1VHK A;  2ZJP S;  1V6Z A;  2RD2 A;  2CX8 A;  2HZ7 A;  1EUY A;  2Z0Y A;  3J7Z V;  1DFU P;  3DLL S;  1GTS A;  3W2V B;  4WFA S;  2ZJR S;  1O0C A;  1D6K A;  1EUQ A;  1QRU A;  1FEU A;  4H4K A;  2G6G A;  2PI8 A;  1QRT A;  5IZN A;  1NYL A;  3PIP S;  3CF5 S;  2RE8 A;  5HL7 S;  1GTR A;  1QRS A;  4UY8 8;  2PNW A;  2G5D A;  3CZB A;  4WFB S;  4IO9 S;  1EXD A;  4P2B A;  1UDX A;  4JYZ A;  3X1L B;  1NXZ A;  2PJJ A;  3KW2 A;  5DM7 S;  4E8B A;  5GAE W;  2ZJQ S;  3PIO S;  4IOC S;  2GAE A;  5DM6 S;  5JVG S;  5GAG W;  2PIC A;  1QTQ A;  4WF9 S;  3AII A;  1O0B A;  2EGV A;  5JVH S;  4J3C A;  3W2W B;  5BNZ A;  2NWA A;  4U67 S;  5GAH W;  1Z85 A;  1B75 A;  1VHY A;  4IOA S;  4H3S A;  2AE0 X;  4WFN S; 
#chains in the Genus database with same CATH homology
 4WCE S;  4JXZ A;  4V19 4;  4JXX A;  5GAD W;  1ZJW A;  2ZJP S;  2RD2 A;  2HZ7 A;  1EUY A;  3J7Z V;  1DFU P;  3DLL S;  1GTS A;  3W2V B;  4WFA S;  2ZJR S;  1O0C A;  1D6K A;  1EUQ A;  1QRU A;  1FEU A;  4H4K A;  1QRT A;  5IZN A;  1NYL A;  3PIP S;  3CF5 S;  2RE8 A;  5HL7 S;  1GTR A;  1QRS A;  4UY8 8;  4WFB S;  4IO9 S;  1EXD A;  4P2B A;  1UDX A;  4JYZ A;  3X1L B;  2ZJQ S;  5DM7 S;  5GAE W;  3PIO S;  4IOC S;  5JVG S;  5DM6 S;  5GAG W;  1QTQ A;  4WF9 S;  3AII A;  1O0B A;  5JVH S;  3W2W B;  5BNZ A;  4U67 S;  5GAH W;  1B75 A;  4IOA S;  4H3S A;  4WFN S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...