2ZJRS

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjrS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjrS02
4WCES 1ZJWA 1D6KA 4IO9S 1EUQA 1GTSA 1QRSA 5GAEW 5GAGW 5GAHW 5GADW 1O0BA 5JVGS 4P2BA 4WFBS 2ZJPS 4UY88 1FEUA 5IZNA 1B75A 3DLLS 1EXDA 1QRTA 1O0CA 4IOCS 2ZJQS 3CF5S 1NYLA 1QRUA 5DM6S 3PIOS 4U67S 2RE8A 5HL7S 4WFNS 3PIPS 2ZJRS 2HZ7A 2RD2A 4JYZA 1EUYA 5JVHS 4WF9S 1GTRA 4IOAS 4JXXA 3AIIA 4JXZA 5BNZA 3J7ZV 4H3SA 1QTQA 1DFUP 4WFAS 5DM7S
chains in the Genus database with same CATH superfamily
4G7ZA 1ZJWA 4LK1A 1R9TC 2WAQD 5IP7C 2PNWA 4C3HC 5GAHW 3HKZD 4A93C 2O5JA 2G6GA 4WFBS 2G5DA 1NXZA 2EGWA 4UY88 4C3IC 5C44C 4A3EC 4XSZA 4GZYA 3KW2A 4XSXA 4C3JC 4BXXC 3I4MC 1QRUA 4QJVA 1I3QC 4U67S 1SMYA 4AYBD 1I50C 2A68A 4A3LC 3HOYC 2NVTC 2ZJRS 2HZ7A 4NOIA 3S2DC 4BY7C 5JVHS 4J3CA 2JA5C 4ZH4A 1Z85A 4L69A 4JXZA 2A6EA 2NVXC 2Z0YA 2E2HC 3GTOC 3GTLC 3GTQC 4A3GC 4KN4A 4A3JC 4XLPA 1UDXA 3PO2C 1V6ZA 1ZYRA 1WCMC 4IO9S 3WODA 3GTMC 1TWHC 5GAEW 5GAGW 2KXYA 5GADW 3HOWC 2BE5A 4Q5SA 2JA8C 2PI8A 5JVGS 2ZJPS 2PPBA 5IZNA 2B63C 1B75A 1VHKA 4G7OA 4LK0A 1QRTA 4H4KA 3GTPC 4IOCS 2PMZD 2RE8A 3S1RC 3RZDC 5HL7S 5HQHA 2YU9C 4WFNS 4BBSC 1EUYA 4WF9S 1YNJA 4IOAS 4JXXA 2R93C 1TWAC 3AIIA 1HQMA 1TWFC 2PA8D 4OIRA 5BNZA 2L5NA 4MQ9A 4JK1A 4Q4ZA 4OIQA 3S17C 2KPUA 5FLMC 1SFOC 3CQZC 3I4NC 4A3FC 2PJJA 1I6HC 4KMUA 2L3UA 4A3CC 4A3IC 1EUQA 1GTSA 5IYBC 5C4XC 4OINA 1TWCC 1I6VA 3W2WB 4YFNA 4P2BA 2NVQC 1FEUA 4G7HA 4LLGA 4YFKA 5D4DA 3M3YC 3DLLS 3W2VB 1EXDA 2A6HA 5IYDC 3DXJA 1YNNA 3LYWA 2NWAA 3H0GC 2GAEA 4YFXA 3CF5S 1BDFA 4V194 5DM6S 3PIOS 2AE0X 4XLNA 2JA7C 2A69A 3S15C 3PIPS 2RD2A 4JYZA 2R7ZC 1Y1VC 4BBRC 1GTRA 2E2JC 3S2HC 4MEYA 4QIWD 2O5IA 2JA6C 1Y1WC 3J7ZV 4LJZA 4H3SA 5C4JC 3PO3C 1QTQA 3EQLA 2R92C 4WFAS 4A3DC 3HOVC 4BY1C 4OIOA 3S16C 4WCES 3GTGC 1D6KA 2NVYC 4A3MC 1VHYA 1QRSA 1IW7A 3CZBA 3K7AC 5IP9C 1O0BA 1K83C 4C2MC 2EGVA 4KN7A 4A3KC 3HOXC 3S1MC 1O0CA 3X1LB 2PICA 2Y0SD 4Y7NC 2ZJQS 5TMFA 3S1NC 3H3VD 1NYLA 3S1QC 4MEXA 2CW0A 4YG2A 2CX8A 4Y52C 3GTJC 2VUMC 3FKIC 5C3EC 3HOUC 2KQ1A 4OIPA 5IYCC 3GTKC 3RZOC 4A3BC 3M4OC 4X6AC 4E8BA 2WB1D 3HOZC 2E2IC 1DFUP 5TMCA 3S14C 5DM7S 1TWGC
chains in the Genus database with same CATH topology
4WCES 1ZJWA 1D6KA 4IO9S 1EUQA 1GTSA 1QRSA 5GAEW 5GAGW 5GAHW 5GADW 3W2WB 5JVGS 4P2BA 4WFBS 1O0BA 2ZJPS 4UY88 1FEUA 5IZNA 1B75A 3DLLS 3W2VB 1EXDA 1QRTA 4H4KA 1O0CA 3X1LB 4IOCS 2ZJQS 3CF5S 1NYLA 1QRUA 4V194 5DM6S 3PIOS 4U67S 2RE8A 5HL7S 4WFNS 3PIPS 2ZJRS 2HZ7A 2RD2A 4JYZA 1EUYA 5JVHS 4WF9S 1GTRA 4IOAS 4JXXA 3AIIA 4JXZA 5BNZA 3J7ZV 4H3SA 1QTQA 1DFUP 4WFAS 1UDXA 5DM7S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE S;  1ZJW A;  1D6K A;  4IO9 S;  1EUQ A;  1GTS A;  1QRS A;  5GAE W;  5GAG W;  5GAH W;  5GAD W;  1O0B A;  5JVG S;  4P2B A;  4WFB S;  2ZJP S;  4UY8 8;  1FEU A;  5IZN A;  1B75 A;  3DLL S;  1EXD A;  1QRT A;  1O0C A;  4IOC S;  2ZJQ S;  3CF5 S;  1NYL A;  1QRU A;  5DM6 S;  3PIO S;  4U67 S;  2RE8 A;  5HL7 S;  4WFN S;  3PIP S;  2ZJR S;  2HZ7 A;  2RD2 A;  4JYZ A;  1EUY A;  5JVH S;  4WF9 S;  1GTR A;  4IOA S;  4JXX A;  3AII A;  4JXZ A;  5BNZ A;  3J7Z V;  4H3S A;  1QTQ A;  1DFU P;  4WFA S;  5DM7 S; 
#chains in the Genus database with same CATH topology
 4G7Z A;  1ZJW A;  4LK1 A;  1R9T C;  2WAQ D;  5IP7 C;  2PNW A;  4C3H C;  5GAH W;  3HKZ D;  4A93 C;  2O5J A;  2G6G A;  4WFB S;  2G5D A;  1NXZ A;  2EGW A;  4UY8 8;  4C3I C;  5C44 C;  4A3E C;  4XSZ A;  4GZY A;  3KW2 A;  4XSX A;  4C3J C;  4BXX C;  3I4M C;  1QRU A;  4QJV A;  1I3Q C;  4U67 S;  1SMY A;  4AYB D;  1I50 C;  2A68 A;  4A3L C;  3HOY C;  2NVT C;  2ZJR S;  2HZ7 A;  4NOI A;  3S2D C;  4BY7 C;  5JVH S;  4J3C A;  2JA5 C;  4ZH4 A;  1Z85 A;  4L69 A;  4JXZ A;  2A6E A;  2NVX C;  2Z0Y A;  2E2H C;  3GTO C;  3GTL C;  3GTQ C;  4A3G C;  4KN4 A;  4A3J C;  4XLP A;  1UDX A;  3PO2 C;  1V6Z A;  1ZYR A;  1WCM C;  4IO9 S;  3WOD A;  3GTM C;  1TWH C;  5GAE W;  5GAG W;  2KXY A;  5GAD W;  3HOW C;  2BE5 A;  4Q5S A;  2JA8 C;  2PI8 A;  5JVG S;  2ZJP S;  2PPB A;  5IZN A;  2B63 C;  1B75 A;  1VHK A;  4G7O A;  4LK0 A;  1QRT A;  4H4K A;  3GTP C;  4IOC S;  2PMZ D;  2RE8 A;  3S1R C;  3RZD C;  5HL7 S;  5HQH A;  2YU9 C;  4WFN S;  4BBS C;  1EUY A;  4WF9 S;  1YNJ A;  4IOA S;  4JXX A;  2R93 C;  1TWA C;  3AII A;  1HQM A;  1TWF C;  2PA8 D;  4OIR A;  5BNZ A;  2L5N A;  4MQ9 A;  4JK1 A;  4Q4Z A;  4OIQ A;  3S17 C;  2KPU A;  5FLM C;  1SFO C;  3CQZ C;  3I4N C;  4A3F C;  2PJJ A;  1I6H C;  4KMU A;  2L3U A;  4A3C C;  4A3I C;  1EUQ A;  1GTS A;  5IYB C;  5C4X C;  4OIN A;  1TWC C;  1I6V A;  3W2W B;  4YFN A;  4P2B A;  2NVQ C;  1FEU A;  4G7H A;  4LLG A;  4YFK A;  5D4D A;  3M3Y C;  3DLL S;  3W2V B;  1EXD A;  2A6H A;  5IYD C;  3DXJ A;  1YNN A;  3LYW A;  2NWA A;  3H0G C;  2GAE A;  4YFX A;  3CF5 S;  1BDF A;  4V19 4;  5DM6 S;  3PIO S;  2AE0 X;  4XLN A;  2JA7 C;  2A69 A;  3S15 C;  3PIP S;  2RD2 A;  4JYZ A;  2R7Z C;  1Y1V C;  4BBR C;  1GTR A;  2E2J C;  3S2H C;  4MEY A;  4QIW D;  2O5I A;  2JA6 C;  1Y1W C;  3J7Z V;  4LJZ A;  4H3S A;  5C4J C;  3PO3 C;  1QTQ A;  3EQL A;  2R92 C;  4WFA S;  4A3D C;  3HOV C;  4BY1 C;  4OIO A;  3S16 C;  4WCE S;  3GTG C;  1D6K A;  2NVY C;  4A3M C;  1VHY A;  1QRS A;  1IW7 A;  3CZB A;  3K7A C;  5IP9 C;  1O0B A;  1K83 C;  4C2M C;  2EGV A;  4KN7 A;  4A3K C;  3HOX C;  3S1M C;  1O0C A;  3X1L B;  2PIC A;  2Y0S D;  4Y7N C;  2ZJQ S;  5TMF A;  3S1N C;  3H3V D;  1NYL A;  3S1Q C;  4MEX A;  2CW0 A;  4YG2 A;  2CX8 A;  4Y52 C;  3GTJ C;  2VUM C;  3FKI C;  5C3E C;  3HOU C;  2KQ1 A;  4OIP A;  5IYC C;  3GTK C;  3RZO C;  4A3B C;  3M4O C;  4X6A C;  4E8B A;  2WB1 D;  3HOZ C;  2E2I C;  1DFU P;  5TMC A;  3S14 C;  5DM7 S;  1TWG C; 
#chains in the Genus database with same CATH homology
 4WCE S;  1ZJW A;  1D6K A;  4IO9 S;  1EUQ A;  1GTS A;  1QRS A;  5GAE W;  5GAG W;  5GAH W;  5GAD W;  3W2W B;  5JVG S;  4P2B A;  4WFB S;  1O0B A;  2ZJP S;  4UY8 8;  1FEU A;  5IZN A;  1B75 A;  3DLL S;  3W2V B;  1EXD A;  1QRT A;  4H4K A;  1O0C A;  3X1L B;  4IOC S;  2ZJQ S;  3CF5 S;  1NYL A;  1QRU A;  4V19 4;  5DM6 S;  3PIO S;  4U67 S;  2RE8 A;  5HL7 S;  4WFN S;  3PIP S;  2ZJR S;  2HZ7 A;  2RD2 A;  4JYZ A;  1EUY A;  5JVH S;  4WF9 S;  1GTR A;  4IOA S;  4JXX A;  3AII A;  4JXZ A;  5BNZ A;  3J7Z V;  4H3S A;  1QTQ A;  1DFU P;  4WFA S;  1UDX A;  5DM7 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...