2ZJRS

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 19
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjrS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjrS02
2RD2A 4U67S 4WFBS 5HL7S 5IZNA 1D6KA 5JVHS 4IO9S 5BNZA 1O0CA 4WCES 5GADW 4UY88 3CF5S 1FEUA 2ZJQS 1DFUP 5GAHW 1QRTA 4JXXA 1QRUA 1GTRA 2ZJRS 4P2BA 3PIPS 4H3SA 3J7ZV 1B75A 1EXDA 2HZ7A 4IOAS 4WF9S 1QRSA 3DLLS 1GTSA 5GAGW 1O0BA 5GAEW 1EUQA 2ZJPS 4IOCS 4WFNS 5DM6S 5DM7S 1ZJWA 1EUYA 3PIOS 4JXZA 2RE8A 1NYLA 5JVGS 4JYZA 1QTQA 3AIIA 4WFAS
chains in the Genus database with same CATH superfamily
2PA8D 2A6EA 4MQ9A 4A3MC 1K83C 5HL7S 3S16C 5TMFA 1D6KA 1HQMA 2PPBA 4WCES 4C3IC 5IYDC 3CQZC 5TMCA 2PMZD 5C4JC 5HQHA 5C3EC 3CF5S 2R7ZC 4G7HA 4A3CC 1DFUP 3HOXC 5GAHW 4JXXA 1SMYA 4LLGA 4C3JC 1QRUA 4C2MC 1GTRA 4E8BA 1VHKA 1UDXA 3W2WB 2YU9C 4C3HC 1B75A 4XSXA 3S1NC 4YFKA 4IOAS 4WF9S 1TWFC 4QIWD 2R92C 3I4NC 3DLLS 1GTSA 2R93C 1V6ZA 2O5JA 4G7ZA 4A93C 1EUQA 1I3QC 3HOVC 4OIOA 3RZDC 4X6AC 2PNWA 4WFNS 4OIPA 3M4OC 3PIOS 4YG2A 2EGVA 1NYLA 4A3FC 3HOZC 1QTQA 1EUYA 2CW0A 2KPUA 2Y0SD 1Z85A 1BDFA 2A69A 4XLPA 4KMUA 3GTOC 2RD2A 4Y7NC 4WFBS 1WCMC 3GTKC 3PO3C 5IYCC 5IP9C 5JVHS 3S15C 5BNZA 4UY88 4AYBD 4A3KC 2NVTC 4G7OA 5FLMC 2WB1D 4BBSC 4ZH4A 3S1RC 1FEUA 1I6HC 3S2HC 4YFNA 4BY1C 4LK0A 2NWAA 4MEXA 1NXZA 4Y52C 3HOYC 3PIPS 3CZBA 3J7ZV 3S1QC 4A3IC 1EXDA 2G6GA 4A3GC 2JA6C 3WODA 1O0BA 3S1MC 1IW7A 5DM6S 1TWHC 5DM7S 4Q4ZA 1SFOC 4JXZA 1R9TC 3GTQC 4XSZA 5IYBC 3K7AC 3X1LB 3W2VB 3GTPC 4OINA 2E2IC 2CX8A 2G5DA 4OIQA 3M3YC 4A3LC 2PI8A 4IO9S 2EGWA 4XLNA 1ZYRA 4A3JC 2L5NA 1YNNA 3DXJA 2NVXC 2A68A 2KXYA 2PJJA 2ZJQS 1Y1WC 1QRTA 2O5IA 3GTJC 4L69A 5D4DA 2ZJRS 4A3EC 3GTGC 4V194 5IP7C 1Y1VC 1TWGC 2Z0YA 1YNJA 2A6HA 3PO2C 1TWAC 2JA7C 3S14C 5GAEW 4MEYA 4KN7A 4NOIA 2JA5C 4IOCS 4LK1A 2GAEA 3H0GC 2VUMC 4JYZA 4A3BC 2E2JC 3LYWA 3RZOC 4BXXC 3FKIC 4OIRA 4U67S 3KW2A 2B63C 2JA8C 5IZNA 4J3CA 1VHYA 4A3DC 2WAQD 2NVQC 1O0CA 3EQLA 4QJVA 5GADW 4Q5SA 4YFXA 3GTLC 4KN4A 2PICA 3GTMC 3I4MC 2NVYC 1I50C 3S2DC 4P2BA 1I6VA 4H3SA 5C44C 4BY7C 2HZ7A 3HOWC 5C4XC 1QRSA 2AE0X 3H3VD 4BBRC 3HOUC 2L3UA 3S17C 5GAGW 2ZJPS 1TWCC 2E2HC 4LJZA 1ZJWA 4H4KA 2RE8A 5JVGS 2KQ1A 4JK1A 3AIIA 2BE5A 4WFAS 4GZYA 3HKZD
chains in the Genus database with same CATH topology
3X1LB 3W2VB 2RD2A 4U67S 4WFBS 5HL7S 5IZNA 1D6KA 5JVHS 4IO9S 5BNZA 1O0CA 4WCES 5GADW 4UY88 3CF5S 1FEUA 2ZJQS 1DFUP 5GAHW 1QRTA 4JXXA 1QRUA 1GTRA 2ZJRS 1UDXA 4P2BA 3W2WB 4H3SA 3J7ZV 3PIPS 4V194 1EXDA 2HZ7A 4IOAS 4WF9S 1B75A 1QRSA 3DLLS 1GTSA 5GAGW 1O0BA 5GAEW 1EUQA 2ZJPS 4IOCS 4WFNS 5DM6S 5DM7S 1ZJWA 1EUYA 3PIOS 4H4KA 2RE8A 1NYLA 5JVGS 4JYZA 1QTQA 3AIIA 4JXZA 4WFAS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD2 A;  4U67 S;  4WFB S;  5HL7 S;  5IZN A;  1D6K A;  5JVH S;  4IO9 S;  5BNZ A;  1O0C A;  4WCE S;  5GAD W;  4UY8 8;  3CF5 S;  1FEU A;  2ZJQ S;  1DFU P;  5GAH W;  1QRT A;  4JXX A;  1QRU A;  1GTR A;  2ZJR S;  4P2B A;  3PIP S;  4H3S A;  3J7Z V;  1B75 A;  1EXD A;  2HZ7 A;  4IOA S;  4WF9 S;  1QRS A;  3DLL S;  1GTS A;  5GAG W;  1O0B A;  5GAE W;  1EUQ A;  2ZJP S;  4IOC S;  4WFN S;  5DM6 S;  5DM7 S;  1ZJW A;  1EUY A;  3PIO S;  4JXZ A;  2RE8 A;  1NYL A;  5JVG S;  4JYZ A;  1QTQ A;  3AII A;  4WFA S; 
#chains in the Genus database with same CATH topology
 2PA8 D;  2A6E A;  4MQ9 A;  4A3M C;  1K83 C;  5HL7 S;  3S16 C;  5TMF A;  1D6K A;  1HQM A;  2PPB A;  4WCE S;  4C3I C;  5IYD C;  3CQZ C;  5TMC A;  2PMZ D;  5C4J C;  5HQH A;  5C3E C;  3CF5 S;  2R7Z C;  4G7H A;  4A3C C;  1DFU P;  3HOX C;  5GAH W;  4JXX A;  1SMY A;  4LLG A;  4C3J C;  1QRU A;  4C2M C;  1GTR A;  4E8B A;  1VHK A;  1UDX A;  3W2W B;  2YU9 C;  4C3H C;  1B75 A;  4XSX A;  3S1N C;  4YFK A;  4IOA S;  4WF9 S;  1TWF C;  4QIW D;  2R92 C;  3I4N C;  3DLL S;  1GTS A;  2R93 C;  1V6Z A;  2O5J A;  4G7Z A;  4A93 C;  1EUQ A;  1I3Q C;  3HOV C;  4OIO A;  3RZD C;  4X6A C;  2PNW A;  4WFN S;  4OIP A;  3M4O C;  3PIO S;  4YG2 A;  2EGV A;  1NYL A;  4A3F C;  3HOZ C;  1QTQ A;  1EUY A;  2CW0 A;  2KPU A;  2Y0S D;  1Z85 A;  1BDF A;  2A69 A;  4XLP A;  4KMU A;  3GTO C;  2RD2 A;  4Y7N C;  4WFB S;  1WCM C;  3GTK C;  3PO3 C;  5IYC C;  5IP9 C;  5JVH S;  3S15 C;  5BNZ A;  4UY8 8;  4AYB D;  4A3K C;  2NVT C;  4G7O A;  5FLM C;  2WB1 D;  4BBS C;  4ZH4 A;  3S1R C;  1FEU A;  1I6H C;  3S2H C;  4YFN A;  4BY1 C;  4LK0 A;  2NWA A;  4MEX A;  1NXZ A;  4Y52 C;  3HOY C;  3PIP S;  3CZB A;  3J7Z V;  3S1Q C;  4A3I C;  1EXD A;  2G6G A;  4A3G C;  2JA6 C;  3WOD A;  1O0B A;  3S1M C;  1IW7 A;  5DM6 S;  1TWH C;  5DM7 S;  4Q4Z A;  1SFO C;  4JXZ A;  1R9T C;  3GTQ C;  4XSZ A;  5IYB C;  3K7A C;  3X1L B;  3W2V B;  3GTP C;  4OIN A;  2E2I C;  2CX8 A;  2G5D A;  4OIQ A;  3M3Y C;  4A3L C;  2PI8 A;  4IO9 S;  2EGW A;  4XLN A;  1ZYR A;  4A3J C;  2L5N A;  1YNN A;  3DXJ A;  2NVX C;  2A68 A;  2KXY A;  2PJJ A;  2ZJQ S;  1Y1W C;  1QRT A;  2O5I A;  3GTJ C;  4L69 A;  5D4D A;  2ZJR S;  4A3E C;  3GTG C;  4V19 4;  5IP7 C;  1Y1V C;  1TWG C;  2Z0Y A;  1YNJ A;  2A6H A;  3PO2 C;  1TWA C;  2JA7 C;  3S14 C;  5GAE W;  4MEY A;  4KN7 A;  4NOI A;  2JA5 C;  4IOC S;  4LK1 A;  2GAE A;  3H0G C;  2VUM C;  4JYZ A;  4A3B C;  2E2J C;  3LYW A;  3RZO C;  4BXX C;  3FKI C;  4OIR A;  4U67 S;  3KW2 A;  2B63 C;  2JA8 C;  5IZN A;  4J3C A;  1VHY A;  4A3D C;  2WAQ D;  2NVQ C;  1O0C A;  3EQL A;  4QJV A;  5GAD W;  4Q5S A;  4YFX A;  3GTL C;  4KN4 A;  2PIC A;  3GTM C;  3I4M C;  2NVY C;  1I50 C;  3S2D C;  4P2B A;  1I6V A;  4H3S A;  5C44 C;  4BY7 C;  2HZ7 A;  3HOW C;  5C4X C;  1QRS A;  2AE0 X;  3H3V D;  4BBR C;  3HOU C;  2L3U A;  3S17 C;  5GAG W;  2ZJP S;  1TWC C;  2E2H C;  4LJZ A;  1ZJW A;  4H4K A;  2RE8 A;  5JVG S;  2KQ1 A;  4JK1 A;  3AII A;  2BE5 A;  4WFA S;  4GZY A;  3HKZ D; 
#chains in the Genus database with same CATH homology
 3X1L B;  3W2V B;  2RD2 A;  4U67 S;  4WFB S;  5HL7 S;  5IZN A;  1D6K A;  5JVH S;  4IO9 S;  5BNZ A;  1O0C A;  4WCE S;  5GAD W;  4UY8 8;  3CF5 S;  1FEU A;  2ZJQ S;  1DFU P;  5GAH W;  1QRT A;  4JXX A;  1QRU A;  1GTR A;  2ZJR S;  1UDX A;  4P2B A;  3W2W B;  4H3S A;  3J7Z V;  3PIP S;  4V19 4;  1EXD A;  2HZ7 A;  4IOA S;  4WF9 S;  1B75 A;  1QRS A;  3DLL S;  1GTS A;  5GAG W;  1O0B A;  5GAE W;  1EUQ A;  2ZJP S;  4IOC S;  4WFN S;  5DM6 S;  5DM7 S;  1ZJW A;  1EUY A;  3PIO S;  4H4K A;  2RE8 A;  1NYL A;  5JVG S;  4JYZ A;  1QTQ A;  3AII A;  4JXZ A;  4WFA S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...