2ZJRS

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 19
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjrS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjrS02
2ZJPS 1EXDA 5JVHS 2ZJQS 1D6KA 1QTQA 5GAGW 2RD2A 2RE8A 4WF9S 4WFAS 1QRSA 4U67S 3PIPS 5HL7S 3J7ZV 1EUQA 4IO9S 3PIOS 4H3SA 5DM6S 4JXXA 3AIIA 2HZ7A 5JVGS 4P2BA 1B75A 1NYLA 1DFUP 1ZJWA 1GTRA 4WCES 3DLLS 1QRUA 5BNZA 3CF5S 1O0BA 5GAEW 1QRTA 5IZNA 4IOAS 2ZJRS 4IOCS 5DM7S 4WFNS 4JXZA 4JYZA 1GTSA 4UY88 1FEUA 5GADW 1EUYA 5GAHW 4WFBS 1O0CA
chains in the Genus database with same CATH superfamily
4LLGA 5C4XC 4A3MC 4KMUA 1UDXA 1R9TC 5C4JC 3S1QC 2WB1D 4BXXC 4C3IC 4ZH4A 5IYCC 4XLPA 2RD2A 2NVQC 1SFOC 4OIRA 4U67S 3S1RC 5HL7S 2EGWA 3J7ZV 1EUQA 3HOYC 4JK1A 3S1MC 4JXXA 2BE5A 3AIIA 2NVTC 5JVGS 1B75A 5C44C 1YNNA 3S1NC 2R92C 1GTRA 1QRUA 4WCES 2L5NA 3GTMC 2A69A 5FLMC 4YFNA 4G7HA 4BBSC 2A6HA 4Y52C 2WAQD 4IOAS 4A3JC 2A68A 2Y0SD 3S14C 4JXZA 4JYZA 1GTSA 4A3EC 3GTGC 3FKIC 4OIQA 4C2MC 2JA8C 3GTJC 1ZYRA 2R7ZC 4G7OA 3RZOC 5TMCA 1TWHC 3HOVC 4A3GC 1HQMA 3GTOC 4A3CC 4WFBS 2G6GA 3LYWA 2NVYC 4A3LC 3GTQC 1EXDA 5JVHS 1D6KA 3HOWC 3S2HC 2E2IC 5TMFA 2A6EA 1TWCC 4A93C 4A3KC 3GTLC 4XLNA 3GTPC 4A3BC 4A3FC 4BBRC 3W2WB 1YNJA 3M4OC 4MQ9A 3DLLS 5IYDC 2PNWA 4E8BA 3S15C 5IZNA 1NXZA 2PA8D 1Z85A 2ZJRS 2JA6C 3I4NC 2G5DA 4J3CA 5DM7S 4V194 1I3QC 3CQZC 4KN4A 4A3IC 3HOZC 5GADW 2PICA 1TWAC 3HOXC 5IP9C 2PJJA 5GAHW 2E2JC 1K83C 4QIWD 3S2DC 2JA5C 2R93C 1O0CA 4G7ZA 5GAGW 4WF9S 4BY7C 3S17C 2NVXC 2E2HC 4WFAS 3K7AC 4A3DC 3KW2A 4Q4ZA 1V6ZA 4AYBD 4IO9S 2EGVA 4H3SA 2L3UA 2HZ7A 2PI8A 2Z0YA 4Y7NC 4X6AC 1DFUP 1VHYA 4Q5SA 1VHKA 5BNZA 3CF5S 5GAEW 2AE0X 1O0BA 3X1LB 1SMYA 4QJVA 2CW0A 4WFNS 2CX8A 1I6VA 1I6HC 4MEXA 2KPUA 1EUYA 2GAEA 1IW7A 2KXYA 3DXJA 3M3YC 4MEYA 2YU9C 2KQ1A 3WODA 5D4DA 4KN7A 3HOUC 4YFKA 4XSZA 2ZJPS 5IYBC 3RZDC 4XSXA 2ZJQS 5C3EC 4OINA 1QTQA 4OIOA 2RE8A 1TWFC 2B63C 1Y1VC 1QRSA 3PIPS 1BDFA 3PIOS 5DM6S 4C3HC 3I4MC 2O5JA 4P2BA 4LJZA 1NYLA 4BY1C 4L69A 1ZJWA 1I50C 4OIPA 1QRTA 2PPBA 3W2VB 3S16C 4LK1A 1Y1WC 5HQHA 2NWAA 4IOCS 2O5IA 4YFXA 4LK0A 3H3VD 4UY88 3PO2C 4H4KA 1FEUA 2PMZD 1WCMC 1TWGC 5IP7C 4GZYA 3CZBA 3H0GC 4C3JC 4NOIA 3GTKC 3EQLA 3PO3C 2JA7C 4YG2A 3HKZD 2VUMC
chains in the Genus database with same CATH topology
2ZJPS 1EXDA 1UDXA 2ZJQS 5JVHS 1D6KA 1QTQA 5GAGW 2RD2A 2RE8A 4WF9S 4WFAS 1QRSA 4U67S 3PIPS 5HL7S 3J7ZV 1EUQA 4IO9S 3PIOS 4H3SA 5DM6S 4JXXA 3AIIA 2HZ7A 5JVGS 4P2BA 3W2WB 1NYLA 1DFUP 1B75A 1ZJWA 1GTRA 4WCES 3DLLS 1QRUA 5BNZA 3CF5S 1O0BA 5GAEW 1QRTA 3X1LB 3W2VB 5IZNA 4IOAS 2ZJRS 4IOCS 5DM7S 4WFNS 4V194 4JYZA 4JXZA 1GTSA 4UY88 4H4KA 1FEUA 5GADW 1EUYA 5GAHW 4WFBS 1O0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJP S;  1EXD A;  5JVH S;  2ZJQ S;  1D6K A;  1QTQ A;  5GAG W;  2RD2 A;  2RE8 A;  4WF9 S;  4WFA S;  1QRS A;  4U67 S;  3PIP S;  5HL7 S;  3J7Z V;  1EUQ A;  4IO9 S;  3PIO S;  4H3S A;  5DM6 S;  4JXX A;  3AII A;  2HZ7 A;  5JVG S;  4P2B A;  1B75 A;  1NYL A;  1DFU P;  1ZJW A;  1GTR A;  4WCE S;  3DLL S;  1QRU A;  5BNZ A;  3CF5 S;  1O0B A;  5GAE W;  1QRT A;  5IZN A;  4IOA S;  2ZJR S;  4IOC S;  5DM7 S;  4WFN S;  4JXZ A;  4JYZ A;  1GTS A;  4UY8 8;  1FEU A;  5GAD W;  1EUY A;  5GAH W;  4WFB S;  1O0C A; 
#chains in the Genus database with same CATH topology
 4LLG A;  5C4X C;  4A3M C;  4KMU A;  1UDX A;  1R9T C;  5C4J C;  3S1Q C;  2WB1 D;  4BXX C;  4C3I C;  4ZH4 A;  5IYC C;  4XLP A;  2RD2 A;  2NVQ C;  1SFO C;  4OIR A;  4U67 S;  3S1R C;  5HL7 S;  2EGW A;  3J7Z V;  1EUQ A;  3HOY C;  4JK1 A;  3S1M C;  4JXX A;  2BE5 A;  3AII A;  2NVT C;  5JVG S;  1B75 A;  5C44 C;  1YNN A;  3S1N C;  2R92 C;  1GTR A;  1QRU A;  4WCE S;  2L5N A;  3GTM C;  2A69 A;  5FLM C;  4YFN A;  4G7H A;  4BBS C;  2A6H A;  4Y52 C;  2WAQ D;  4IOA S;  4A3J C;  2A68 A;  2Y0S D;  3S14 C;  4JXZ A;  4JYZ A;  1GTS A;  4A3E C;  3GTG C;  3FKI C;  4OIQ A;  4C2M C;  2JA8 C;  3GTJ C;  1ZYR A;  2R7Z C;  4G7O A;  3RZO C;  5TMC A;  1TWH C;  3HOV C;  4A3G C;  1HQM A;  3GTO C;  4A3C C;  4WFB S;  2G6G A;  3LYW A;  2NVY C;  4A3L C;  3GTQ C;  1EXD A;  5JVH S;  1D6K A;  3HOW C;  3S2H C;  2E2I C;  5TMF A;  2A6E A;  1TWC C;  4A93 C;  4A3K C;  3GTL C;  4XLN A;  3GTP C;  4A3B C;  4A3F C;  4BBR C;  3W2W B;  1YNJ A;  3M4O C;  4MQ9 A;  3DLL S;  5IYD C;  2PNW A;  4E8B A;  3S15 C;  5IZN A;  1NXZ A;  2PA8 D;  1Z85 A;  2ZJR S;  2JA6 C;  3I4N C;  2G5D A;  4J3C A;  5DM7 S;  4V19 4;  1I3Q C;  3CQZ C;  4KN4 A;  4A3I C;  3HOZ C;  5GAD W;  2PIC A;  1TWA C;  3HOX C;  5IP9 C;  2PJJ A;  5GAH W;  2E2J C;  1K83 C;  4QIW D;  3S2D C;  2JA5 C;  2R93 C;  1O0C A;  4G7Z A;  5GAG W;  4WF9 S;  4BY7 C;  3S17 C;  2NVX C;  2E2H C;  4WFA S;  3K7A C;  4A3D C;  3KW2 A;  4Q4Z A;  1V6Z A;  4AYB D;  4IO9 S;  2EGV A;  4H3S A;  2L3U A;  2HZ7 A;  2PI8 A;  2Z0Y A;  4Y7N C;  4X6A C;  1DFU P;  1VHY A;  4Q5S A;  1VHK A;  5BNZ A;  3CF5 S;  5GAE W;  2AE0 X;  1O0B A;  3X1L B;  1SMY A;  4QJV A;  2CW0 A;  4WFN S;  2CX8 A;  1I6V A;  1I6H C;  4MEX A;  2KPU A;  1EUY A;  2GAE A;  1IW7 A;  2KXY A;  3DXJ A;  3M3Y C;  4MEY A;  2YU9 C;  2KQ1 A;  3WOD A;  5D4D A;  4KN7 A;  3HOU C;  4YFK A;  4XSZ A;  2ZJP S;  5IYB C;  3RZD C;  4XSX A;  2ZJQ S;  5C3E C;  4OIN A;  1QTQ A;  4OIO A;  2RE8 A;  1TWF C;  2B63 C;  1Y1V C;  1QRS A;  3PIP S;  1BDF A;  3PIO S;  5DM6 S;  4C3H C;  3I4M C;  2O5J A;  4P2B A;  4LJZ A;  1NYL A;  4BY1 C;  4L69 A;  1ZJW A;  1I50 C;  4OIP A;  1QRT A;  2PPB A;  3W2V B;  3S16 C;  4LK1 A;  1Y1W C;  5HQH A;  2NWA A;  4IOC S;  2O5I A;  4YFX A;  4LK0 A;  3H3V D;  4UY8 8;  3PO2 C;  4H4K A;  1FEU A;  2PMZ D;  1WCM C;  1TWG C;  5IP7 C;  4GZY A;  3CZB A;  3H0G C;  4C3J C;  4NOI A;  3GTK C;  3EQL A;  3PO3 C;  2JA7 C;  4YG2 A;  3HKZ D;  2VUM C; 
#chains in the Genus database with same CATH homology
 2ZJP S;  1EXD A;  1UDX A;  2ZJQ S;  5JVH S;  1D6K A;  1QTQ A;  5GAG W;  2RD2 A;  2RE8 A;  4WF9 S;  4WFA S;  1QRS A;  4U67 S;  3PIP S;  5HL7 S;  3J7Z V;  1EUQ A;  4IO9 S;  3PIO S;  4H3S A;  5DM6 S;  4JXX A;  3AII A;  2HZ7 A;  5JVG S;  4P2B A;  3W2W B;  1NYL A;  1DFU P;  1B75 A;  1ZJW A;  1GTR A;  4WCE S;  3DLL S;  1QRU A;  5BNZ A;  3CF5 S;  1O0B A;  5GAE W;  1QRT A;  3X1L B;  3W2V B;  5IZN A;  4IOA S;  2ZJR S;  4IOC S;  5DM7 S;  4WFN S;  4V19 4;  4JYZ A;  4JXZ A;  1GTS A;  4UY8 8;  4H4K A;  1FEU A;  5GAD W;  1EUY A;  5GAH W;  4WFB S;  1O0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...