2ZJRS

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
total genus 19
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjrS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjrS02
3AIIA 4IOCS 5GAGW 1QTQA 3PIOS 4WFBS 2ZJRS 1ZJWA 1FEUA 1O0BA 1D6KA 4IOAS 4JXZA 2RD2A 4WCES 4WFNS 5GADW 4P2BA 1NYLA 4IO9S 5GAEW 4H3SA 1GTSA 2ZJPS 1EUQA 2ZJQS 1GTRA 3CF5S 4WF9S 5JVHS 4UY88 2RE8A 5JVGS 5DM6S 1EUYA 5HL7S 1QRSA 4WFAS 5IZNA 1QRUA 3J7ZV 3PIPS 2HZ7A 1O0CA 5GAHW 1EXDA 1QRTA 1B75A 3DLLS 1DFUP 4JXXA 5DM7S 5BNZA 4U67S 4JYZA
chains in the Genus database with same CATH superfamily
4YG2A 2E2JC 4C2MC 5GAGW 1QTQA 4WFBS 4G7ZA 2WB1D 1ZYRA 1D6KA 2KQ1A 5IP9C 4C3JC 4Y52C 5C44C 4OINA 1SFOC 4A3GC 2PA8D 4OIOA 3W2VB 2NVTC 1GTSA 2A6HA 5GAEW 4H3SA 3HOXC 4G7OA 4LK1A 3LYWA 4BBRC 5D4DA 3CF5S 2NVYC 1Y1WC 5JVHS 2RE8A 4LJZA 3S1QC 1QRSA 1HQMA 1QRUA 2JA5C 3S15C 3HOUC 1TWCC 5TMCA 1V6ZA 3GTMC 1R9TC 4C3IC 3GTOC 4A3CC 4A3LC 2PNWA 4YFKA 3H0GC 4GZYA 1TWGC 3H3VD 2PJJA 1I50C 1UDXA 4MEYA 3S1MC 3HKZD 4OIPA 3HOZC 3HOYC 4A3MC 5BNZA 3FKIC 3I4MC 4MEXA 4IOCS 4H4KA 2R7ZC 4Q5SA 1O0BA 4J3CA 1I6VA 2Z0YA 4XLNA 2A68A 3GTJC 3I4NC 4YFNA 3GTLC 4WCES 4BBSC 5C4JC 3S2HC 5GADW 3EQLA 4E8BA 3RZOC 2E2IC 4BY1C 3S17C 2ZJPS 1I3QC 3S1NC 2JA8C 5DM6S 4A3FC 3HOWC 5HL7S 1YNJA 4KN4A 4MQ9A 2KXYA 2PICA 2PI8A 3PIPS 2G5DA 2EGVA 1VHYA 1TWAC 2BE5A 2KPUA 4KMUA 4LK0A 4A3BC 5C4XC 3GTQC 2VUMC 3DLLS 1DFUP 4JXXA 2NVXC 4U67S 4JYZA 3AIIA 2O5JA 2R92C 3KW2A 4V194 4KN7A 4JXZA 2O5IA 4G7HA 4A3IC 2Y0SD 4WFNS 5C3EC 1NYLA 4IO9S 2JA6C 5IYCC 2L3UA 3M4OC 1SMYA 4ZH4A 2ZJQS 2E2HC 3RZDC 2GAEA 3CZBA 3K7AC 5JVGS 1TWFC 5IZNA 2EGWA 3J7ZV 3S2DC 4XSZA 1O0CA 1WCMC 5GAHW 1EXDA 5IYBC 5FLMC 3S16C 1QRTA 4A93C 1B75A 2G6GA 3X1LB 1I6HC 2AE0X 1IW7A 4LLGA 4C3HC 5DM7S 1Z85A 3WODA 2NWAA 4OIRA 4JK1A 2L5NA 4NOIA 1NXZA 4BXXC 4A3JC 3PO2C 3PIOS 4XSXA 1VHKA 2ZJRS 1ZJWA 3GTPC 1FEUA 3GTGC 4A3KC 3PO3C 4AYBD 5IP7C 4IOAS 2YU9C 3HOVC 2RD2A 4QIWD 4Q4ZA 3CQZC 5HQHA 4A3EC 3S1RC 4A3DC 2R93C 4P2BA 2PPBA 3GTKC 4YFXA 1TWHC 1EUQA 1GTRA 3M3YC 4WF9S 4BY7C 4UY88 1EUYA 4Y7NC 2NVQC 1YNNA 2CW0A 3W2WB 4WFAS 5IYDC 4QJVA 2CX8A 4XLPA 3S14C 2HZ7A 2A69A 2B63C 4X6AC 3DXJA 2JA7C 5TMFA 2PMZD 4L69A 1K83C 4OIQA 1Y1VC 2A6EA 2WAQD 1BDFA
chains in the Genus database with same CATH topology
3AIIA 4IOCS 4H4KA 5GAGW 1QTQA 3PIOS 4WFBS 2ZJRS 1ZJWA 1FEUA 4V194 1O0BA 1D6KA 4IOAS 4JXZA 2RD2A 4WCES 4WFNS 3W2VB 5GADW 4P2BA 1NYLA 4IO9S 5GAEW 4H3SA 1GTSA 2ZJPS 1EUQA 2ZJQS 1GTRA 3CF5S 4WF9S 5JVHS 4UY88 2RE8A 5JVGS 5DM6S 1EUYA 5HL7S 1QRSA 3W2WB 4WFAS 5IZNA 1QRUA 3J7ZV 3PIPS 2HZ7A 1O0CA 5GAHW 1EXDA 1QRTA 1B75A 3X1LB 1UDXA 3DLLS 1DFUP 4JXXA 5DM7S 5BNZA 4U67S 4JYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AII A;  4IOC S;  5GAG W;  1QTQ A;  3PIO S;  4WFB S;  2ZJR S;  1ZJW A;  1FEU A;  1O0B A;  1D6K A;  4IOA S;  4JXZ A;  2RD2 A;  4WCE S;  4WFN S;  5GAD W;  4P2B A;  1NYL A;  4IO9 S;  5GAE W;  4H3S A;  1GTS A;  2ZJP S;  1EUQ A;  2ZJQ S;  1GTR A;  3CF5 S;  4WF9 S;  5JVH S;  4UY8 8;  2RE8 A;  5JVG S;  5DM6 S;  1EUY A;  5HL7 S;  1QRS A;  4WFA S;  5IZN A;  1QRU A;  3J7Z V;  3PIP S;  2HZ7 A;  1O0C A;  5GAH W;  1EXD A;  1QRT A;  1B75 A;  3DLL S;  1DFU P;  4JXX A;  5DM7 S;  5BNZ A;  4U67 S;  4JYZ A; 
#chains in the Genus database with same CATH topology
 4YG2 A;  2E2J C;  4C2M C;  5GAG W;  1QTQ A;  4WFB S;  4G7Z A;  2WB1 D;  1ZYR A;  1D6K A;  2KQ1 A;  5IP9 C;  4C3J C;  4Y52 C;  5C44 C;  4OIN A;  1SFO C;  4A3G C;  2PA8 D;  4OIO A;  3W2V B;  2NVT C;  1GTS A;  2A6H A;  5GAE W;  4H3S A;  3HOX C;  4G7O A;  4LK1 A;  3LYW A;  4BBR C;  5D4D A;  3CF5 S;  2NVY C;  1Y1W C;  5JVH S;  2RE8 A;  4LJZ A;  3S1Q C;  1QRS A;  1HQM A;  1QRU A;  2JA5 C;  3S15 C;  3HOU C;  1TWC C;  5TMC A;  1V6Z A;  3GTM C;  1R9T C;  4C3I C;  3GTO C;  4A3C C;  4A3L C;  2PNW A;  4YFK A;  3H0G C;  4GZY A;  1TWG C;  3H3V D;  2PJJ A;  1I50 C;  1UDX A;  4MEY A;  3S1M C;  3HKZ D;  4OIP A;  3HOZ C;  3HOY C;  4A3M C;  5BNZ A;  3FKI C;  3I4M C;  4MEX A;  4IOC S;  4H4K A;  2R7Z C;  4Q5S A;  1O0B A;  4J3C A;  1I6V A;  2Z0Y A;  4XLN A;  2A68 A;  3GTJ C;  3I4N C;  4YFN A;  3GTL C;  4WCE S;  4BBS C;  5C4J C;  3S2H C;  5GAD W;  3EQL A;  4E8B A;  3RZO C;  2E2I C;  4BY1 C;  3S17 C;  2ZJP S;  1I3Q C;  3S1N C;  2JA8 C;  5DM6 S;  4A3F C;  3HOW C;  5HL7 S;  1YNJ A;  4KN4 A;  4MQ9 A;  2KXY A;  2PIC A;  2PI8 A;  3PIP S;  2G5D A;  2EGV A;  1VHY A;  1TWA C;  2BE5 A;  2KPU A;  4KMU A;  4LK0 A;  4A3B C;  5C4X C;  3GTQ C;  2VUM C;  3DLL S;  1DFU P;  4JXX A;  2NVX C;  4U67 S;  4JYZ A;  3AII A;  2O5J A;  2R92 C;  3KW2 A;  4V19 4;  4KN7 A;  4JXZ A;  2O5I A;  4G7H A;  4A3I C;  2Y0S D;  4WFN S;  5C3E C;  1NYL A;  4IO9 S;  2JA6 C;  5IYC C;  2L3U A;  3M4O C;  1SMY A;  4ZH4 A;  2ZJQ S;  2E2H C;  3RZD C;  2GAE A;  3CZB A;  3K7A C;  5JVG S;  1TWF C;  5IZN A;  2EGW A;  3J7Z V;  3S2D C;  4XSZ A;  1O0C A;  1WCM C;  5GAH W;  1EXD A;  5IYB C;  5FLM C;  3S16 C;  1QRT A;  4A93 C;  1B75 A;  2G6G A;  3X1L B;  1I6H C;  2AE0 X;  1IW7 A;  4LLG A;  4C3H C;  5DM7 S;  1Z85 A;  3WOD A;  2NWA A;  4OIR A;  4JK1 A;  2L5N A;  4NOI A;  1NXZ A;  4BXX C;  4A3J C;  3PO2 C;  3PIO S;  4XSX A;  1VHK A;  2ZJR S;  1ZJW A;  3GTP C;  1FEU A;  3GTG C;  4A3K C;  3PO3 C;  4AYB D;  5IP7 C;  4IOA S;  2YU9 C;  3HOV C;  2RD2 A;  4QIW D;  4Q4Z A;  3CQZ C;  5HQH A;  4A3E C;  3S1R C;  4A3D C;  2R93 C;  4P2B A;  2PPB A;  3GTK C;  4YFX A;  1TWH C;  1EUQ A;  1GTR A;  3M3Y C;  4WF9 S;  4BY7 C;  4UY8 8;  1EUY A;  4Y7N C;  2NVQ C;  1YNN A;  2CW0 A;  3W2W B;  4WFA S;  5IYD C;  4QJV A;  2CX8 A;  4XLP A;  3S14 C;  2HZ7 A;  2A69 A;  2B63 C;  4X6A C;  3DXJ A;  2JA7 C;  5TMF A;  2PMZ D;  4L69 A;  1K83 C;  4OIQ A;  1Y1V C;  2A6E A;  2WAQ D;  1BDF A; 
#chains in the Genus database with same CATH homology
 3AII A;  4IOC S;  4H4K A;  5GAG W;  1QTQ A;  3PIO S;  4WFB S;  2ZJR S;  1ZJW A;  1FEU A;  4V19 4;  1O0B A;  1D6K A;  4IOA S;  4JXZ A;  2RD2 A;  4WCE S;  4WFN S;  3W2V B;  5GAD W;  4P2B A;  1NYL A;  4IO9 S;  5GAE W;  4H3S A;  1GTS A;  2ZJP S;  1EUQ A;  2ZJQ S;  1GTR A;  3CF5 S;  4WF9 S;  5JVH S;  4UY8 8;  2RE8 A;  5JVG S;  5DM6 S;  1EUY A;  5HL7 S;  1QRS A;  3W2W B;  4WFA S;  5IZN A;  1QRU A;  3J7Z V;  3PIP S;  2HZ7 A;  1O0C A;  5GAH W;  1EXD A;  1QRT A;  1B75 A;  3X1L B;  1UDX A;  3DLL S;  1DFU P;  4JXX A;  5DM7 S;  5BNZ A;  4U67 S;  4JYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...