2ZJQS

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 22
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjqS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjqS02
4WFAS 3PIOS 2RD2A 5IZNA 4U67S 2RE8A 4WFNS 5JVGS 1QTQA 1QRSA 5JVHS 2ZJQS 5GAHW 5BNZA 4WCES 4IO9S 3PIPS 4JXXA 1EXDA 5GAGW 1DFUP 1ZJWA 2HZ7A 2ZJRS 4P2BA 4JXZA 4WFBS 5GADW 4IOAS 1O0BA 1EUQA 3AIIA 3CF5S 4H3SA 3J7ZV 4UY88 4WF9S 4JYZA 1GTSA 4IOCS 1GTRA 3DLLS 5DM7S 5GAEW 1O0CA 2ZJPS 1B75A 5DM6S 1EUYA 1QRUA 1FEUA 1QRTA 1NYLA 1D6KA 5HL7S
chains in the Genus database with same CATH superfamily
1VHYA 4C2MC 2NVXC 2RE8A 1YNJA 1QTQA 2B63C 1QRSA 1WCMC 4BBSC 4MEYA 4A3CC 5TMFA 3W2WB 3PIPS 4Y52C 4BY1C 4JXXA 1EXDA 2CW0A 5GAGW 4BBRC 1ZJWA 4BY7C 2EGVA 1VHKA 2O5JA 2WAQD 4C3JC 1BDFA 1TWCC 2JA6C 2A6HA 4X6AC 4GZYA 1EUQA 4H3SA 1YNNA 1GTSA 2BE5A 2KQ1A 2WB1D 2E2HC 2PNWA 4LLGA 4KMUA 4LK0A 5DM7S 3RZDC 1Z85A 1B75A 3HOXC 2Z0YA 2CX8A 4C3HC 3K7AC 1QRTA 1UDXA 4A3JC 3GTKC 5HL7S 3H0GC 2RD2A 4MEXA 2PI8A 5IZNA 4OIQA 5JVGS 4G7HA 2NVQC 3HOWC 4A93C 4KN7A 3KW2A 5BNZA 5GAHW 2L3UA 1SMYA 2PMZD 3EQLA 1TWHC 1Y1WC 2A68A 5C3EC 3GTMC 3FKIC 4QIWD 4A3MC 3GTLC 1I6VA 3LYWA 4BXXC 2ZJRS 4C3IC 4P2BA 2A69A 2PA8D 3S1RC 4WFBS 1I6HC 2NVTC 4QJVA 3S1MC 4AYBD 2JA5C 2G6GA 4A3BC 1TWFC 3HOYC 4YFKA 4A3GC 3M3YC 3AIIA 3CF5S 4UY88 5IYDC 4OINA 3I4NC 3S1QC 4G7ZA 4Q5SA 2NVYC 3GTQC 4J3CA 3DLLS 2Y0SD 2E2IC 2A6EA 4XSXA 2JA7C 2PICA 3S2DC 2ZJPS 4OIOA 4NOIA 3S2HC 5C4XC 3S1NC 2GAEA 3S14C 4OIPA 4A3EC 1NYLA 3HKZD 2JA8C 4KN4A 2AE0X 3I4MC 4U67S 3GTPC 1TWAC 4XSZA 1R9TC 2KPUA 1SFOC 1I50C 5C4JC 2NWAA 4YG2A 2YU9C 5IP7C 4V194 1I3QC 1DFUP 3HOVC 3RZOC 4A3KC 2HZ7A 4LJZA 4JXZA 4A3DC 5GADW 5D4DA 5FLMC 5HQHA 4WF9S 4OIRA 3J7ZV 2G5DA 1Y1VC 4YFNA 4JYZA 4IOCS 2PJJA 4H4KA 1GTRA 2R92C 2VUMC 2O5IA 2EGWA 2PPBA 1HQMA 3W2VB 1O0CA 4A3IC 3H3VD 4JK1A 4MQ9A 3GTGC 4Y7NC 4IOAS 1FEUA 1D6KA 4A3LC 4WFAS 3PIOS 3DXJA 4XLPA 3S16C 3GTJC 4WFNS 4G7OA 5TMCA 5JVHS 2L5NA 2ZJQS 4XLNA 4WCES 4IO9S 2KXYA 4YFXA 1NXZA 1K83C 3S15C 4L69A 3HOUC 3S17C 1V6ZA 2R93C 3CZBA 1ZYRA 3M4OC 3X1LB 5IYBC 1O0BA 3PO2C 4A3FC 5IYCC 3CQZC 1TWGC 4LK1A 1IW7A 4ZH4A 3WODA 2R7ZC 5GAEW 3GTOC 3PO3C 5DM6S 1EUYA 1QRUA 5IP9C 4E8BA 4Q4ZA 5C44C 2E2JC 3HOZC
chains in the Genus database with same CATH topology
4WFAS 3PIOS 2RD2A 5IZNA 4U67S 2RE8A 4WFNS 5JVGS 1QTQA 1QRSA 5JVHS 2ZJQS 5GAHW 5BNZA 4WCES 4IO9S 3W2WB 3PIPS 4JXXA 1EXDA 4V194 5GAGW 1DFUP 1ZJWA 2HZ7A 2ZJRS 4P2BA 4JXZA 4WFBS 3X1LB 5GADW 4IOAS 1O0BA 1EUQA 3AIIA 3CF5S 4H3SA 3J7ZV 4UY88 4WF9S 4JYZA 1GTSA 4IOCS 4H4KA 1GTRA 3DLLS 5DM7S 5GAEW 3W2VB 1O0CA 2ZJPS 1B75A 5DM6S 1EUYA 1QRUA 1FEUA 1QRTA 1UDXA 1NYLA 1D6KA 5HL7S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFA S;  3PIO S;  2RD2 A;  5IZN A;  4U67 S;  2RE8 A;  4WFN S;  5JVG S;  1QTQ A;  1QRS A;  5JVH S;  2ZJQ S;  5GAH W;  5BNZ A;  4WCE S;  4IO9 S;  3PIP S;  4JXX A;  1EXD A;  5GAG W;  1DFU P;  1ZJW A;  2HZ7 A;  2ZJR S;  4P2B A;  4JXZ A;  4WFB S;  5GAD W;  4IOA S;  1O0B A;  1EUQ A;  3AII A;  3CF5 S;  4H3S A;  3J7Z V;  4UY8 8;  4WF9 S;  4JYZ A;  1GTS A;  4IOC S;  1GTR A;  3DLL S;  5DM7 S;  5GAE W;  1O0C A;  2ZJP S;  1B75 A;  5DM6 S;  1EUY A;  1QRU A;  1FEU A;  1QRT A;  1NYL A;  1D6K A;  5HL7 S; 
#chains in the Genus database with same CATH topology
 1VHY A;  4C2M C;  2NVX C;  2RE8 A;  1YNJ A;  1QTQ A;  2B63 C;  1QRS A;  1WCM C;  4BBS C;  4MEY A;  4A3C C;  5TMF A;  3W2W B;  3PIP S;  4Y52 C;  4BY1 C;  4JXX A;  1EXD A;  2CW0 A;  5GAG W;  4BBR C;  1ZJW A;  4BY7 C;  2EGV A;  1VHK A;  2O5J A;  2WAQ D;  4C3J C;  1BDF A;  1TWC C;  2JA6 C;  2A6H A;  4X6A C;  4GZY A;  1EUQ A;  4H3S A;  1YNN A;  1GTS A;  2BE5 A;  2KQ1 A;  2WB1 D;  2E2H C;  2PNW A;  4LLG A;  4KMU A;  4LK0 A;  5DM7 S;  3RZD C;  1Z85 A;  1B75 A;  3HOX C;  2Z0Y A;  2CX8 A;  4C3H C;  3K7A C;  1QRT A;  1UDX A;  4A3J C;  3GTK C;  5HL7 S;  3H0G C;  2RD2 A;  4MEX A;  2PI8 A;  5IZN A;  4OIQ A;  5JVG S;  4G7H A;  2NVQ C;  3HOW C;  4A93 C;  4KN7 A;  3KW2 A;  5BNZ A;  5GAH W;  2L3U A;  1SMY A;  2PMZ D;  3EQL A;  1TWH C;  1Y1W C;  2A68 A;  5C3E C;  3GTM C;  3FKI C;  4QIW D;  4A3M C;  3GTL C;  1I6V A;  3LYW A;  4BXX C;  2ZJR S;  4C3I C;  4P2B A;  2A69 A;  2PA8 D;  3S1R C;  4WFB S;  1I6H C;  2NVT C;  4QJV A;  3S1M C;  4AYB D;  2JA5 C;  2G6G A;  4A3B C;  1TWF C;  3HOY C;  4YFK A;  4A3G C;  3M3Y C;  3AII A;  3CF5 S;  4UY8 8;  5IYD C;  4OIN A;  3I4N C;  3S1Q C;  4G7Z A;  4Q5S A;  2NVY C;  3GTQ C;  4J3C A;  3DLL S;  2Y0S D;  2E2I C;  2A6E A;  4XSX A;  2JA7 C;  2PIC A;  3S2D C;  2ZJP S;  4OIO A;  4NOI A;  3S2H C;  5C4X C;  3S1N C;  2GAE A;  3S14 C;  4OIP A;  4A3E C;  1NYL A;  3HKZ D;  2JA8 C;  4KN4 A;  2AE0 X;  3I4M C;  4U67 S;  3GTP C;  1TWA C;  4XSZ A;  1R9T C;  2KPU A;  1SFO C;  1I50 C;  5C4J C;  2NWA A;  4YG2 A;  2YU9 C;  5IP7 C;  4V19 4;  1I3Q C;  1DFU P;  3HOV C;  3RZO C;  4A3K C;  2HZ7 A;  4LJZ A;  4JXZ A;  4A3D C;  5GAD W;  5D4D A;  5FLM C;  5HQH A;  4WF9 S;  4OIR A;  3J7Z V;  2G5D A;  1Y1V C;  4YFN A;  4JYZ A;  4IOC S;  2PJJ A;  4H4K A;  1GTR A;  2R92 C;  2VUM C;  2O5I A;  2EGW A;  2PPB A;  1HQM A;  3W2V B;  1O0C A;  4A3I C;  3H3V D;  4JK1 A;  4MQ9 A;  3GTG C;  4Y7N C;  4IOA S;  1FEU A;  1D6K A;  4A3L C;  4WFA S;  3PIO S;  3DXJ A;  4XLP A;  3S16 C;  3GTJ C;  4WFN S;  4G7O A;  5TMC A;  5JVH S;  2L5N A;  2ZJQ S;  4XLN A;  4WCE S;  4IO9 S;  2KXY A;  4YFX A;  1NXZ A;  1K83 C;  3S15 C;  4L69 A;  3HOU C;  3S17 C;  1V6Z A;  2R93 C;  3CZB A;  1ZYR A;  3M4O C;  3X1L B;  5IYB C;  1O0B A;  3PO2 C;  4A3F C;  5IYC C;  3CQZ C;  1TWG C;  4LK1 A;  1IW7 A;  4ZH4 A;  3WOD A;  2R7Z C;  5GAE W;  3GTO C;  3PO3 C;  5DM6 S;  1EUY A;  1QRU A;  5IP9 C;  4E8B A;  4Q4Z A;  5C44 C;  2E2J C;  3HOZ C; 
#chains in the Genus database with same CATH homology
 4WFA S;  3PIO S;  2RD2 A;  5IZN A;  4U67 S;  2RE8 A;  4WFN S;  5JVG S;  1QTQ A;  1QRS A;  5JVH S;  2ZJQ S;  5GAH W;  5BNZ A;  4WCE S;  4IO9 S;  3W2W B;  3PIP S;  4JXX A;  1EXD A;  4V19 4;  5GAG W;  1DFU P;  1ZJW A;  2HZ7 A;  2ZJR S;  4P2B A;  4JXZ A;  4WFB S;  3X1L B;  5GAD W;  4IOA S;  1O0B A;  1EUQ A;  3AII A;  3CF5 S;  4H3S A;  3J7Z V;  4UY8 8;  4WF9 S;  4JYZ A;  1GTS A;  4IOC S;  4H4K A;  1GTR A;  3DLL S;  5DM7 S;  5GAE W;  3W2V B;  1O0C A;  2ZJP S;  1B75 A;  5DM6 S;  1EUY A;  1QRU A;  1FEU A;  1QRT A;  1UDX A;  1NYL A;  1D6K A;  5HL7 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...