2ZJQS

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjqS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjqS02
1B75A 4JXZA 2RE8A 4WF9S 5GADW 3J7ZV 3PIOS 2ZJQS 4JXXA 4IOCS 1O0CA 4WFNS 2RD2A 4U67S 4WCES 5GAHW 4WFBS 1DFUP 4IO9S 1QRUA 5JVHS 4WFAS 1QRSA 2ZJRS 5IZNA 5GAEW 3CF5S 1QRTA 1FEUA 4UY88 5BNZA 1EUYA 5DM7S 4P2BA 1O0BA 1NYLA 3DLLS 1GTRA 5DM6S 5GAGW 1EXDA 1ZJWA 4H3SA 5JVGS 4IOAS 1QTQA 1D6KA 5HL7S 4JYZA 3AIIA 3PIPS 1GTSA 1EUQA 2HZ7A 2ZJPS
chains in the Genus database with same CATH superfamily
4E8BA 4LK1A 2PMZD 3J7ZV 2Y0SD 4XSXA 1TWHC 4XLPA 3W2VB 3I4NC 4GZYA 4X6AC 3KW2A 2PPBA 1I6VA 2WB1D 4OIQA 2PJJA 3GTJC 4U67S 2JA6C 4WFBS 2R92C 4KN4A 4A3MC 1QRUA 1QRTA 5GAEW 5IZNA 1I6HC 5IYDC 1O0BA 4BBSC 1NYLA 4ZH4A 3RZOC 2BE5A 1GTRA 2NVQC 5DM6S 3GTQC 4OIOA 1IW7A 4G7OA 4H3SA 4JK1A 5JVGS 3WODA 4G7HA 2EGWA 2PA8D 1VHYA 4AYBD 3HOZC 2E2JC 4XLNA 3HOUC 5TMCA 1UDXA 3S1RC 4LK0A 4A3DC 1B75A 4JXZA 2RE8A 4YFXA 1I50C 2PNWA 3FKIC 5IP9C 2NVXC 4A93C 3H3VD 1ZYRA 2WAQD 4MQ9A 4C2MC 3H0GC 3PO2C 3S16C 2RD2A 4V194 4OIPA 1V6ZA 4WCES 1DFUP 3RZDC 4IO9S 4C3HC 4WFAS 1Y1VC 4LJZA 1FEUA 2A6EA 3S14C 5IYCC 4A3JC 3HOVC 2A6HA 4Q4ZA 4BY7C 3GTLC 1TWGC 1VHKA 4QIWD 1TWCC 3GTOC 2O5JA 2EGVA 5C4XC 4A3EC 1D6KA 4G7ZA 5HL7S 2A69A 3PIPS 1YNJA 4A3KC 2ZJPS 4KN7A 1TWAC 1SFOC 3S17C 3EQLA 2CX8A 1TWFC 2L5NA 5GADW 2KXYA 4Q5SA 3W2WB 3PIOS 3CZBA 4JXXA 4KMUA 1O0CA 3GTMC 3S15C 4A3IC 4XSZA 3X1LB 5C4JC 2AE0X 2GAEA 3GTGC 5JVHS 4C3JC 2PI8A 2ZJRS 3CF5S 3HOWC 2G5DA 4YFNA 1EUYA 4P2BA 4BY1C 2JA8C 2B63C 3PO3C 4BXXC 4J3CA 3M4OC 3S1MC 1EXDA 1BDFA 4BBRC 5FLMC 1SMYA 2A68A 4Y7NC 5C3EC 3DXJA 4IOAS 4H4KA 2O5IA 3GTKC 3K7AC 2R7ZC 3S1QC 2JA7C 4Y52C 2NWAA 5TMFA 1HQMA 1EUQA 4NOIA 2Z0YA 2KQ1A 1R9TC 5IP7C 1Y1WC 4A3CC 4WF9S 5HQHA 4OIRA 2NVTC 2E2HC 2L3UA 2ZJQS 4QJVA 4A3GC 4A3BC 4IOCS 3HKZD 4WFNS 1YNNA 5GAHW 1I3QC 2E2IC 4C3IC 3GTPC 2G6GA 1K83C 2KPUA 1QRSA 4LLGA 3I4MC 3M3YC 3S2DC 1WCMC 4UY88 5C44C 3CQZC 1NXZA 5BNZA 5DM7S 4MEYA 2JA5C 4OINA 4A3LC 2NVYC 4YG2A 3HOYC 3DLLS 4A3FC 5D4DA 5GAGW 3LYWA 3HOXC 1ZJWA 2YU9C 2R93C 2CW0A 4L69A 3S1NC 1QTQA 4JYZA 4MEXA 3S2HC 4YFKA 5IYBC 3AIIA 2PICA 1GTSA 2VUMC 1Z85A 2HZ7A
chains in the Genus database with same CATH topology
1B75A 4JXZA 2RE8A 4WF9S 5GADW 3J7ZV 3W2WB 3PIOS 2ZJQS 4JXXA 3W2VB 4IOCS 1O0CA 4WFNS 2RD2A 4V194 3X1LB 4U67S 4WCES 5GAHW 4WFBS 1DFUP 4IO9S 1QRUA 5JVHS 4WFAS 1QRSA 2ZJRS 5GAEW 5IZNA 3CF5S 1QRTA 1FEUA 4UY88 5BNZA 1EUYA 5DM7S 4P2BA 1O0BA 1NYLA 3DLLS 1GTRA 5DM6S 5GAGW 1EXDA 1ZJWA 4H3SA 5JVGS 4IOAS 4H4KA 1QTQA 1D6KA 3PIPS 5HL7S 4JYZA 3AIIA 1UDXA 1GTSA 1EUQA 2HZ7A 2ZJPS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B75 A;  4JXZ A;  2RE8 A;  4WF9 S;  5GAD W;  3J7Z V;  3PIO S;  2ZJQ S;  4JXX A;  4IOC S;  1O0C A;  4WFN S;  2RD2 A;  4U67 S;  4WCE S;  5GAH W;  4WFB S;  1DFU P;  4IO9 S;  1QRU A;  5JVH S;  4WFA S;  1QRS A;  2ZJR S;  5IZN A;  5GAE W;  3CF5 S;  1QRT A;  1FEU A;  4UY8 8;  5BNZ A;  1EUY A;  5DM7 S;  4P2B A;  1O0B A;  1NYL A;  3DLL S;  1GTR A;  5DM6 S;  5GAG W;  1EXD A;  1ZJW A;  4H3S A;  5JVG S;  4IOA S;  1QTQ A;  1D6K A;  5HL7 S;  4JYZ A;  3AII A;  3PIP S;  1GTS A;  1EUQ A;  2HZ7 A;  2ZJP S; 
#chains in the Genus database with same CATH topology
 4E8B A;  4LK1 A;  2PMZ D;  3J7Z V;  2Y0S D;  4XSX A;  1TWH C;  4XLP A;  3W2V B;  3I4N C;  4GZY A;  4X6A C;  3KW2 A;  2PPB A;  1I6V A;  2WB1 D;  4OIQ A;  2PJJ A;  3GTJ C;  4U67 S;  2JA6 C;  4WFB S;  2R92 C;  4KN4 A;  4A3M C;  1QRU A;  1QRT A;  5GAE W;  5IZN A;  1I6H C;  5IYD C;  1O0B A;  4BBS C;  1NYL A;  4ZH4 A;  3RZO C;  2BE5 A;  1GTR A;  2NVQ C;  5DM6 S;  3GTQ C;  4OIO A;  1IW7 A;  4G7O A;  4H3S A;  4JK1 A;  5JVG S;  3WOD A;  4G7H A;  2EGW A;  2PA8 D;  1VHY A;  4AYB D;  3HOZ C;  2E2J C;  4XLN A;  3HOU C;  5TMC A;  1UDX A;  3S1R C;  4LK0 A;  4A3D C;  1B75 A;  4JXZ A;  2RE8 A;  4YFX A;  1I50 C;  2PNW A;  3FKI C;  5IP9 C;  2NVX C;  4A93 C;  3H3V D;  1ZYR A;  2WAQ D;  4MQ9 A;  4C2M C;  3H0G C;  3PO2 C;  3S16 C;  2RD2 A;  4V19 4;  4OIP A;  1V6Z A;  4WCE S;  1DFU P;  3RZD C;  4IO9 S;  4C3H C;  4WFA S;  1Y1V C;  4LJZ A;  1FEU A;  2A6E A;  3S14 C;  5IYC C;  4A3J C;  3HOV C;  2A6H A;  4Q4Z A;  4BY7 C;  3GTL C;  1TWG C;  1VHK A;  4QIW D;  1TWC C;  3GTO C;  2O5J A;  2EGV A;  5C4X C;  4A3E C;  1D6K A;  4G7Z A;  5HL7 S;  2A69 A;  3PIP S;  1YNJ A;  4A3K C;  2ZJP S;  4KN7 A;  1TWA C;  1SFO C;  3S17 C;  3EQL A;  2CX8 A;  1TWF C;  2L5N A;  5GAD W;  2KXY A;  4Q5S A;  3W2W B;  3PIO S;  3CZB A;  4JXX A;  4KMU A;  1O0C A;  3GTM C;  3S15 C;  4A3I C;  4XSZ A;  3X1L B;  5C4J C;  2AE0 X;  2GAE A;  3GTG C;  5JVH S;  4C3J C;  2PI8 A;  2ZJR S;  3CF5 S;  3HOW C;  2G5D A;  4YFN A;  1EUY A;  4P2B A;  4BY1 C;  2JA8 C;  2B63 C;  3PO3 C;  4BXX C;  4J3C A;  3M4O C;  3S1M C;  1EXD A;  1BDF A;  4BBR C;  5FLM C;  1SMY A;  2A68 A;  4Y7N C;  5C3E C;  3DXJ A;  4IOA S;  4H4K A;  2O5I A;  3GTK C;  3K7A C;  2R7Z C;  3S1Q C;  2JA7 C;  4Y52 C;  2NWA A;  5TMF A;  1HQM A;  1EUQ A;  4NOI A;  2Z0Y A;  2KQ1 A;  1R9T C;  5IP7 C;  1Y1W C;  4A3C C;  4WF9 S;  5HQH A;  4OIR A;  2NVT C;  2E2H C;  2L3U A;  2ZJQ S;  4QJV A;  4A3G C;  4A3B C;  4IOC S;  3HKZ D;  4WFN S;  1YNN A;  5GAH W;  1I3Q C;  2E2I C;  4C3I C;  3GTP C;  2G6G A;  1K83 C;  2KPU A;  1QRS A;  4LLG A;  3I4M C;  3M3Y C;  3S2D C;  1WCM C;  4UY8 8;  5C44 C;  3CQZ C;  1NXZ A;  5BNZ A;  5DM7 S;  4MEY A;  2JA5 C;  4OIN A;  4A3L C;  2NVY C;  4YG2 A;  3HOY C;  3DLL S;  4A3F C;  5D4D A;  5GAG W;  3LYW A;  3HOX C;  1ZJW A;  2YU9 C;  2R93 C;  2CW0 A;  4L69 A;  3S1N C;  1QTQ A;  4JYZ A;  4MEX A;  3S2H C;  4YFK A;  5IYB C;  3AII A;  2PIC A;  1GTS A;  2VUM C;  1Z85 A;  2HZ7 A; 
#chains in the Genus database with same CATH homology
 1B75 A;  4JXZ A;  2RE8 A;  4WF9 S;  5GAD W;  3J7Z V;  3W2W B;  3PIO S;  2ZJQ S;  4JXX A;  3W2V B;  4IOC S;  1O0C A;  4WFN S;  2RD2 A;  4V19 4;  3X1L B;  4U67 S;  4WCE S;  5GAH W;  4WFB S;  1DFU P;  4IO9 S;  1QRU A;  5JVH S;  4WFA S;  1QRS A;  2ZJR S;  5GAE W;  5IZN A;  3CF5 S;  1QRT A;  1FEU A;  4UY8 8;  5BNZ A;  1EUY A;  5DM7 S;  4P2B A;  1O0B A;  1NYL A;  3DLL S;  1GTR A;  5DM6 S;  5GAG W;  1EXD A;  1ZJW A;  4H3S A;  5JVG S;  4IOA S;  4H4K A;  1QTQ A;  1D6K A;  3PIP S;  5HL7 S;  4JYZ A;  3AII A;  1UDX A;  1GTS A;  1EUQ A;  2HZ7 A;  2ZJP S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...