2ZJQS

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
total genus 22
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjqS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjqS02
1QRUA 4WFBS 2ZJPS 5GAHW 4UY88 5DM7S 2ZJRS 1O0CA 1QTQA 2RD2A 4IOCS 4U67S 1NYLA 1ZJWA 3AIIA 2ZJQS 5JVHS 2HZ7A 1EXDA 1QRTA 5GADW 5HL7S 4IO9S 1DFUP 1B75A 1GTSA 4JXZA 4H3SA 4WF9S 1O0BA 4WFAS 1EUYA 4WFNS 5BNZA 4IOAS 5GAEW 3PIOS 5DM6S 4JXXA 4P2BA 1QRSA 1D6KA 2RE8A 4WCES 3CF5S 1FEUA 5IZNA 5GAGW 3DLLS 3J7ZV 1GTRA 4JYZA 1EUQA 5JVGS 3PIPS
chains in the Genus database with same CATH superfamily
3LYWA 5DM7S 2AE0X 2PJJA 1O0CA 2NVYC 3GTOC 4BBSC 3S2HC 4JK1A 4Q5SA 4BY7C 4GZYA 4A3JC 2KPUA 4KMUA 4NOIA 2E2JC 2PPBA 4LK0A 4YFNA 3S1QC 2Y0SD 4JXZA 3RZDC 3HOVC 4MEXA 4WF9S 4YFXA 3H3VD 3S14C 5D4DA 2R93C 2Z0YA 3X1LB 1WCMC 5BNZA 4IOAS 3S2DC 3GTLC 4C2MC 1Y1VC 2KQ1A 2R7ZC 2RE8A 2NWAA 3EQLA 2O5IA 2WAQD 3M3YC 4V194 5IYBC 1K83C 4A3DC 5JVGS 4MQ9A 4QJVA 1QRUA 1VHYA 3PO3C 4XLPA 3I4MC 4A3LC 1YNJA 2A68A 1R9TC 1V6ZA 2G5DA 4IOCS 2KXYA 2L3UA 1NYLA 3W2WB 1BDFA 3PO2C 3S16C 4X6AC 1TWHC 2ZJQS 3S1RC 1EXDA 1SFOC 3HOXC 2JA6C 5GADW 4G7OA 4L69A 5HL7S 5TMFA 4A3IC 2PNWA 1IW7A 3GTQC 4A3CC 4LK1A 2NVXC 1EUYA 3RZOC 2PMZD 2YU9C 2JA7C 5GAEW 3PIOS 4A3EC 5DM6S 2A6HA 2B63C 3HOUC 3CZBA 1TWCC 4C3HC 4H4KA 2CW0A 4AYBD 1FEUA 1SMYA 3WODA 5FLMC 3HOWC 3J7ZV 1ZYRA 1EUQA 2PICA 4KN7A 3K7AC 5C4JC 1Y1WC 4WFBS 1VHKA 2ZJPS 3DXJA 5GAHW 4UY88 2ZJRS 4OIOA 4C3IC 3HOYC 1QTQA 1HQMA 2G6GA 4XSXA 3CQZC 3FKIC 4KN4A 4BXXC 4U67S 3HKZD 1I6HC 1ZJWA 4YG2A 3HOZC 2HZ7A 4BY1C 1UDXA 2CX8A 1TWGC 4IO9S 2E2IC 2JA8C 3GTKC 3S17C 3GTGC 1O0BA 4WFAS 3S1NC 5IYCC 4XLNA 4JXXA 4Y52C 5C3EC 3H0GC 4LJZA 1Z85A 3CF5S 1I50C 5IZNA 4XSZA 3DLLS 4A3MC 1TWFC 1GTRA 5IYDC 4JYZA 3KW2A 2L5NA 3PIPS 2EGVA 4QIWD 3GTMC 3GTPC 1NXZA 4A3BC 3S1MC 5C4XC 2A69A 2RD2A 2E2HC 3GTJC 4OIRA 5IP7C 3AIIA 5JVHS 1QRTA 1TWAC 3M4OC 2NVQC 1YNNA 4ZH4A 4OIQA 3S15C 1DFUP 2O5JA 4J3CA 1GTSA 1B75A 2A6EA 2JA5C 5HQHA 4H3SA 4Q4ZA 4A93C 4OINA 1I6VA 4WFNS 4OIPA 5TMCA 4A3GC 4BBRC 4G7ZA 4MEYA 2WB1D 2PI8A 2BE5A 4C3JC 4A3KC 2NVTC 4P2BA 3W2VB 1D6KA 1QRSA 2VUMC 4Y7NC 3I4NC 4YFKA 4WCES 2GAEA 5IP9C 4G7HA 5GAGW 4LLGA 1I3QC 4E8BA 5C44C 2R92C 4A3FC 2PA8D 2EGWA
chains in the Genus database with same CATH topology
1QRUA 4WFBS 2ZJPS 5GAHW 4UY88 5DM7S 2ZJRS 1O0CA 1QTQA 2RD2A 4IOCS 4U67S 1NYLA 3W2WB 1ZJWA 3AIIA 2ZJQS 5JVHS 2HZ7A 1EXDA 1QRTA 5GADW 1UDXA 5HL7S 4IO9S 1DFUP 1B75A 1GTSA 4JXZA 4H3SA 4WF9S 1O0BA 4WFAS 1EUYA 4WFNS 3X1LB 5BNZA 4IOAS 5GAEW 3PIOS 5DM6S 4JXXA 4P2BA 3W2VB 1D6KA 1QRSA 2RE8A 4H4KA 4WCES 3CF5S 1FEUA 5IZNA 5GAGW 3DLLS 4V194 3J7ZV 1GTRA 4JYZA 1EUQA 5JVGS 3PIPS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRU A;  4WFB S;  2ZJP S;  5GAH W;  4UY8 8;  5DM7 S;  2ZJR S;  1O0C A;  1QTQ A;  2RD2 A;  4IOC S;  4U67 S;  1NYL A;  1ZJW A;  3AII A;  2ZJQ S;  5JVH S;  2HZ7 A;  1EXD A;  1QRT A;  5GAD W;  5HL7 S;  4IO9 S;  1DFU P;  1B75 A;  1GTS A;  4JXZ A;  4H3S A;  4WF9 S;  1O0B A;  4WFA S;  1EUY A;  4WFN S;  5BNZ A;  4IOA S;  5GAE W;  3PIO S;  5DM6 S;  4JXX A;  4P2B A;  1QRS A;  1D6K A;  2RE8 A;  4WCE S;  3CF5 S;  1FEU A;  5IZN A;  5GAG W;  3DLL S;  3J7Z V;  1GTR A;  4JYZ A;  1EUQ A;  5JVG S;  3PIP S; 
#chains in the Genus database with same CATH topology
 3LYW A;  5DM7 S;  2AE0 X;  2PJJ A;  1O0C A;  2NVY C;  3GTO C;  4BBS C;  3S2H C;  4JK1 A;  4Q5S A;  4BY7 C;  4GZY A;  4A3J C;  2KPU A;  4KMU A;  4NOI A;  2E2J C;  2PPB A;  4LK0 A;  4YFN A;  3S1Q C;  2Y0S D;  4JXZ A;  3RZD C;  3HOV C;  4MEX A;  4WF9 S;  4YFX A;  3H3V D;  3S14 C;  5D4D A;  2R93 C;  2Z0Y A;  3X1L B;  1WCM C;  5BNZ A;  4IOA S;  3S2D C;  3GTL C;  4C2M C;  1Y1V C;  2KQ1 A;  2R7Z C;  2RE8 A;  2NWA A;  3EQL A;  2O5I A;  2WAQ D;  3M3Y C;  4V19 4;  5IYB C;  1K83 C;  4A3D C;  5JVG S;  4MQ9 A;  4QJV A;  1QRU A;  1VHY A;  3PO3 C;  4XLP A;  3I4M C;  4A3L C;  1YNJ A;  2A68 A;  1R9T C;  1V6Z A;  2G5D A;  4IOC S;  2KXY A;  2L3U A;  1NYL A;  3W2W B;  1BDF A;  3PO2 C;  3S16 C;  4X6A C;  1TWH C;  2ZJQ S;  3S1R C;  1EXD A;  1SFO C;  3HOX C;  2JA6 C;  5GAD W;  4G7O A;  4L69 A;  5HL7 S;  5TMF A;  4A3I C;  2PNW A;  1IW7 A;  3GTQ C;  4A3C C;  4LK1 A;  2NVX C;  1EUY A;  3RZO C;  2PMZ D;  2YU9 C;  2JA7 C;  5GAE W;  3PIO S;  4A3E C;  5DM6 S;  2A6H A;  2B63 C;  3HOU C;  3CZB A;  1TWC C;  4C3H C;  4H4K A;  2CW0 A;  4AYB D;  1FEU A;  1SMY A;  3WOD A;  5FLM C;  3HOW C;  3J7Z V;  1ZYR A;  1EUQ A;  2PIC A;  4KN7 A;  3K7A C;  5C4J C;  1Y1W C;  4WFB S;  1VHK A;  2ZJP S;  3DXJ A;  5GAH W;  4UY8 8;  2ZJR S;  4OIO A;  4C3I C;  3HOY C;  1QTQ A;  1HQM A;  2G6G A;  4XSX A;  3CQZ C;  3FKI C;  4KN4 A;  4BXX C;  4U67 S;  3HKZ D;  1I6H C;  1ZJW A;  4YG2 A;  3HOZ C;  2HZ7 A;  4BY1 C;  1UDX A;  2CX8 A;  1TWG C;  4IO9 S;  2E2I C;  2JA8 C;  3GTK C;  3S17 C;  3GTG C;  1O0B A;  4WFA S;  3S1N C;  5IYC C;  4XLN A;  4JXX A;  4Y52 C;  5C3E C;  3H0G C;  4LJZ A;  1Z85 A;  3CF5 S;  1I50 C;  5IZN A;  4XSZ A;  3DLL S;  4A3M C;  1TWF C;  1GTR A;  5IYD C;  4JYZ A;  3KW2 A;  2L5N A;  3PIP S;  2EGV A;  4QIW D;  3GTM C;  3GTP C;  1NXZ A;  4A3B C;  3S1M C;  5C4X C;  2A69 A;  2RD2 A;  2E2H C;  3GTJ C;  4OIR A;  5IP7 C;  3AII A;  5JVH S;  1QRT A;  1TWA C;  3M4O C;  2NVQ C;  1YNN A;  4ZH4 A;  4OIQ A;  3S15 C;  1DFU P;  2O5J A;  4J3C A;  1GTS A;  1B75 A;  2A6E A;  2JA5 C;  5HQH A;  4H3S A;  4Q4Z A;  4A93 C;  4OIN A;  1I6V A;  4WFN S;  4OIP A;  5TMC A;  4A3G C;  4BBR C;  4G7Z A;  4MEY A;  2WB1 D;  2PI8 A;  2BE5 A;  4C3J C;  4A3K C;  2NVT C;  4P2B A;  3W2V B;  1D6K A;  1QRS A;  2VUM C;  4Y7N C;  3I4N C;  4YFK A;  4WCE S;  2GAE A;  5IP9 C;  4G7H A;  5GAG W;  4LLG A;  1I3Q C;  4E8B A;  5C44 C;  2R92 C;  4A3F C;  2PA8 D;  2EGW A; 
#chains in the Genus database with same CATH homology
 1QRU A;  4WFB S;  2ZJP S;  5GAH W;  4UY8 8;  5DM7 S;  2ZJR S;  1O0C A;  1QTQ A;  2RD2 A;  4IOC S;  4U67 S;  1NYL A;  3W2W B;  1ZJW A;  3AII A;  2ZJQ S;  5JVH S;  2HZ7 A;  1EXD A;  1QRT A;  5GAD W;  1UDX A;  5HL7 S;  4IO9 S;  1DFU P;  1B75 A;  1GTS A;  4JXZ A;  4H3S A;  4WF9 S;  1O0B A;  4WFA S;  1EUY A;  4WFN S;  3X1L B;  5BNZ A;  4IOA S;  5GAE W;  3PIO S;  5DM6 S;  4JXX A;  4P2B A;  3W2V B;  1D6K A;  1QRS A;  2RE8 A;  4H4K A;  4WCE S;  3CF5 S;  1FEU A;  5IZN A;  5GAG W;  3DLL S;  4V19 4;  3J7Z V;  1GTR A;  4JYZ A;  1EUQ A;  5JVG S;  3PIP S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...