2ZJQS

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 22
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjqS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjqS02
3PIOS 4IOAS 1O0CA 1ZJWA 2HZ7A 4JYZA 5HL7S 4WF9S 2ZJRS 5BNZA 5DM7S 3J7ZV 4JXXA 1NYLA 1D6KA 4P2BA 1EXDA 5DM6S 1QRTA 1B75A 3AIIA 4JXZA 1FEUA 4WCES 1QRUA 4WFBS 4IOCS 3DLLS 5JVGS 1GTSA 5IZNA 5GAEW 2RE8A 1EUQA 4WFNS 3CF5S 2ZJPS 4IO9S 4UY88 4WFAS 2RD2A 1QRSA 2ZJQS 5GADW 5GAGW 1GTRA 1EUYA 5JVHS 4U67S 5GAHW 1DFUP 4H3SA 1QTQA 1O0BA 3PIPS
chains in the Genus database with same CATH superfamily
1I50C 4LJZA 3PIOS 4IOAS 4XSXA 4YFNA 1TWAC 1VHYA 4KN7A 3RZOC 5C4XC 3DXJA 4A3JC 5BNZA 5DM7S 4V194 2NWAA 4A3CC 4JXZA 3EQLA 2VUMC 3GTPC 4BY7C 3GTOC 1TWCC 4QJVA 2NVXC 5IYDC 2KQ1A 4BBRC 4Y7NC 1GTSA 5IZNA 4A3MC 5GAEW 3GTQC 1EUQA 2B63C 2ZJPS 4WFAS 1SMYA 4QIWD 4C3HC 2WB1D 4G7HA 5D4DA 2JA6C 2ZJQS 5C4JC 3LYWA 4ZH4A 4C3JC 3PO3C 5IYBC 4BXXC 5FLMC 1R9TC 2E2JC 2O5JA 3HOYC 2NVYC 3HKZD 4XSZA 2GAEA 1O0BA 3PIPS 3FKIC 3PO2C 3HOXC 3S16C 4YFKA 2PI8A 3GTLC 3CZBA 1TWHC 1TWFC 2A6EA 3WODA 2NVTC 1NXZA 4H4KA 1EXDA 1D6KA 4YFXA 1B75A 3AIIA 1FEUA 4WCES 4A93C 4C3IC 2R92C 1V6ZA 4MQ9A 2L3UA 2E2IC 2CX8A 4IOCS 3S1QC 3S1RC 3K7AC 5JVGS 3HOUC 4AYBD 5HQHA 3I4NC 4NOIA 4XLNA 3HOZC 3H3VD 1I3QC 2KXYA 5GAGW 4YG2A 5IYCC 5C44C 4BY1C 5JVHS 4A3GC 3I4MC 2PJJA 3M3YC 3CQZC 4L69A 4G7ZA 5IP9C 4A3BC 3HOWC 1YNJA 2PICA 4MEYA 1Z85A 4A3EC 2Z0YA 2PA8D 3W2VB 5C3EC 5IP7C 5TMCA 2HZ7A 5HL7S 4C2MC 1QRTA 4P2BA 5DM6S 1UDXA 4A3KC 2PMZD 4J3CA 3GTJC 1BDFA 4E8BA 1QRUA 4Q5SA 3X1LB 4GZYA 1Y1VC 3GTKC 1TWGC 2G5DA 3RZDC 5TMFA 4IO9S 2E2HC 2WAQD 2NVQC 2AE0X 4Q4ZA 1QRSA 2A69A 3GTMC 4LLGA 1K83C 4A3DC 3S1MC 1IW7A 1WCMC 1EUYA 2EGWA 4U67S 1Y1WC 3GTGC 5GAHW 4A3LC 3S2HC 1DFUP 4H3SA 1QTQA 4OIRA 4A3IC 3H0GC 4LK0A 4A3FC 2PNWA 4XLPA 2EGVA 1O0CA 1YNNA 4OIPA 2Y0SD 1I6HC 1ZJWA 3S1NC 2YU9C 4JYZA 2PPBA 4WF9S 4KMUA 2R93C 2ZJRS 2JA5C 3J7ZV 4JXXA 2BE5A 1NYLA 4MEXA 2A68A 2JA8C 2R7ZC 3HOVC 4OIOA 4X6AC 3W2WB 2CW0A 4OIQA 3S2DC 1HQMA 4WFBS 4JK1A 4G7OA 4Y52C 3M4OC 3DLLS 4OINA 1VHKA 3S15C 4KN4A 4BBSC 2RE8A 4WFNS 3CF5S 2A6HA 4UY88 1I6VA 3KW2A 2RD2A 2O5IA 2L5NA 1ZYRA 2JA7C 5GADW 2G6GA 2KPUA 1GTRA 3S17C 3S14C 1SFOC 4LK1A
chains in the Genus database with same CATH topology
3PIOS 4IOAS 1O0CA 3W2VB 1ZJWA 2HZ7A 4JYZA 5HL7S 4WF9S 2ZJRS 4H4KA 5BNZA 5DM7S 3J7ZV 4JXXA 1NYLA 1D6KA 4P2BA 1EXDA 5DM6S 1QRTA 1UDXA 4V194 1B75A 3AIIA 3W2WB 4JXZA 4WCES 1FEUA 1QRUA 4WFBS 4IOCS 3DLLS 5JVGS 3X1LB 1GTSA 5IZNA 5GAEW 2RE8A 1EUQA 4WFNS 3CF5S 2ZJPS 4IO9S 4UY88 4WFAS 2RD2A 1QRSA 2ZJQS 5GADW 5GAGW 1GTRA 1EUYA 5JVHS 4U67S 5GAHW 1DFUP 4H3SA 1QTQA 1O0BA 3PIPS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO S;  4IOA S;  1O0C A;  1ZJW A;  2HZ7 A;  4JYZ A;  5HL7 S;  4WF9 S;  2ZJR S;  5BNZ A;  5DM7 S;  3J7Z V;  4JXX A;  1NYL A;  1D6K A;  4P2B A;  1EXD A;  5DM6 S;  1QRT A;  1B75 A;  3AII A;  4JXZ A;  1FEU A;  4WCE S;  1QRU A;  4WFB S;  4IOC S;  3DLL S;  5JVG S;  1GTS A;  5IZN A;  5GAE W;  2RE8 A;  1EUQ A;  4WFN S;  3CF5 S;  2ZJP S;  4IO9 S;  4UY8 8;  4WFA S;  2RD2 A;  1QRS A;  2ZJQ S;  5GAD W;  5GAG W;  1GTR A;  1EUY A;  5JVH S;  4U67 S;  5GAH W;  1DFU P;  4H3S A;  1QTQ A;  1O0B A;  3PIP S; 
#chains in the Genus database with same CATH topology
 1I50 C;  4LJZ A;  3PIO S;  4IOA S;  4XSX A;  4YFN A;  1TWA C;  1VHY A;  4KN7 A;  3RZO C;  5C4X C;  3DXJ A;  4A3J C;  5BNZ A;  5DM7 S;  4V19 4;  2NWA A;  4A3C C;  4JXZ A;  3EQL A;  2VUM C;  3GTP C;  4BY7 C;  3GTO C;  1TWC C;  4QJV A;  2NVX C;  5IYD C;  2KQ1 A;  4BBR C;  4Y7N C;  1GTS A;  5IZN A;  4A3M C;  5GAE W;  3GTQ C;  1EUQ A;  2B63 C;  2ZJP S;  4WFA S;  1SMY A;  4QIW D;  4C3H C;  2WB1 D;  4G7H A;  5D4D A;  2JA6 C;  2ZJQ S;  5C4J C;  3LYW A;  4ZH4 A;  4C3J C;  3PO3 C;  5IYB C;  4BXX C;  5FLM C;  1R9T C;  2E2J C;  2O5J A;  3HOY C;  2NVY C;  3HKZ D;  4XSZ A;  2GAE A;  1O0B A;  3PIP S;  3FKI C;  3PO2 C;  3HOX C;  3S16 C;  4YFK A;  2PI8 A;  3GTL C;  3CZB A;  1TWH C;  1TWF C;  2A6E A;  3WOD A;  2NVT C;  1NXZ A;  4H4K A;  1EXD A;  1D6K A;  4YFX A;  1B75 A;  3AII A;  1FEU A;  4WCE S;  4A93 C;  4C3I C;  2R92 C;  1V6Z A;  4MQ9 A;  2L3U A;  2E2I C;  2CX8 A;  4IOC S;  3S1Q C;  3S1R C;  3K7A C;  5JVG S;  3HOU C;  4AYB D;  5HQH A;  3I4N C;  4NOI A;  4XLN A;  3HOZ C;  3H3V D;  1I3Q C;  2KXY A;  5GAG W;  4YG2 A;  5IYC C;  5C44 C;  4BY1 C;  5JVH S;  4A3G C;  3I4M C;  2PJJ A;  3M3Y C;  3CQZ C;  4L69 A;  4G7Z A;  5IP9 C;  4A3B C;  3HOW C;  1YNJ A;  2PIC A;  4MEY A;  1Z85 A;  4A3E C;  2Z0Y A;  2PA8 D;  3W2V B;  5C3E C;  5IP7 C;  5TMC A;  2HZ7 A;  5HL7 S;  4C2M C;  1QRT A;  4P2B A;  5DM6 S;  1UDX A;  4A3K C;  2PMZ D;  4J3C A;  3GTJ C;  1BDF A;  4E8B A;  1QRU A;  4Q5S A;  3X1L B;  4GZY A;  1Y1V C;  3GTK C;  1TWG C;  2G5D A;  3RZD C;  5TMF A;  4IO9 S;  2E2H C;  2WAQ D;  2NVQ C;  2AE0 X;  4Q4Z A;  1QRS A;  2A69 A;  3GTM C;  4LLG A;  1K83 C;  4A3D C;  3S1M C;  1IW7 A;  1WCM C;  1EUY A;  2EGW A;  4U67 S;  1Y1W C;  3GTG C;  5GAH W;  4A3L C;  3S2H C;  1DFU P;  4H3S A;  1QTQ A;  4OIR A;  4A3I C;  3H0G C;  4LK0 A;  4A3F C;  2PNW A;  4XLP A;  2EGV A;  1O0C A;  1YNN A;  4OIP A;  2Y0S D;  1I6H C;  1ZJW A;  3S1N C;  2YU9 C;  4JYZ A;  2PPB A;  4WF9 S;  4KMU A;  2R93 C;  2ZJR S;  2JA5 C;  3J7Z V;  4JXX A;  2BE5 A;  1NYL A;  4MEX A;  2A68 A;  2JA8 C;  2R7Z C;  3HOV C;  4OIO A;  4X6A C;  3W2W B;  2CW0 A;  4OIQ A;  3S2D C;  1HQM A;  4WFB S;  4JK1 A;  4G7O A;  4Y52 C;  3M4O C;  3DLL S;  4OIN A;  1VHK A;  3S15 C;  4KN4 A;  4BBS C;  2RE8 A;  4WFN S;  3CF5 S;  2A6H A;  4UY8 8;  1I6V A;  3KW2 A;  2RD2 A;  2O5I A;  2L5N A;  1ZYR A;  2JA7 C;  5GAD W;  2G6G A;  2KPU A;  1GTR A;  3S17 C;  3S14 C;  1SFO C;  4LK1 A; 
#chains in the Genus database with same CATH homology
 3PIO S;  4IOA S;  1O0C A;  3W2V B;  1ZJW A;  2HZ7 A;  4JYZ A;  5HL7 S;  4WF9 S;  2ZJR S;  4H4K A;  5BNZ A;  5DM7 S;  3J7Z V;  4JXX A;  1NYL A;  1D6K A;  4P2B A;  1EXD A;  5DM6 S;  1QRT A;  1UDX A;  4V19 4;  1B75 A;  3AII A;  3W2W B;  4JXZ A;  4WCE S;  1FEU A;  1QRU A;  4WFB S;  4IOC S;  3DLL S;  5JVG S;  3X1L B;  1GTS A;  5IZN A;  5GAE W;  2RE8 A;  1EUQ A;  4WFN S;  3CF5 S;  2ZJP S;  4IO9 S;  4UY8 8;  4WFA S;  2RD2 A;  1QRS A;  2ZJQ S;  5GAD W;  5GAG W;  1GTR A;  1EUY A;  5JVH S;  4U67 S;  5GAH W;  1DFU P;  4H3S A;  1QTQ A;  1O0B A;  3PIP S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...