2ZJQS

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjqS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjqS02
1O0BA 4U67S 1EUQA 5JVHS 1QRTA 5GAEW 1QRUA 1B75A 1EXDA 1FEUA 4H3SA 2ZJRS 5JVGS 5DM6S 3CF5S 4JXZA 1GTSA 2HZ7A 5HL7S 5BNZA 2ZJQS 4WCES 4IO9S 1NYLA 1EUYA 1QRSA 5GADW 5GAGW 3PIOS 4UY88 1ZJWA 1QTQA 3DLLS 5DM7S 4WFAS 1O0CA 1GTRA 4JYZA 2RD2A 3AIIA 1D6KA 4P2BA 4WFBS 5GAHW 5IZNA 3PIPS 3J7ZV 1DFUP 2ZJPS 4WF9S 4IOCS 4IOAS 2RE8A 4JXXA 4WFNS
chains in the Genus database with same CATH superfamily
1SFOC 4G7OA 1QRTA 4KN4A 1QRUA 3KW2A 1B75A 2A6EA 3HOZC 4MQ9A 3GTGC 1FEUA 4X6AC 4A3GC 4NOIA 5TMFA 2ZJRS 5JVGS 3GTQC 2JA8C 1TWFC 3CF5S 2AE0X 4OIQA 4AYBD 5BNZA 1YNJA 3CQZC 1SMYA 3EQLA 1I3QC 4WCES 4IO9S 3S2HC 4LK0A 1QRSA 1YNNA 4KMUA 3DLLS 2PA8D 4OIPA 4A3CC 1Z85A 1GTRA 4A3IC 2O5JA 3AIIA 1BDFA 1D6KA 2Z0YA 3DXJA 2PMZD 3PIPS 2PPBA 2CX8A 4BY7C 1V6ZA 4J3CA 4A3FC 2ZJPS 4A3DC 4IOCS 2NWAA 4G7ZA 1I6VA 4OIRA 4A3LC 2YU9C 4L69A 1TWAC 2R93C 1O0BA 1EUQA 2A6HA 5GAEW 2PJJA 2NVYC 2Y0SD 2JA6C 4LJZA 4C3IC 2KXYA 3W2VB 4YFXA 4KN7A 2HZ7A 2CW0A 4QIWD 2ZJQS 4E8BA 2A69A 5IP9C 2WB1D 1HQMA 3W2WB 4A3EC 2NVTC 5IYBC 5GAGW 4UY88 2E2HC 1ZJWA 4LK1A 3WODA 5DM7S 4Y52C 3M3YC 4XSXA 4BBSC 4YG2A 2E2JC 4G7HA 5IYCC 2A68A 4YFKA 1DFUP 2G5DA 3HOYC 3S1MC 4WF9S 4A3JC 3S15C 2VUMC 4XLPA 4JK1A 3PO2C 4JXXA 4A3MC 4BBRC 5FLMC 4Q5SA 4U67S 4YFNA 5D4DA 1TWGC 1VHKA 4BXXC 4V194 5C4JC 1EXDA 4A3KC 1IW7A 5IP7C 4H3SA 2JA5C 3GTLC 3I4MC 5C4XC 1I50C 2R7ZC 1GTSA 5IYDC 3GTKC 5HL7S 3HKZD 3K7AC 3GTJC 3RZOC 3S14C 2KPUA 3FKIC 1VHYA 4ZH4A 1QTQA 1Y1VC 4MEXA 1I6HC 3RZDC 3H0GC 4MEYA 4JYZA 2RD2A 4A3BC 3S1NC 2GAEA 2EGWA 3I4NC 4WFBS 1NXZA 3J7ZV 3GTMC 3GTPC 3HOXC 2JA7C 4LLGA 4IOAS 4BY1C 1R9TC 2NVQC 1WCMC 4H4KA 3M4OC 3S2DC 2KQ1A 5JVHS 2PI8A 1ZYRA 5C3EC 2PICA 1TWCC 4C3HC 4Y7NC 4C3JC 3CZBA 2G6GA 2PNWA 2L5NA 5DM6S 2WAQD 2E2IC 4JXZA 3S1QC 5HQHA 4GZYA 3S16C 3HOVC 4OIOA 1NYLA 1EUYA 2B63C 2R92C 3X1LB 5GADW 3PIOS 4WFAS 1O0CA 4OINA 4Q4ZA 1Y1WC 4XLNA 2NVXC 3S1RC 1K83C 5C44C 4P2BA 3LYWA 5GAHW 5IZNA 2L3UA 3HOWC 2BE5A 4QJVA 3HOUC 4C2MC 3S17C 2EGVA 4A93C 3PO3C 5TMCA 2O5IA 3GTOC 1UDXA 4XSZA 3H3VD 2RE8A 1TWHC 4WFNS
chains in the Genus database with same CATH topology
1O0BA 4U67S 1EUQA 5JVHS 1QRTA 5GAEW 1QRUA 1B75A 4V194 1EXDA 1FEUA 4H3SA 2ZJRS 5JVGS 3W2VB 5DM6S 3CF5S 4JXZA 1GTSA 2HZ7A 5HL7S 5BNZA 2ZJQS 4WCES 4IO9S 1NYLA 3W2WB 1EUYA 1QRSA 3X1LB 5GADW 5GAGW 3PIOS 4UY88 1ZJWA 1QTQA 3DLLS 5DM7S 4WFAS 1O0CA 1GTRA 4JYZA 2RD2A 3AIIA 1D6KA 4P2BA 4WFBS 5GAHW 5IZNA 3PIPS 3J7ZV 1DFUP 2ZJPS 4WF9S 4IOCS 4IOAS 1UDXA 2RE8A 4JXXA 4WFNS 4H4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0B A;  4U67 S;  1EUQ A;  5JVH S;  1QRT A;  5GAE W;  1QRU A;  1B75 A;  1EXD A;  1FEU A;  4H3S A;  2ZJR S;  5JVG S;  5DM6 S;  3CF5 S;  4JXZ A;  1GTS A;  2HZ7 A;  5HL7 S;  5BNZ A;  2ZJQ S;  4WCE S;  4IO9 S;  1NYL A;  1EUY A;  1QRS A;  5GAD W;  5GAG W;  3PIO S;  4UY8 8;  1ZJW A;  1QTQ A;  3DLL S;  5DM7 S;  4WFA S;  1O0C A;  1GTR A;  4JYZ A;  2RD2 A;  3AII A;  1D6K A;  4P2B A;  4WFB S;  5GAH W;  5IZN A;  3PIP S;  3J7Z V;  1DFU P;  2ZJP S;  4WF9 S;  4IOC S;  4IOA S;  2RE8 A;  4JXX A;  4WFN S; 
#chains in the Genus database with same CATH topology
 1SFO C;  4G7O A;  1QRT A;  4KN4 A;  1QRU A;  3KW2 A;  1B75 A;  2A6E A;  3HOZ C;  4MQ9 A;  3GTG C;  1FEU A;  4X6A C;  4A3G C;  4NOI A;  5TMF A;  2ZJR S;  5JVG S;  3GTQ C;  2JA8 C;  1TWF C;  3CF5 S;  2AE0 X;  4OIQ A;  4AYB D;  5BNZ A;  1YNJ A;  3CQZ C;  1SMY A;  3EQL A;  1I3Q C;  4WCE S;  4IO9 S;  3S2H C;  4LK0 A;  1QRS A;  1YNN A;  4KMU A;  3DLL S;  2PA8 D;  4OIP A;  4A3C C;  1Z85 A;  1GTR A;  4A3I C;  2O5J A;  3AII A;  1BDF A;  1D6K A;  2Z0Y A;  3DXJ A;  2PMZ D;  3PIP S;  2PPB A;  2CX8 A;  4BY7 C;  1V6Z A;  4J3C A;  4A3F C;  2ZJP S;  4A3D C;  4IOC S;  2NWA A;  4G7Z A;  1I6V A;  4OIR A;  4A3L C;  2YU9 C;  4L69 A;  1TWA C;  2R93 C;  1O0B A;  1EUQ A;  2A6H A;  5GAE W;  2PJJ A;  2NVY C;  2Y0S D;  2JA6 C;  4LJZ A;  4C3I C;  2KXY A;  3W2V B;  4YFX A;  4KN7 A;  2HZ7 A;  2CW0 A;  4QIW D;  2ZJQ S;  4E8B A;  2A69 A;  5IP9 C;  2WB1 D;  1HQM A;  3W2W B;  4A3E C;  2NVT C;  5IYB C;  5GAG W;  4UY8 8;  2E2H C;  1ZJW A;  4LK1 A;  3WOD A;  5DM7 S;  4Y52 C;  3M3Y C;  4XSX A;  4BBS C;  4YG2 A;  2E2J C;  4G7H A;  5IYC C;  2A68 A;  4YFK A;  1DFU P;  2G5D A;  3HOY C;  3S1M C;  4WF9 S;  4A3J C;  3S15 C;  2VUM C;  4XLP A;  4JK1 A;  3PO2 C;  4JXX A;  4A3M C;  4BBR C;  5FLM C;  4Q5S A;  4U67 S;  4YFN A;  5D4D A;  1TWG C;  1VHK A;  4BXX C;  4V19 4;  5C4J C;  1EXD A;  4A3K C;  1IW7 A;  5IP7 C;  4H3S A;  2JA5 C;  3GTL C;  3I4M C;  5C4X C;  1I50 C;  2R7Z C;  1GTS A;  5IYD C;  3GTK C;  5HL7 S;  3HKZ D;  3K7A C;  3GTJ C;  3RZO C;  3S14 C;  2KPU A;  3FKI C;  1VHY A;  4ZH4 A;  1QTQ A;  1Y1V C;  4MEX A;  1I6H C;  3RZD C;  3H0G C;  4MEY A;  4JYZ A;  2RD2 A;  4A3B C;  3S1N C;  2GAE A;  2EGW A;  3I4N C;  4WFB S;  1NXZ A;  3J7Z V;  3GTM C;  3GTP C;  3HOX C;  2JA7 C;  4LLG A;  4IOA S;  4BY1 C;  1R9T C;  2NVQ C;  1WCM C;  4H4K A;  3M4O C;  3S2D C;  2KQ1 A;  5JVH S;  2PI8 A;  1ZYR A;  5C3E C;  2PIC A;  1TWC C;  4C3H C;  4Y7N C;  4C3J C;  3CZB A;  2G6G A;  2PNW A;  2L5N A;  5DM6 S;  2WAQ D;  2E2I C;  4JXZ A;  3S1Q C;  5HQH A;  4GZY A;  3S16 C;  3HOV C;  4OIO A;  1NYL A;  1EUY A;  2B63 C;  2R92 C;  3X1L B;  5GAD W;  3PIO S;  4WFA S;  1O0C A;  4OIN A;  4Q4Z A;  1Y1W C;  4XLN A;  2NVX C;  3S1R C;  1K83 C;  5C44 C;  4P2B A;  3LYW A;  5GAH W;  5IZN A;  2L3U A;  3HOW C;  2BE5 A;  4QJV A;  3HOU C;  4C2M C;  3S17 C;  2EGV A;  4A93 C;  3PO3 C;  5TMC A;  2O5I A;  3GTO C;  1UDX A;  4XSZ A;  3H3V D;  2RE8 A;  1TWH C;  4WFN S; 
#chains in the Genus database with same CATH homology
 1O0B A;  4U67 S;  1EUQ A;  5JVH S;  1QRT A;  5GAE W;  1QRU A;  1B75 A;  4V19 4;  1EXD A;  1FEU A;  4H3S A;  2ZJR S;  5JVG S;  3W2V B;  5DM6 S;  3CF5 S;  4JXZ A;  1GTS A;  2HZ7 A;  5HL7 S;  5BNZ A;  2ZJQ S;  4WCE S;  4IO9 S;  1NYL A;  3W2W B;  1EUY A;  1QRS A;  3X1L B;  5GAD W;  5GAG W;  3PIO S;  4UY8 8;  1ZJW A;  1QTQ A;  3DLL S;  5DM7 S;  4WFA S;  1O0C A;  1GTR A;  4JYZ A;  2RD2 A;  3AII A;  1D6K A;  4P2B A;  4WFB S;  5GAH W;  5IZN A;  3PIP S;  3J7Z V;  1DFU P;  2ZJP S;  4WF9 S;  4IOC S;  4IOA S;  1UDX A;  2RE8 A;  4JXX A;  4WFN S;  4H4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...