5IZNA

The crystal structure of 50s ribosomal protein l25 from vibrio vulnificus cmcp6
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
94
structure length
94
Chain Sequence
NAMKFEAVVRTELGKGASRRLRLAGQFPAVVYGGEAAPVAVALNHDDIVNQMDKPEFYEAITLVIGGEEVKVKPQDVQRHAFKPKVEHMDFIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L25
publication title The crystal structure of 50S ribosomal protein L25 from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus (strain cmcp6)
molecule tags Ribosomal protein
total genus 10
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01386 Ribosomal_L25p Ribosomal L25p family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 5iznA00
1NYLA 2HZ7A 5BNZA 3AIIA 3PIOS 1QTQA 5IZNA 4UY88 2ZJPS 1O0BA 4IOCS 1D6KA 1EXDA 1O0CA 4H3SA 4WCES 4WFAS 1QRUA 5GAEW 4U67S 4JXXA 2RE8A 1EUYA 2ZJRS 5JVGS 5GAHW 5GADW 1GTSA 1B75A 5DM6S 1ZJWA 1EUQA 2RD2A 1GTRA 5DM7S 5JVHS 5GAGW 1QRSA 3PIPS 4WF9S 4WFBS 1DFUP 1FEUA 2ZJQS 4WFNS 4IOAS 4JYZA 4P2BA 3CF5S 4IO9S 4JXZA 3DLLS 1QRTA 3J7ZV 5HL7S
chains in the Genus database with same CATH superfamily
2HZ7A 4H4KA 1QTQA 5IZNA 3W2WB 4JXXA 3KW2A 1EUYA 5JVGS 1EUQA 1QRSA 3PIPS 2PJJA 4J3CA 4IOAS 4JXZA 1VHYA 5BNZA 4V194 2G6GA 3CZBA 4IOCS 2PNWA 4H3SA 3X1LB 1QRUA 2PICA 5GAHW 1ZJWA 1VHKA 2AE0X 2PI8A 1UDXA 4L69A 4WFBS 2Z0YA 1QRTA 1NXZA 5HL7S 1NYLA 3AIIA 3PIOS 4UY88 2EGVA 1O0CA 5GAEW 4U67S 2RE8A 2G5DA 3W2VB 1B75A 5DM6S 2RD2A 1GTRA 5JVHS 4WF9S 2ZJQS 4WFNS 4JYZA 4P2BA 4IO9S 3J7ZV 2ZJPS 1O0BA 1D6KA 1EXDA 4WCES 4WFAS 2CX8A 2ZJRS 4E8BA 2GAEA 2EGWA 5GADW 1GTSA 1Z85A 2NWAA 5DM7S 5GAGW 1V6ZA 1DFUP 1FEUA 3CF5S 3DLLS
chains in the Genus database with same CATH topology
1NYLA 2HZ7A 4H4KA 5BNZA 3AIIA 3PIOS 1QTQA 5IZNA 4V194 4UY88 2ZJPS 1O0BA 4IOCS 1D6KA 1EXDA 1O0CA 4H3SA 4WCES 3X1LB 4WFAS 1QRUA 3W2WB 5GAEW 4U67S 4JXXA 2RE8A 3W2VB 1EUYA 2ZJRS 5JVGS 5GAHW 5GADW 1GTSA 1B75A 5DM6S 1ZJWA 1EUQA 2RD2A 1GTRA 5DM7S 5JVHS 5GAGW 1QRSA 3PIPS 4WF9S 1UDXA 4WFBS 1DFUP 1FEUA 2ZJQS 4WFNS 4IOAS 4JYZA 4P2BA 3CF5S 4IO9S 4JXZA 3DLLS 1QRTA 3J7ZV 5HL7S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYL A;  2HZ7 A;  5BNZ A;  3AII A;  3PIO S;  1QTQ A;  5IZN A;  4UY8 8;  2ZJP S;  1O0B A;  4IOC S;  1D6K A;  1EXD A;  1O0C A;  4H3S A;  4WCE S;  4WFA S;  1QRU A;  5GAE W;  4U67 S;  4JXX A;  2RE8 A;  1EUY A;  2ZJR S;  5JVG S;  5GAH W;  5GAD W;  1GTS A;  1B75 A;  5DM6 S;  1ZJW A;  1EUQ A;  2RD2 A;  1GTR A;  5DM7 S;  5JVH S;  5GAG W;  1QRS A;  3PIP S;  4WF9 S;  4WFB S;  1DFU P;  1FEU A;  2ZJQ S;  4WFN S;  4IOA S;  4JYZ A;  4P2B A;  3CF5 S;  4IO9 S;  4JXZ A;  3DLL S;  1QRT A;  3J7Z V;  5HL7 S; 
#chains in the Genus database with same CATH topology
 2HZ7 A;  4H4K A;  1QTQ A;  5IZN A;  3W2W B;  4JXX A;  3KW2 A;  1EUY A;  5JVG S;  1EUQ A;  1QRS A;  3PIP S;  2PJJ A;  4J3C A;  4IOA S;  4JXZ A;  1VHY A;  5BNZ A;  4V19 4;  2G6G A;  3CZB A;  4IOC S;  2PNW A;  4H3S A;  3X1L B;  1QRU A;  2PIC A;  5GAH W;  1ZJW A;  1VHK A;  2AE0 X;  2PI8 A;  1UDX A;  4L69 A;  4WFB S;  2Z0Y A;  1QRT A;  1NXZ A;  5HL7 S;  1NYL A;  3AII A;  3PIO S;  4UY8 8;  2EGV A;  1O0C A;  5GAE W;  4U67 S;  2RE8 A;  2G5D A;  3W2V B;  1B75 A;  5DM6 S;  2RD2 A;  1GTR A;  5JVH S;  4WF9 S;  2ZJQ S;  4WFN S;  4JYZ A;  4P2B A;  4IO9 S;  3J7Z V;  2ZJP S;  1O0B A;  1D6K A;  1EXD A;  4WCE S;  4WFA S;  2CX8 A;  2ZJR S;  4E8B A;  2GAE A;  2EGW A;  5GAD W;  1GTS A;  1Z85 A;  2NWA A;  5DM7 S;  5GAG W;  1V6Z A;  1DFU P;  1FEU A;  3CF5 S;  3DLL S; 
#chains in the Genus database with same CATH homology
 1NYL A;  2HZ7 A;  4H4K A;  5BNZ A;  3AII A;  3PIO S;  1QTQ A;  5IZN A;  4V19 4;  4UY8 8;  2ZJP S;  1O0B A;  4IOC S;  1D6K A;  1EXD A;  1O0C A;  4H3S A;  4WCE S;  3X1L B;  4WFA S;  1QRU A;  3W2W B;  5GAE W;  4U67 S;  4JXX A;  2RE8 A;  3W2V B;  1EUY A;  2ZJR S;  5JVG S;  5GAH W;  5GAD W;  1GTS A;  1B75 A;  5DM6 S;  1ZJW A;  1EUQ A;  2RD2 A;  1GTR A;  5DM7 S;  5JVH S;  5GAG W;  1QRS A;  3PIP S;  4WF9 S;  1UDX A;  4WFB S;  1DFU P;  1FEU A;  2ZJQ S;  4WFN S;  4IOA S;  4JYZ A;  4P2B A;  3CF5 S;  4IO9 S;  4JXZ A;  3DLL S;  1QRT A;  3J7Z V;  5HL7 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...