1GU8A

Sensory rhodopsin ii
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
218
structure length
218
Chain Sequence
VGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords SENSORY RHODOPSIN II
publication title Early Structural Rearrangements in the Photocycle of an Integral Membrane Sensory Receptor
pubmed doi rcsb
source organism Natronomonas pharaonis
total genus 91
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2002-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01036 Bac_rhodopsin Bacteriorhodopsin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 1gu8A00
3MBVA 4OV0A 3PBLA 1BRRA 1QHJA 1KGBA 3EMLA 5BR5A 5B34A 2QPEB 3PDSA 3A7KA 3OE8A 2ZFEA 5KKHA 1GU8A 4MQTA 1GZMA 4LDLA 3HARA 3PXOA 4FA7B 5H2IA 3EH4B 1S8LA 5AX1A 1X0I1 1O0AA 3AM6A 2Y02A 4JR8A 3QJQB 5G2CA 3S3DB 1QKPA 2LNLA 3PWHA 5ETZA 3VGAA 5B2NA 4L35A 1PY6A 2HPYA 1BRXA 3HASA 4X1HA 5ITEA 1JGJA 3QBIA 4GP5B 3QDCA 1TN0A 1PXRA 3OE9A 2Y00A 1P8HA 2YCWA 4EJ4A 3EH3B 3PQRA 3UG9A 4G7RB 4IAQA 4GYCA 5H2HA 1L9HA 5JJJA 4LDOA 4GP8B 5B6WA 1LN6A 4G72B 3NSBA 1CWQA 1KMEA 1GUEA 5AWZA 4G7QB 5DHHA 3VW7A 1MGYA 5AHYA 1IW9A 3ODUA 2WJLA 2AT9A 4KLYA 4PXKA 3RZEA 1E0PA 4N6HA 1C3WA 4AMIA 3VHZA 3D4SA 3WQJA 4N4WA 3DDLA 2J4YA 1BM1A 1S8JA 5G54A 3BVDB 3REYA 1Q5JA 4QRYA 4GRVA 4LDEA 3QJSB 5H2LA 2NTUA 4HYXA 2F93A 4IB4A 3QBLA 1X0K1 3UTXA 1XIOA 3ABWA 1C8RA 1FBBA 1QKOA 4A4MA 4GBRA 5G53A 5H2OA 1DZEA 1H2SA 3S8GB 4G70B 3NYAA 1BRDA 1KG8A 4UG2A 4BWBA 1S51A 3ZPRA 4FBZA 1L0MA 4XTLA 4UHRA 3UTVA 4J4QA 1EHKB 5AHZA 1AP9A 3DQBA 1AT9A 2R4RA 2KSYA 4KNFA 5F8UA 4Y9HA 2YDVA 1P8UA 4BEYA 3CODA 1F88A 3HAPA 3UTWA 4L6RA 3OE6A 1IW6A 2I35A 3VVKA 4BUOA 2I21A 3HAOA 3QBGA 3HANA 2Y03A 5ITCA 2YCYA 3OE0A 2RH1A 3COCA 2YDOA 4NC3A 3AYMA 3QBKA 2YCXA 5JJEA 4HWLA 3T45A 1QM8A 1HZXA 2KS9A 4DJHA 1UAZA 3QAPA 3UZCA 1JV6A 2R4SA 5B6XA 4GP4B 4DKLA 4FPDA 5EN0A 4K5YA 2KSBA 5BR2A 2Y01A 3AYNA 3VG9A 3ZPQA 1S52A 1PXSA 5DYSA 3UONA 4G7SB 1TN5A 3P0GA 1F4ZA 3KJ6A 4XTOA 1S53A 1XMEB 4N4YB 5B6YA 5FJGA 2NTWA 4BVNA 3QJRB 5B6VA 2X72A 1KG9A 1H68A 5H2NA 4XT3A 5AZDA 1JFPA 4BV0A 3X3CA 3NS0A 3SN6R 3RFMA 2BRDA 3S3BB 1E12A 3QJVB 3S3CB 3HAQA 5G2DA 4X31A 4QI1A 3CAPA 1R2NA 1F50A 5DHGA 1M0LA 4BEZA 5JJNA 4X32A 3NY9A 5G36A 5J7AA 1U19A 2WJKA 2VT4A 2Z73A 4EIYA 3ZEVA 2L6XA 1VGOA 4IARA 5G28A 4EA3A 2EI4A 3X3BA 5C1MA 2ZIYA 1M0KA 1IXFA 1P8IA 4TL3A 4WAVA 4MD2A 5H2MA 1UCQA 5A8EA 3QJUB 1FBKA 3UZAA 4G71B 2F95A 4AMJA 5B6ZA 4GPOA 5A45A 5TGZA 5B35A 2KSAA 3EH5B 2YCZA 1Q5IA 3C9MA 5B0WA 4FAAB 1M0MA 2Z55A 4XTNA 1XJIA 3QJTB 5H2KA 4JQ6A 1VJMA 1C8SA 3QAKA 2G87A 5G2AA 4JKVA 4QIDA 3C9LA 4XXJA 2ZZLA 5H2PA 4WW3A 5A44A 1S54A 3NY8A 3V2YA 5AX0A 2QPDB 4HYJA 1JV7A 2JAGA 2I20A 1X0SA 2Y04A 2M3GA 4MQSA 4XT1A 1R84A 3OAXA 4MBSA 3UTYA 3S8FB 5H2JA 5LWEA 4DAJA 3VI0A 4PXFA 2JAFA 3V2WA 2I1XA 2PEDA 4MD1A
chains in the Genus database with same CATH superfamily
3MBVA 4OV0A 3PBLA 1BRRA 1QHJA 1KGBA 3EMLA 5BR5A 5B34A 2QPEB 3PDSA 3A7KA 3OE8A 2ZFEA 5KKHA 1GU8A 4MQTA 1GZMA 4LDLA 3HARA 3PXOA 4FA7B 5H2IA 3EH4B 1S8LA 5AX1A 1X0I1 1O0AA 3AM6A 2Y02A 4JR8A 3QJQB 5G2CA 3S3DB 1QKPA 2LNLA 3PWHA 5ETZA 3VGAA 5B2NA 4L35A 1PY6A 2HPYA 1BRXA 3HASA 4X1HA 5ITEA 1JGJA 3QBIA 4GP5B 3QDCA 1TN0A 1PXRA 3OE9A 2Y00A 1P8HA 2YCWA 4EJ4A 3EH3B 3PQRA 3UG9A 4G7RB 4IAQA 4GYCA 5H2HA 1L9HA 5JJJA 4LDOA 4GP8B 5B6WA 1LN6A 4G72B 3NSBA 1CWQA 1KMEA 1GUEA 5AWZA 4G7QB 5DHHA 3VW7A 1MGYA 5AHYA 1IW9A 3ODUA 2WJLA 2AT9A 4KLYA 4PXKA 3RZEA 1E0PA 4N6HA 1C3WA 4AMIA 3VHZA 3D4SA 3WQJA 4N4WA 3DDLA 2J4YA 1BM1A 1S8JA 5G54A 3BVDB 3REYA 1Q5JA 4QRYA 4GRVA 4LDEA 3QJSB 5H2LA 2NTUA 4HYXA 2F93A 4IB4A 3QBLA 1X0K1 3UTXA 1XIOA 3ABWA 1C8RA 1FBBA 1QKOA 4A4MA 4GBRA 5G53A 5H2OA 1DZEA 1H2SA 3S8GB 4G70B 3NYAA 1BRDA 1KG8A 4UG2A 4DS7E 4BWBA 1S51A 3ZPRA 4FBZA 1L0MA 4XTLA 4UHRA 3UTVA 4J4QA 1EHKB 5AHZA 1AP9A 3DQBA 1AT9A 2R4RA 2KSYA 4KNFA 5F8UA 4Y9HA 2YDVA 1P8UA 4BEYA 3CODA 1F88A 3HAPA 3UTWA 4L6RA 3OE6A 1IW6A 2I35A 3VVKA 4BUOA 2I21A 3HAOA 3QBGA 3HANA 2Y03A 5ITCA 2YCYA 3OE0A 2RH1A 3COCA 2YDOA 4NC3A 3AYMA 3QBKA 2YCXA 5JJEA 4HWLA 3T45A 1QM8A 1HZXA 2KS9A 4DJHA 1UAZA 3QAPA 3UZCA 1JV6A 2R4SA 5B6XA 4GP4B 4DKLA 4FPDA 5EN0A 4K5YA 2KSBA 5BR2A 2Y01A 3AYNA 3VG9A 3ZPQA 1S52A 1PXSA 5DYSA 3UONA 4G7SB 1TN5A 3P0GA 1F4ZA 3KJ6A 4XTOA 1S53A 1XMEB 4N4YB 5B6YA 5FJGA 2NTWA 4BVNA 3QJRB 5B6VA 2X72A 1KG9A 1H68A 5H2NA 4XT3A 5AZDA 1JFPA 4BV0A 3X3CA 3NS0A 3SN6R 3RFMA 2BRDA 3S3BB 1E12A 3QJVB 3S3CB 3HAQA 5G2DA 4X31A 4QI1A 3CAPA 1R2NA 1F50A 5DHGA 1M0LA 4BEZA 5JJNA 4X32A 3NY9A 5G36A 5J7AA 1U19A 2WJKA 2VT4A 2Z73A 4EIYA 3ZEVA 2L6XA 1VGOA 4IARA 5G28A 4EA3A 2EI4A 3X3BA 5C1MA 2ZIYA 1M0KA 1IXFA 1P8IA 4TL3A 4WAVA 4MD2A 5H2MA 1UCQA 5A8EA 3QJUB 1FBKA 3UZAA 4G71B 2F95A 4AMJA 5B6ZA 4GPOA 5A45A 5TGZA 5B35A 2KSAA 3EH5B 2YCZA 1Q5IA 3C9MA 5B0WA 4FAAB 1M0MA 2Z55A 4XTNA 1XJIA 3QJTB 5H2KA 4JQ6A 1VJMA 1C8SA 3QAKA 2G87A 5G2AA 4JKVA 4QIDA 3C9LA 4XXJA 2ZZLA 5H2PA 4WW3A 5A44A 1S54A 3NY8A 3V2YA 5AX0A 2QPDB 4HYJA 1JV7A 2JAGA 2I20A 1X0SA 2Y04A 2M3GA 4MQSA 4XT1A 1R84A 3OAXA 4MBSA 3UTYA 3S8FB 5H2JA 5LWEA 4DAJA 3VI0A 4PXFA 2JAFA 3V2WA 2I1XA 2PEDA 4MD1A
chains in the Genus database with same CATH topology
3MBVA 4OV0A 3PBLA 1BRRA 1QHJA 1KGBA 3EMLA 5BR5A 5B34A 2QPEB 3PDSA 3A7KA 3OE8A 2ZFEA 5KKHA 1GU8A 4MQTA 1GZMA 4LDLA 3HARA 3PXOA 4FA7B 5H2IA 3EH4B 1S8LA 5AX1A 1X0I1 1O0AA 3AM6A 2Y02A 4JR8A 3QJQB 5G2CA 3S3DB 1QKPA 2LNLA 3PWHA 5ETZA 3VGAA 5B2NA 4L35A 1PY6A 2HPYA 1BRXA 3HASA 4X1HA 5ITEA 1JGJA 3QBIA 4GP5B 3QDCA 1TN0A 1PXRA 3OE9A 2Y00A 1P8HA 2YCWA 4EJ4A 3EH3B 3PQRA 3UG9A 4G7RB 4IAQA 4GYCA 5H2HA 1L9HA 5JJJA 4LDOA 4GP8B 5B6WA 1LN6A 4G72B 3NSBA 1CWQA 1KMEA 1GUEA 5AWZA 4G7QB 5DHHA 3VW7A 1MGYA 5AHYA 1IW9A 3ODUA 2WJLA 2AT9A 4KLYA 4PXKA 3RZEA 1E0PA 4N6HA 1C3WA 4AMIA 3VHZA 3D4SA 3WQJA 4N4WA 3DDLA 2J4YA 1BM1A 1S8JA 5G54A 3BVDB 3REYA 1Q5JA 4QRYA 4GRVA 4LDEA 3QJSB 5H2LA 2NTUA 4HYXA 2F93A 4IB4A 3QBLA 1X0K1 3UTXA 1XIOA 3ABWA 1C8RA 1FBBA 1QKOA 4A4MA 4GBRA 5G53A 5H2OA 1DZEA 1H2SA 3S8GB 4G70B 3NYAA 1BRDA 1KG8A 4UG2A 4DS7E 4BWBA 1S51A 3ZPRA 4FBZA 1L0MA 4XTLA 4UHRA 3UTVA 4J4QA 1EHKB 5AHZA 1AP9A 3DQBA 1AT9A 2R4RA 2KSYA 4KNFA 5F8UA 4Y9HA 2YDVA 1P8UA 4BEYA 3CODA 1F88A 3HAPA 3UTWA 4L6RA 3OE6A 1IW6A 2I35A 3VVKA 4BUOA 2I21A 3HAOA 3QBGA 3HANA 2Y03A 5ITCA 2YCYA 3OE0A 2RH1A 3COCA 2YDOA 4NC3A 3AYMA 3QBKA 2YCXA 5JJEA 4HWLA 3T45A 1QM8A 1HZXA 2KS9A 4DJHA 1UAZA 3QAPA 3UZCA 1JV6A 2R4SA 5B6XA 4GP4B 4DKLA 4FPDA 5EN0A 4K5YA 2KSBA 5BR2A 2Y01A 3AYNA 3VG9A 3ZPQA 1S52A 1PXSA 5DYSA 3UONA 4G7SB 1TN5A 3P0GA 1F4ZA 3KJ6A 4XTOA 1S53A 1XMEB 4N4YB 5B6YA 5FJGA 2NTWA 4BVNA 3QJRB 5B6VA 2X72A 1KG9A 1H68A 5H2NA 4XT3A 5AZDA 1JFPA 4BV0A 3X3CA 3NS0A 3SN6R 3RFMA 2BRDA 3S3BB 1E12A 3QJVB 3S3CB 3HAQA 5G2DA 4X31A 4QI1A 3CAPA 1R2NA 1F50A 5DHGA 1M0LA 4BEZA 5JJNA 4X32A 3NY9A 5G36A 5J7AA 1U19A 2WJKA 2VT4A 2Z73A 4EIYA 3ZEVA 2L6XA 1VGOA 4IARA 5G28A 4EA3A 2EI4A 3X3BA 5C1MA 2ZIYA 1M0KA 1IXFA 1P8IA 4TL3A 4WAVA 4MD2A 5H2MA 1UCQA 5A8EA 3QJUB 1FBKA 3UZAA 4G71B 2F95A 4AMJA 5B6ZA 4GPOA 5A45A 5TGZA 5B35A 2KSAA 3EH5B 2YCZA 1Q5IA 3C9MA 5B0WA 4FAAB 1M0MA 2Z55A 4XTNA 1XJIA 3QJTB 5H2KA 4JQ6A 1VJMA 1C8SA 3QAKA 2G87A 5G2AA 4JKVA 4QIDA 3C9LA 4XXJA 2ZZLA 5H2PA 4WW3A 5A44A 1S54A 3NY8A 3V2YA 5AX0A 2QPDB 4HYJA 1JV7A 2JAGA 2I20A 1X0SA 2Y04A 2M3GA 4MQSA 4XT1A 1R84A 3OAXA 4MBSA 3UTYA 3S8FB 5H2JA 5LWEA 4DAJA 3VI0A 4PXFA 2JAFA 3V2WA 2I1XA 2PEDA 4MD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBV A;  4OV0 A;  3PBL A;  1BRR A;  1QHJ A;  1KGB A;  3EML A;  5BR5 A;  5B34 A;  2QPE B;  3PDS A;  3A7K A;  3OE8 A;  2ZFE A;  5KKH A;  1GU8 A;  4MQT A;  1GZM A;  4LDL A;  3HAR A;  3PXO A;  4FA7 B;  5H2I A;  3EH4 B;  1S8L A;  5AX1 A;  1X0I 1;  1O0A A;  3AM6 A;  2Y02 A;  4JR8 A;  3QJQ B;  5G2C A;  3S3D B;  1QKP A;  2LNL A;  3PWH A;  5ETZ A;  3VGA A;  5B2N A;  4L35 A;  1PY6 A;  2HPY A;  1BRX A;  3HAS A;  4X1H A;  5ITE A;  1JGJ A;  3QBI A;  4GP5 B;  3QDC A;  1TN0 A;  1PXR A;  3OE9 A;  2Y00 A;  1P8H A;  2YCW A;  4EJ4 A;  3EH3 B;  3PQR A;  3UG9 A;  4G7R B;  4IAQ A;  4GYC A;  5H2H A;  1L9H A;  5JJJ A;  4LDO A;  4GP8 B;  5B6W A;  1LN6 A;  4G72 B;  3NSB A;  1CWQ A;  1KME A;  1GUE A;  5AWZ A;  4G7Q B;  5DHH A;  3VW7 A;  1MGY A;  5AHY A;  1IW9 A;  3ODU A;  2WJL A;  2AT9 A;  4KLY A;  4PXK A;  3RZE A;  1E0P A;  4N6H A;  1C3W A;  4AMI A;  3VHZ A;  3D4S A;  3WQJ A;  4N4W A;  3DDL A;  2J4Y A;  1BM1 A;  1S8J A;  5G54 A;  3BVD B;  3REY A;  1Q5J A;  4QRY A;  4GRV A;  4LDE A;  3QJS B;  5H2L A;  2NTU A;  4HYX A;  2F93 A;  4IB4 A;  3QBL A;  1X0K 1;  3UTX A;  1XIO A;  3ABW A;  1C8R A;  1FBB A;  1QKO A;  4A4M A;  4GBR A;  5G53 A;  5H2O A;  1DZE A;  1H2S A;  3S8G B;  4G70 B;  3NYA A;  1BRD A;  1KG8 A;  4UG2 A;  4BWB A;  1S51 A;  3ZPR A;  4FBZ A;  1L0M A;  4XTL A;  4UHR A;  3UTV A;  4J4Q A;  1EHK B;  5AHZ A;  1AP9 A;  3DQB A;  1AT9 A;  2R4R A;  2KSY A;  4KNF A;  5F8U A;  4Y9H A;  2YDV A;  1P8U A;  4BEY A;  3COD A;  1F88 A;  3HAP A;  3UTW A;  4L6R A;  3OE6 A;  1IW6 A;  2I35 A;  3VVK A;  4BUO A;  2I21 A;  3HAO A;  3QBG A;  3HAN A;  2Y03 A;  5ITC A;  2YCY A;  3OE0 A;  2RH1 A;  3COC A;  2YDO A;  4NC3 A;  3AYM A;  3QBK A;  2YCX A;  5JJE A;  4HWL A;  3T45 A;  1QM8 A;  1HZX A;  2KS9 A;  4DJH A;  1UAZ A;  3QAP A;  3UZC A;  1JV6 A;  2R4S A;  5B6X A;  4GP4 B;  4DKL A;  4FPD A;  5EN0 A;  4K5Y A;  2KSB A;  5BR2 A;  2Y01 A;  3AYN A;  3VG9 A;  3ZPQ A;  1S52 A;  1PXS A;  5DYS A;  3UON A;  4G7S B;  1TN5 A;  3P0G A;  1F4Z A;  3KJ6 A;  4XTO A;  1S53 A;  1XME B;  4N4Y B;  5B6Y A;  5FJG A;  2NTW A;  4BVN A;  3QJR B;  5B6V A;  2X72 A;  1KG9 A;  1H68 A;  5H2N A;  4XT3 A;  5AZD A;  1JFP A;  4BV0 A;  3X3C A;  3NS0 A;  3SN6 R;  3RFM A;  2BRD A;  3S3B B;  1E12 A;  3QJV B;  3S3C B;  3HAQ A;  5G2D A;  4X31 A;  4QI1 A;  3CAP A;  1R2N A;  1F50 A;  5DHG A;  1M0L A;  4BEZ A;  5JJN A;  4X32 A;  3NY9 A;  5G36 A;  5J7A A;  1U19 A;  2WJK A;  2VT4 A;  2Z73 A;  4EIY A;  3ZEV A;  2L6X A;  1VGO A;  4IAR A;  5G28 A;  4EA3 A;  2EI4 A;  3X3B A;  5C1M A;  2ZIY A;  1M0K A;  1IXF A;  1P8I A;  4TL3 A;  4WAV A;  4MD2 A;  5H2M A;  1UCQ A;  5A8E A;  3QJU B;  1FBK A;  3UZA A;  4G71 B;  2F95 A;  4AMJ A;  5B6Z A;  4GPO A;  5A45 A;  5TGZ A;  5B35 A;  2KSA A;  3EH5 B;  2YCZ A;  1Q5I A;  3C9M A;  5B0W A;  4FAA B;  1M0M A;  2Z55 A;  4XTN A;  1XJI A;  3QJT B;  5H2K A;  4JQ6 A;  1VJM A;  1C8S A;  3QAK A;  2G87 A;  5G2A A;  4JKV A;  4QID A;  3C9L A;  4XXJ A;  2ZZL A;  5H2P A;  4WW3 A;  5A44 A;  1S54 A;  3NY8 A;  3V2Y A;  5AX0 A;  2QPD B;  4HYJ A;  1JV7 A;  2JAG A;  2I20 A;  1X0S A;  2Y04 A;  2M3G A;  4MQS A;  4XT1 A;  1R84 A;  3OAX A;  4MBS A;  3UTY A;  3S8F B;  5H2J A;  5LWE A;  4DAJ A;  3VI0 A;  4PXF A;  2JAF A;  3V2W A;  2I1X A;  2PED A;  4MD1 A; 
#chains in the Genus database with same CATH topology
 3MBV A;  4OV0 A;  3PBL A;  1BRR A;  1QHJ A;  1KGB A;  3EML A;  5BR5 A;  5B34 A;  2QPE B;  3PDS A;  3A7K A;  3OE8 A;  2ZFE A;  5KKH A;  1GU8 A;  4MQT A;  1GZM A;  4LDL A;  3HAR A;  3PXO A;  4FA7 B;  5H2I A;  3EH4 B;  1S8L A;  5AX1 A;  1X0I 1;  1O0A A;  3AM6 A;  2Y02 A;  4JR8 A;  3QJQ B;  5G2C A;  3S3D B;  1QKP A;  2LNL A;  3PWH A;  5ETZ A;  3VGA A;  5B2N A;  4L35 A;  1PY6 A;  2HPY A;  1BRX A;  3HAS A;  4X1H A;  5ITE A;  1JGJ A;  3QBI A;  4GP5 B;  3QDC A;  1TN0 A;  1PXR A;  3OE9 A;  2Y00 A;  1P8H A;  2YCW A;  4EJ4 A;  3EH3 B;  3PQR A;  3UG9 A;  4G7R B;  4IAQ A;  4GYC A;  5H2H A;  1L9H A;  5JJJ A;  4LDO A;  4GP8 B;  5B6W A;  1LN6 A;  4G72 B;  3NSB A;  1CWQ A;  1KME A;  1GUE A;  5AWZ A;  4G7Q B;  5DHH A;  3VW7 A;  1MGY A;  5AHY A;  1IW9 A;  3ODU A;  2WJL A;  2AT9 A;  4KLY A;  4PXK A;  3RZE A;  1E0P A;  4N6H A;  1C3W A;  4AMI A;  3VHZ A;  3D4S A;  3WQJ A;  4N4W A;  3DDL A;  2J4Y A;  1BM1 A;  1S8J A;  5G54 A;  3BVD B;  3REY A;  1Q5J A;  4QRY A;  4GRV A;  4LDE A;  3QJS B;  5H2L A;  2NTU A;  4HYX A;  2F93 A;  4IB4 A;  3QBL A;  1X0K 1;  3UTX A;  1XIO A;  3ABW A;  1C8R A;  1FBB A;  1QKO A;  4A4M A;  4GBR A;  5G53 A;  5H2O A;  1DZE A;  1H2S A;  3S8G B;  4G70 B;  3NYA A;  1BRD A;  1KG8 A;  4UG2 A;  4DS7 E;  4BWB A;  1S51 A;  3ZPR A;  4FBZ A;  1L0M A;  4XTL A;  4UHR A;  3UTV A;  4J4Q A;  1EHK B;  5AHZ A;  1AP9 A;  3DQB A;  1AT9 A;  2R4R A;  2KSY A;  4KNF A;  5F8U A;  4Y9H A;  2YDV A;  1P8U A;  4BEY A;  3COD A;  1F88 A;  3HAP A;  3UTW A;  4L6R A;  3OE6 A;  1IW6 A;  2I35 A;  3VVK A;  4BUO A;  2I21 A;  3HAO A;  3QBG A;  3HAN A;  2Y03 A;  5ITC A;  2YCY A;  3OE0 A;  2RH1 A;  3COC A;  2YDO A;  4NC3 A;  3AYM A;  3QBK A;  2YCX A;  5JJE A;  4HWL A;  3T45 A;  1QM8 A;  1HZX A;  2KS9 A;  4DJH A;  1UAZ A;  3QAP A;  3UZC A;  1JV6 A;  2R4S A;  5B6X A;  4GP4 B;  4DKL A;  4FPD A;  5EN0 A;  4K5Y A;  2KSB A;  5BR2 A;  2Y01 A;  3AYN A;  3VG9 A;  3ZPQ A;  1S52 A;  1PXS A;  5DYS A;  3UON A;  4G7S B;  1TN5 A;  3P0G A;  1F4Z A;  3KJ6 A;  4XTO A;  1S53 A;  1XME B;  4N4Y B;  5B6Y A;  5FJG A;  2NTW A;  4BVN A;  3QJR B;  5B6V A;  2X72 A;  1KG9 A;  1H68 A;  5H2N A;  4XT3 A;  5AZD A;  1JFP A;  4BV0 A;  3X3C A;  3NS0 A;  3SN6 R;  3RFM A;  2BRD A;  3S3B B;  1E12 A;  3QJV B;  3S3C B;  3HAQ A;  5G2D A;  4X31 A;  4QI1 A;  3CAP A;  1R2N A;  1F50 A;  5DHG A;  1M0L A;  4BEZ A;  5JJN A;  4X32 A;  3NY9 A;  5G36 A;  5J7A A;  1U19 A;  2WJK A;  2VT4 A;  2Z73 A;  4EIY A;  3ZEV A;  2L6X A;  1VGO A;  4IAR A;  5G28 A;  4EA3 A;  2EI4 A;  3X3B A;  5C1M A;  2ZIY A;  1M0K A;  1IXF A;  1P8I A;  4TL3 A;  4WAV A;  4MD2 A;  5H2M A;  1UCQ A;  5A8E A;  3QJU B;  1FBK A;  3UZA A;  4G71 B;  2F95 A;  4AMJ A;  5B6Z A;  4GPO A;  5A45 A;  5TGZ A;  5B35 A;  2KSA A;  3EH5 B;  2YCZ A;  1Q5I A;  3C9M A;  5B0W A;  4FAA B;  1M0M A;  2Z55 A;  4XTN A;  1XJI A;  3QJT B;  5H2K A;  4JQ6 A;  1VJM A;  1C8S A;  3QAK A;  2G87 A;  5G2A A;  4JKV A;  4QID A;  3C9L A;  4XXJ A;  2ZZL A;  5H2P A;  4WW3 A;  5A44 A;  1S54 A;  3NY8 A;  3V2Y A;  5AX0 A;  2QPD B;  4HYJ A;  1JV7 A;  2JAG A;  2I20 A;  1X0S A;  2Y04 A;  2M3G A;  4MQS A;  4XT1 A;  1R84 A;  3OAX A;  4MBS A;  3UTY A;  3S8F B;  5H2J A;  5LWE A;  4DAJ A;  3VI0 A;  4PXF A;  2JAF A;  3V2W A;  2I1X A;  2PED A;  4MD1 A; 
#chains in the Genus database with same CATH homology
 3MBV A;  4OV0 A;  3PBL A;  1BRR A;  1QHJ A;  1KGB A;  3EML A;  5BR5 A;  5B34 A;  2QPE B;  3PDS A;  3A7K A;  3OE8 A;  2ZFE A;  5KKH A;  1GU8 A;  4MQT A;  1GZM A;  4LDL A;  3HAR A;  3PXO A;  4FA7 B;  5H2I A;  3EH4 B;  1S8L A;  5AX1 A;  1X0I 1;  1O0A A;  3AM6 A;  2Y02 A;  4JR8 A;  3QJQ B;  5G2C A;  3S3D B;  1QKP A;  2LNL A;  3PWH A;  5ETZ A;  3VGA A;  5B2N A;  4L35 A;  1PY6 A;  2HPY A;  1BRX A;  3HAS A;  4X1H A;  5ITE A;  1JGJ A;  3QBI A;  4GP5 B;  3QDC A;  1TN0 A;  1PXR A;  3OE9 A;  2Y00 A;  1P8H A;  2YCW A;  4EJ4 A;  3EH3 B;  3PQR A;  3UG9 A;  4G7R B;  4IAQ A;  4GYC A;  5H2H A;  1L9H A;  5JJJ A;  4LDO A;  4GP8 B;  5B6W A;  1LN6 A;  4G72 B;  3NSB A;  1CWQ A;  1KME A;  1GUE A;  5AWZ A;  4G7Q B;  5DHH A;  3VW7 A;  1MGY A;  5AHY A;  1IW9 A;  3ODU A;  2WJL A;  2AT9 A;  4KLY A;  4PXK A;  3RZE A;  1E0P A;  4N6H A;  1C3W A;  4AMI A;  3VHZ A;  3D4S A;  3WQJ A;  4N4W A;  3DDL A;  2J4Y A;  1BM1 A;  1S8J A;  5G54 A;  3BVD B;  3REY A;  1Q5J A;  4QRY A;  4GRV A;  4LDE A;  3QJS B;  5H2L A;  2NTU A;  4HYX A;  2F93 A;  4IB4 A;  3QBL A;  1X0K 1;  3UTX A;  1XIO A;  3ABW A;  1C8R A;  1FBB A;  1QKO A;  4A4M A;  4GBR A;  5G53 A;  5H2O A;  1DZE A;  1H2S A;  3S8G B;  4G70 B;  3NYA A;  1BRD A;  1KG8 A;  4UG2 A;  4DS7 E;  4BWB A;  1S51 A;  3ZPR A;  4FBZ A;  1L0M A;  4XTL A;  4UHR A;  3UTV A;  4J4Q A;  1EHK B;  5AHZ A;  1AP9 A;  3DQB A;  1AT9 A;  2R4R A;  2KSY A;  4KNF A;  5F8U A;  4Y9H A;  2YDV A;  1P8U A;  4BEY A;  3COD A;  1F88 A;  3HAP A;  3UTW A;  4L6R A;  3OE6 A;  1IW6 A;  2I35 A;  3VVK A;  4BUO A;  2I21 A;  3HAO A;  3QBG A;  3HAN A;  2Y03 A;  5ITC A;  2YCY A;  3OE0 A;  2RH1 A;  3COC A;  2YDO A;  4NC3 A;  3AYM A;  3QBK A;  2YCX A;  5JJE A;  4HWL A;  3T45 A;  1QM8 A;  1HZX A;  2KS9 A;  4DJH A;  1UAZ A;  3QAP A;  3UZC A;  1JV6 A;  2R4S A;  5B6X A;  4GP4 B;  4DKL A;  4FPD A;  5EN0 A;  4K5Y A;  2KSB A;  5BR2 A;  2Y01 A;  3AYN A;  3VG9 A;  3ZPQ A;  1S52 A;  1PXS A;  5DYS A;  3UON A;  4G7S B;  1TN5 A;  3P0G A;  1F4Z A;  3KJ6 A;  4XTO A;  1S53 A;  1XME B;  4N4Y B;  5B6Y A;  5FJG A;  2NTW A;  4BVN A;  3QJR B;  5B6V A;  2X72 A;  1KG9 A;  1H68 A;  5H2N A;  4XT3 A;  5AZD A;  1JFP A;  4BV0 A;  3X3C A;  3NS0 A;  3SN6 R;  3RFM A;  2BRD A;  3S3B B;  1E12 A;  3QJV B;  3S3C B;  3HAQ A;  5G2D A;  4X31 A;  4QI1 A;  3CAP A;  1R2N A;  1F50 A;  5DHG A;  1M0L A;  4BEZ A;  5JJN A;  4X32 A;  3NY9 A;  5G36 A;  5J7A A;  1U19 A;  2WJK A;  2VT4 A;  2Z73 A;  4EIY A;  3ZEV A;  2L6X A;  1VGO A;  4IAR A;  5G28 A;  4EA3 A;  2EI4 A;  3X3B A;  5C1M A;  2ZIY A;  1M0K A;  1IXF A;  1P8I A;  4TL3 A;  4WAV A;  4MD2 A;  5H2M A;  1UCQ A;  5A8E A;  3QJU B;  1FBK A;  3UZA A;  4G71 B;  2F95 A;  4AMJ A;  5B6Z A;  4GPO A;  5A45 A;  5TGZ A;  5B35 A;  2KSA A;  3EH5 B;  2YCZ A;  1Q5I A;  3C9M A;  5B0W A;  4FAA B;  1M0M A;  2Z55 A;  4XTN A;  1XJI A;  3QJT B;  5H2K A;  4JQ6 A;  1VJM A;  1C8S A;  3QAK A;  2G87 A;  5G2A A;  4JKV A;  4QID A;  3C9L A;  4XXJ A;  2ZZL A;  5H2P A;  4WW3 A;  5A44 A;  1S54 A;  3NY8 A;  3V2Y A;  5AX0 A;  2QPD B;  4HYJ A;  1JV7 A;  2JAG A;  2I20 A;  1X0S A;  2Y04 A;  2M3G A;  4MQS A;  4XT1 A;  1R84 A;  3OAX A;  4MBS A;  3UTY A;  3S8F B;  5H2J A;  5LWE A;  4DAJ A;  3VI0 A;  4PXF A;  2JAF A;  3V2W A;  2I1X A;  2PED A;  4MD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...