4EIYA

Crystal structure of the chimeric protein of a2aar-bril in complex with zm241385 at 1.8a resolution
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
405
structure length
390
Chain Sequence
GAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine receptor A2a/Soluble cytochrome b562 chimera
publication title Structural basis for allosteric regulation of GPCRs by sodium ions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 173
structure length 390
sequence length 405
ec nomenclature
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4eiyA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4eiyA01
3NSBA 1GU8A 4UHRA 5A45A 4CDAA 3OE6A 4FPDA 2F93A 5KKHA 3UTVA 1MGYA 5C1MA 1M0KA 2KSAA 1UCQA 3U8PA 1IW9A 1QKPA 2J8WA 2NTUA 2ZFEA 1XJIA 1CPRA 4U9EA 3NMKA 3L1MA 5G2CA 4NC3A 2J4YA 3P0GA 1QHJA 4FBZA 2YLGA 5B6ZA 1KG8A 3OE9A 3QVZA 1R2NA 1O0AA 5G2DA 5A44A 2Y00A 3DDLA 4G7SB 4XXJA 1KGBA 5J7AA 3BVDB 5TGZA 3C9LA 1L9HA 5ITCA 3M4BA 5JJJA 4UG2A 5AWZA 5H2NA 5DYSA 3NY9A 4DAJA 1AT9A 2Z55A 3PQRA 2YL1A 3M4CA 4CDVA 4ER9A 3QJTB 3QJRB 5G36A 3VVKA 3QAKA 3S8GB 1TN0A 4QRYA 1KMEA 1S8JA 4GYCA 1BM1A 1AP9A 3IQ6A 3NY8A 2XLEA 1GZMA 2R4SA 3IQ5A 1QPUA 4GP5B 4DJHA 4EA3A 4XT3A 4G7QB 3COCA 2XLDA 5EN0A 3X3BA 2XM4A 2LNLA 4MQSA 3VGAA 4JQ6A 4MD1A 3UG9A 3DE8A 3UTYA 2ZZLA 5FJGA 5JJNA 5H2LA 4JEAA 2YL3A 2JAGA 3ABWA 3QBKA 1QM8A 1U19A 3VRCA 4FA7B 3S3CB 2Y02A 2Y04A 2YKZA 1EKYA 3HARA 4CDYA 4N4WA 4GP8B 5H2PA 5B2NA 2YDVA 3QJSB 1E85A 1KG9A 3AM6A 1PXSA 2F95A 3RFMA 4KLYA 3ZQVA 5B6WA 2YCWA 5AGFA 3PDSA 1L0MA 1BRDA 1M0LA 3D4SA 1APCA 5DHGA 5B35A 1PY6A 5JJEA 4ULVA 1VGOA 3EH5B 3PBLA 1FBBA 3VW7A 4TL3A 1C8RA 3HAOA 4CJGA 4WW3A 1JFPA 1IXFA 5JP7A 5LWEA 1S53A 1E84A 3QJQB 3FOPA 1P8HA 5A8EA 2XLOA 1X0K1 2XL8A 2RH1A 3CODA 2KSYA 3QW0A 3PXOA 2M3GA 4K5YA 2WJKA 2R4RA 3HASA 5B6XA 4LDOA 2YCXA 3MBVA 1CWQA 3HNIA 3RZEA 4EJ4A 4L6RA 1Q5JA 3REYA 4BV0A 5JSLA 4BWBA 3ZPRA 4XTOA 3EH3B 5JUAA 2Z73A 3HAQA 1BBHA 1DZEA 3KJ6A 1YYXA 2HPYA 4X31A 2XL6A 3HAPA 3EH4B 4PXKA 4BEYA 1F4ZA 5ETZA 5G54A 1NBBA 5H2HA 3OE8A 2EI4A 5B6VA 1E12A 5H2KA 1XIOA 1CGOA 2YCZA 4JEBA 2XLHA 4G7RB 4CX9A 1F88A 4X32A 2L6XA 2G87A 1E86A 3T45A 4QIDA 3HANA 1S8LA 5H2OA 2WJLA 4BEZA 2XM0A 4MQTA 3DQBA 1UAZA 1H68A 2XLMA 3NMIA 4JR8A 4GBRA 1HZXA 4IARA 3WQJA 5AHYA 3CAPA 3C62A 3C63A 4WGYA 1S05A 4L35A 3M79A 1RCPA 4BUOA 3M15A 2AT9A 5G28A 3QBGA 1H2SA 3C9MA 1M6TA 4G72B 2KSBA 1C3WA 2I21A 4MBSA 4PXFA 4CJOA 5H2IA 3A7KA 2I20A 3QW1A 2QPEB 4N6HA 4CIPA 3QJVB 4DKLA 3FOOA 4JKVA 4EIYA 4HYJA 2XLWA 1QKOA 1VJMA 1M0MA 4KNFA 5H2JA 5B34A 3ZQYA 3UTXA 3EMLA 5G53A 1S52A 3NMJA 1BRRA 5H2MA 5JS5A 5DHHA 4LDLA 2KS9A 4GRVA 1R84A 3QBIA 4XT1A 2XLVA 4JE9A 3HNKA 3ZEVA 1A7VA 3ZPQA 2CCYA 4G71B 5AX0A 1S51A 1JAFA 3HNJA 1JGJA 2X72A 1PXRA 4D4XA 2YDOA 3SN6R 4FAAB 1X0I1 4WAVA 4A4MA 1E83A 4X1HA 4GPOA 3VHZA 4OV0A 3ZTZA 1GQAA 2YL7A 3DE9A 2ZIYA 3AYMA 4AMIA 2YCYA 5B6YA 3PWHA 3HNLA 3TOMA 1Q5IA 5G2AA 3S3DB 5AX1A 2YLIA 4BVNA 3QAPA 2YLDA 4LDEA 2YL0A 4XTNA 5JLIA 1C8SA 3TOLA 2QPDB 2PEDA 3ZWIA 3ZTMA 4AMJA 4U9DA 3ODUA 2BC5A 1LM3B 3VI0A 3UONA 1TN5A 4HWLA 1QQ3A 3NYAA 1X0SA 1S54A 4HYXA 4G70B 256BA 3QVYA 5AHZA 1LN6A 3UZAA 3OE0A 3X3CA 1CGNA 4IAQA 1FBKA 5JRAA 5AZDA 4MD2A 3V2WA 3V2YA 1MQVA 3NS0A 1GUEA 1YZAA 4GP4B 4XTLA 5JT4A 1YZCA 2I1XA 4QI1A 5F8UA 2Y01A 1BRXA 3S3BB 5B0WA 3VG9A 3S8FB 2I35A 3OAXA 2NTWA 1P8IA 4N4YB 3UTWA 1IW6A 3QBLA 4IB4A 3QJUB 2QLAA 3UZCA 1P8UA 1JV7A 2VT4A 1E0PA 5ITEA 5BR2A 5B3IA 2Y03A 3AYNA 1JV6A 5JVEA 4WGZA 3QDCA 1YYJA 2J9BA 2BRDA 5BR5A 1CPQA 1EHKB 1F50A 2JAFA 4J4QA 4Y9HA 1XMEB 4D4NA
chains in the Genus database with same CATH superfamily
3NSBA 5KYXA 2BL2A 2AWYA 2W45A 5A45A 2YWAA 1RKCA 2XS1A 4NY3A 5AC4A 2ZXOA 2EPKX 1NFNA 5L3QA 2JX0A 4ZLCA 4G7ZF 2NTUA 1C02A 3WG7C 1CPRA 3NKEA 3RIPA 4DBRA 4NC3A 4MS2A 1WWPA 4I44A 1HE1A 3OE9A 1OR3A 2J9WA 1TFOB 5A44A 2Y00A 3DDLA 4G7SB 4LLCA 3UMIA 2XRHA 5J7AA 2PP4A 3BVDB 1L9HA 4UG2A 3GEHA 5AWZA 5H2NA 5DYSA 3NY9A 3N24A 4LERA 1AT9A 4C7OA 3EGDB 4LACB 4ER9A 3V5ZA 4AE4B 1I5NA 2Y69C 4DRJB 4LDQA 4O79A 1BM1A 2OU6A 2Q3TA 4YWQA 4IAOA 1GM5A 1AP9A 3CAXA 2EIKC 2H8AA 3DZAA 2R4SA 2M64A 3GORA 4XPWA 4GP5B 3LEOA 3CSKA 3VGAA 2P0NA 3N0TA 1QVXA 1DOVA 4G7OF 3NKDA 5JJNA 3DI5A 5H2LA 3POVA 2MWQA 4XQ1A 1U19A 3S3CB 2Y02A 1EKYA 2LFFA 2KYHA 5A6BA 3OEOA 4CDYA 3EFOB 3QMKA 3C8GA 3DWWA 5B2NA 5EGYA 4OIRF 3AOUA 1PXSA 3RFMA 4Q5SF 5B6WA 3WODF 1OCCC 3WHNA 4C3EA 3PDSA 1BRDA 1VOMA 1APCA 5A6JA 5B35A 2Y3BA 4XTKA 1PV3A 3LAYA 4ULVA 1VGOA 4TL3A 3G50A 3MLGA 2NUTA 4JCZA 1S53A 1E84A 3FOPA 4DOZA 2YHSA 2DI3A 2YZSA 2PX0A 1FTSA 3LUTB 1H9TA 2LD6A 3HJCA 2RH1A 4FAPB 3B71A 3PXOA 2YCXA 1CWQA 4O6NA 1TWCA 3RZEA 5KYWA 4EJ4A 1Q5JA 3ZC4A 4YT8A 4NTAA 4Q7CA 5A6AA 3ZPRA 3U2LA 2G3VA 2OEXA 3EH3B 3ASNC 1YYXA 4CS8C 4PXKA 3T6JA 4BEYA 1F4ZA 5ETZA 5G54A 1GGQA 5H2HA 3EHNA 4MQ9F 2EI4A 5B6VA 4I1MA 1CGOA 1RKEA 1D1AA 1YLMA 2R02A 2OCCC 2R7SA 3PDMP 1D1CA 2XLHA 5L0JA 4J7TA 4CX9A 4M63A 1BR4A 1T6QA 1ZW3A 3JZ0A 4I3MA 1FAPB 4Q4ZF 2G87A 5BQIA 3ABLC 1Z6AA 3EG9A 2EILC 1Q0DA 2JPUA 4BEZA 4MQTA 1SZIA 1Z63A 4OINF 1H68A 2XLMA 3NMIA 1KU2A 3H2VA 3I5PA 3V5XA 5AHYA 4JCHA 3C63A 3NYJA 4L35A 1T5OA 1RCPA 3M15A 3WAQA 5G28A 3PCVA 4U5GA 4W8PA 4MBSA 4PXFA 2RSEB 3HTKC 2A0UA 3EQLF 3DJUB 3QJVB 3O6XA 5IY5C 4IJJA 3DMDA 2A69F 1I4ZA 3FOOA 3IQCA 2GAQA 1FMWA 3L34A 1QKOA 4KNFA 3UTXA 4E7SA 5G53A 1EQ1A 1JR8A 4MVQA 1TWAA 1BRRA 4HE8D 2P61A 4YT5A 5DS6A 4LDLA 3KYJA 1K05A 5KYWB 1R84A 4JE9A 3ZEVA 2R03A 1FFTC 2YRFA 2CCYA 3ECSA 1PXRA 3RQFA 3SN6R 4G7HF 3NYLA 1XZQA 4A4MA 1E83A 4X1HA 4GPOA 2L6GA 3VHZA 3GWLA 5T1DB 4OV0A 1QKRA 1UFBA 2YL7A 3AYMA 4AMIA 2YCYA 5COFA 2QE9A 3PWHA 3HNLA 5AX1A 1Y4CA 3SXYA 2PFDA 1WASA 2PEDA 4K1OA 2GFHA 3ZTMA 3ODUA 2DB4A 2HJMA 3JRMO 1H7IA 2HSQA 1X0SA 4HYXA 3VYWA 2Y39A 5D92A 3GM2A 3F46A 3IPMO 1ZVZA 4N6CA 1GUEA 1YZAA 2EIJC 4XTLA 2W9YA 2Y3DA 4JW1A 3S3BB 1JOGA 3DM9B 4LDKA 4P9FA 1OW7A 1O87A 3GANA 1Z3IX 5KYNA 1LI7A 2WZLA 3QBLA 4IB4A 1NU7D 2F22A 1MNEA 5JVEA 1RJ9B 4CSAC 5BR5A 3GEEA 3J06A 4GEHA 1KTMA 1ORYA 3TK0A 2JAFA 5E33A 4J32B 4D4NA 3GODA 4A2NB 2D4UA 1GU8A 3AG4C 4UHRA 3FHDA 2G3KA 1YAUO 3E9VA 4FPDA 5TJ5E 5C1MA 1M0KA 1UCQA 4PJLA 2LCHA 2IOQA 3X2QC 3C8GD 5L0HA 1NG1A 1QKPA 4AL0A 3MFNA 5EHHA 1VLSA 1XJIA 4EBJA 3L1MA 3JYYA 4FBZA 2YLGA 4OIQF 3NG1A 4NCQA 3B0UX 1OW6A 2Q9BA 1O0AA 5G2DA 4N06A 3PHF2 4XPYA 2HJ3A 4XXJA 1ZYRF 4MVMA 3MYIA 1O5HA 4O7GA 5ITCA 3M4BA 4IWBA 5JJJA 3ZVRA 5EK0A 3K33A 1ZHYA 4DAJA 2CDQA 3JTLO 2WVQA 2YL1A 3M4CA 3S28A 3QJRB 4XLNF 2FGYA 4K0DA 2A1DD 5E2QA 3RF3A 1TN0A 1M2VB 4BJ6C 1KMEA 1S8JA 1NU9C 4BEMJ 2R05A 2BE5F 3IQ6A 1NLXA 2KSFA 2R9RB 4O6MA 3EPVA 5DS5A 3B29A 4KNWA 2OG2A 4PK4A 4WABA 3SXZA 2XLDA 5EN0A 2J0WA 1C17M 2XM4A 3DM5A 2R7VA 2LNLA 1I4YA 2M4EA 4JQ6A 3DE8A 3DAGA 1TR2A 2ZZLA 4IRUA 4JVSA 1J8YF 3LS0A 3I5QA 1U0BB 2YKZA 1O3UA 4BG0A 3RFYA 3SEOA 3DXJF 1WN0A 3EH2A 5F5HA 2IXPA 4RBNA 2OJQA 4GP8B 2A6EF 1ORJA 1BR2A 1VLTA 3AM6A 3ZQVA 1MMNA 2WZGA 3W2WA 5JJEA 4EBKA 3EGXA 3VW7A 1V54C 4JZAA 4WW3A 2QY9A 1JFPA 4OIPF 2QUPA 5JP7A 3AJMA 3CQZA 1P8HA 5A8EA 1W2WA 1NFOA 1X0K1 5CI8A 3JYHA 3QW0A 4H4KC 4K5YA 2WJKA 2WL8A 2HZ8A 1HW1A 5B1AC 2Q00A 4YN0B 4JC7A 2KJGA 4E18A 3REYA 1ZHWA 3FAPB 5JSLA 3OWTA 1SMYF 1QZXA 3S0XA 4C3DA 2Z73A 1BBHA 3KJ6A 3SNHA 3RQEA 2HPYA 4UDVA 4ANJA 2R7OA 2XL6A 1YJGA 4IGGA 2J7PA 1LIHA 1N1CA 5H2KA 2LP4A 3T6BA 2FFHA 5D91A 4JEBA 1Q0MA 4A4AA 1ZHXA 1Q0FA 4P9TA 2Y3GA 4X32A 2OEVA 2HMQA 1NSGB 1WGWA 1AUEA 1E86A 1LS4A 4PJMA 3FVYA 1LS1A 1SYQA 3SYNA 3W4YA 1FFHA 3W8IA 4KI2A 2Q4FA 3UGPA 4YL1A 3LNMB 5KYXB 1AVOB 1T9KA 3U9JA 4JR8A 3VM6A 2NG1A 1BZ4A 3A11A 1S05A 4YL3A 5DQZA 2J9VA 3QTHA 1HMDA 3C9MA 1M6TA 4G72B 3JT1A 4DRIB 2I21A 4CJOA 3GM1A 4MVZA 3Q6MA 5H2IA 2I15A 2J9UA 3FMSA 3FDQA 3NDBB 4HYJA 3ZQYA 3EMLA 3UMKA 3AQBA 1S52A 2VH3A 5H2MA 5L0FA 1R4TA 5JS5A 2J45A 1YARO 2ZD9A 2KS9A 1TQGA 3L0IA 3QBIA 4XT1A 3NYMA 2XLVA 1JMWA 2EPNA 4MTGA 1A7VA 3ASOC 3ZPQA 3K7DA 4G71B 1JAFA 1K04A 1JGJA 2YQYA 2DYSC 4C7OB 1LI5A 5K0IA 1LE2A 3ZTZA 1GQAA 2VB6A 3DE9A 3S9OA 2KC3A 1IW7F 3TOMA 3S3DB 3LEVA 3QAPA 2VCCA 2RD9A 4LDEA 3OA1A 5T3TA 3AGUA 2NSGA 3TOLA 2QPDB 3ZWIA 4U9DA 1EA8A 2BC5A 1LM3B 1WOLA 3VI0A 4U5EE 4HWLA 1YA7O 2TMVP 4BEJA 2B0HA 3DD7A 3ATPA 5L0GA 1OR2A 3K1HA 4QI0A 4G70B 1ST6A 2UUIA 3UZAA 3OE0A 3RVYA 3X3CA 1HMOA 2EPLX 1CGME 3V2YA 5KYUA 4GP4B 1LE4A 3G4ZA 1U89A 4QI1A 2Y01A 3B0VC 5B0WA 3C8GB 3S8FB 2I35A 3UMHA 4Z9IA 2ZXWC 2NTWA 4N4YB 3UTWA 1JPJA 1VB5A 3ABKC 3RKOF 1V4AA 4Z9HA 1WATA 1E0PA 5ITEA 2IXMA 2NUPA 3EH1A 3RYLA 5KYYA 2NUTB 3SP1A 2P7VA 1Q0KA 2J46A 5BUOA 3V7OA 4BPMA 4G78A 4XEKA 4CDAA 2IYLD 4XLPF 3UTVA 5KKHA 3KYIA 3M1CB 1MGYA 2KSAA 2W4MA 3U8PA 5F28E 1Z5ZA 3JRTA 1IW9A 1PCXA 1D0YA 2J8WA 2ZFEA 3UR3C 5HSWA 3Q6NA 2R7TA 4U9EA 3NMKA 4WJ0A 2I8BA 5G2CA 3SXKA 2J4YA 3P0GA 1QHJA 1ZU4A 4PFPA 3LS1A 1TFKB 4CIHA 3QVZA 3QZCA 2A68F 4CS9A 1RKEB 1KGBA 4KNVA 4NTBA 1YVIA 5TGZA 4JRZA 3C9LA 2CNWD 4MVRA 4EWCA 2AVKA 1S7ZA 1LKXA 3HLZA 2XS8A 4EHPA 3EG9B 3SXMA 2HV6A 1A0BA 5G36A 4JTCB 3VVKA 3QAKA 4H54A 4GYCA 4MTFA 3X1OA 3NY8A 1GS9A 2XLEA 1LVKA 3U0CA 4OIOF 1OCZC 3VAYA 4PJJA 3IQ5A 2J7PD 2A0BA 4DJHA 4XT3A 1HW2A 3C7JA 4XWJA 1D1BA 3VF0A 4MD1A 3UG9A 3UTYA 1WTYA 2HKVA 3LJBA 5FZTA 2JAGA 2X51A 3ABWA 1QM8A 1RMVA 4FA7B 5A6KA 2Y04A 1HY5A 4DXWA 3HARA 3Q7GA 4PFOA 2YVKA 4N4WA 1YA9A 3QJSB 4DBQA 4BJTA 3KPHA 1Z23A 2ZPAA 1E85A 1KG9A 2YCWA 4HEAJ 5AGFA 2R7WA 5FCLA 1L0MA 4ZLDA 3D4SA 2IXNA 2L6FA 1ORSC 4U5HA 1FBBA 2LSEA 2H7VC 1QSPA 1FNTc 3HAOA 1SF8A 3B9QA 1U6HA 4R32A 3MYFA 3CEXA 1G4US 5LWEA 3HKKA 3DAFA 3CZ6A 4BJ5A 4YL0A 4U5FE 2XL8A 4DVYP 2ZXRA 3TQOA 2O9XA 4GYTA 2M3GA 4LDOA 2XSEA 4J7YA 3US6A 2PF4E 1MNDA 2Q9CA 4L6RA 3JCUQ 2IBFA 3LLKA 5E3AA 1V74B 1R5ID 4XTOA 3K1IA 5JUAA 1DZEA 4AX2A 3HAPA 3EH4B 1T6UA 1TWHA 2R7UA 2V26A 4MW8A 3S84A 2VCAA 3OE8A 1E12A 1XIOA 5DLJA 4JURI 5DVWA 3B0PA 2Z15A 3TULA 2QTVA 1F88A 2KW3C 2CW0F 2D5RB 4W8KA 2ETSA 3T45A 1YDIA 1OKKD 2LK4A 3F47A 1S8LA 5H2OA 2WJLA 1VK5A 5L0IA 4J30B 2VCBA 3U5SA 1ZU5A 3ZDLA 2R7RA 3DQBA 2C04A 5L0CA 4DRHB 2R25A 4GBRA 1HZXA 4IARA 4XEVA 3S90A 3CAPA 2G62A 3C62A 2P6VA 4WGYA 3M79A 2L7AA 3QBGA 1H2SA 2KSBA 5HV9A 1C3WA 3RQGA 4C3BA 2DYRC 2JD3A 3QW1A 2QPEB 4N6HA 2EPOA 2B0JA 4DVZA 4DKLA 2AU5A 1K40A 3EHMA 4EIYA 4JJGA 3U3FA 3T6GB 5BQGA 1H6GA 3TD7A 1D0XA 3NRHA 1B68A 1VYIA 3EFOA 2CNWA 3V5YA 3L8JA 3HNKA 4PACA 5AX0A 3HNJA 1V55C 2P1AA 2YDOA 4FAAB 1X0I1 4WAVA 1KNYA 2ZIYA 4QDLA 3O10A 2HS5A 1BR1A 4G0HA 1OXKA 2ASRA 4BVNA 1VYKA 2YL0A 4XTNA 5BQHA 5JLIA 4O6YA 4AMJA 4KBLA 1G8XA 2L81A 1PD0A 256BA 3QVYA 5AHZA 5JRAA 2L9JA 5B3SC 5AC5A 3ABMC 3GM3A 4CS7A 3NS0A 1D0ZA 3U9MA 3UGOA 2XXAA 1YZCA 3KKBA 2I1XA 5F8UA 3GWNA 1BRXA 3O39A 3L8IA 3FAJA 4E17A 2NPUA 1P8IA 3W2VA 2Q9AA 3K6BA 4JTAB 3QJUB 2QLAA 4E0HA 2KNHA 3EZIA 5B3IA 2Y03A 3AYNA 1YYJA 3O55A 2OOCA 2J9BA 1OXBA 3EGXB 2OKUA 1G5ZA 2HUJA 1F50A 2NSFA 2E87A 1OW8A 4HFKB 3S29A 4Y9HA 1NZEA 1H9GA 1G4WR 2H7BA 3R2PA 1A7EA 2WB7A 1XWJA 3OE6A 4QI2A 2F93A 1QLEC 2PNOA 1M56C 3E70C 4OD5A 4YK5A 3PMRA 1Y6DA 2IXOA 3DKAA 4CS8A 1TWGA 4MVSA 4PR9A 5B6ZA 1SR2A 1KG8A 4MNDA 1R2NA 4DS7E 4LLEA 3C8ZA 4FESA 3K66A 4YT2A 4ULWA 2LFDA 3U3BA 5T3WA 3UNGC 5COMA 2KK1A 2GDCA 4X0RA 1OKKA 2Z55A 3PQRA 4CDVA 3QJTB 2HMZA 3U8VA 4MVUA 3IEEA 3ZSUA 2XXAB 4F4BA 3S8GB 1L7CA 2ICWG 1LPEA 4QRYA 4PJNA 1UG7A 1TKNA 2MHRA 5B1BC 1GZMA 2GWWA 1QPUA 2OJED 3GEIA 4U5CE 4EA3A 4RDAA 1JRAA 4G7QB 3COCA 2R7XA 1PD1A 3X3BA 5A69A 1C03A 4MQSA 1EI7A 1IZMA 4HFFB 2WZFA 3AG2C 4DJ9A 3AGTA 1Z7Qc 5FJGA 4JEAA 2YL3A 3QBKA 3R7CA 2CGEA 3VRCA 4JIOA 3IHUA 4GQHA 1M57C 3TJ5A 1MMAA 5H2PA 2YDVA 3ITFA 3AG3C 2F95A 2C03A 5CIVA 4KLYA 2AP3A 1OQCA 4RD9A 3RVZA 1M0LA 4AK9A 3H2UA 2PBEA 4YT4A 5DHGA 1PY6A 4YJWA 1RJ9A 2EIMC 3EH5B 3PBLA 1DOWA 3EJNA 1C8RA 4CJGA 1ZHZA 2EPMX 1IXFA 2LQGA 3RH3A 3QJQB 2XLOA 3CODA 2KSYA 3G4XA 2J0XA 5B6XA 3JSEO 2MYSA 2R4RA 3HASA 3MBVA 1T6IA 3HNIA 2ZXPA 1FMVA 2HFIA 4AL1A 3EZHA 3KH2A 3MX3A 4NQFA 2W4BA 4BV0A 4BWBA 1MMGA 5COGA 4ONSA 1VTMP 3TJ6A 1E2XA 3I4UA 3HAQA 4X31A 4LDRA 5KYUB 2WVOA 1Q0GA 3SZRA 1NBBA 4B6IA 4Z9JA 4CS9C 3MBGA 4CBEA 4E7ZA 2YCZA 4G7RB 3N2ZB 2IM8A 1ZHTA 3A9CA 4JTDB 1F1MA 3ZG1A 3KMIA 2L6XA 2KGOA 2NUPB 2VASA 4CSAA 3S27A 4QIDA 2L6HA 2GA0A 3HANA 5KYYB 2Y3HA 1M2VA 3LLIA 2XM0A 4E0IA 1UAZA 1T01A 2XL4A 5DQTA 3W8HA 3WQJA 1XZPA 5CI9A 3U2MA 1OCOC 3T4RA 4MTOA 3Q7LA 4BUOA 2AT9A 2LIGA 3ZIBA 5F5FA 2HV7A 1ZW2A 1JPNA 2EINC 3A7KA 2I20A 4CIPA 4P6IC 4EKWA 1HE9A 2WVNA 2X0CA 4JKVA 3AQCA 1BDJB 3FXHA 2XLWA 1VJMA 1M0MA 5H2JA 2AWCA 5B34A 1A41A 3JSZA 4OD4A 2PX3A 3NMJA 5L3VA 5DHHA 5GPGB 1ZZPA 4GRVA 4U5DE 1RXQA 5A6BD 2R7QA 4JJFA 1L3PA 3KL4A 1S51A 3LESA 2X72A 4FX5A 4D4XA 2UUHA 2H7OA 3BRJA 4K7BA 4XPXA 3BEHA 1OCRC 5B6YA 5DS4A 2V3CC 4BJ6A 1Q5IA 3AG1C 5G2AA 2YLIA 2QNLA 2YLDA 4BJ5C 1MMDA 1C8SA 3RW0A 4FWVA 4MW3A 4MVOA 5L0DA 3UONA 4EBBA 1TN5A 1QQ3A 3NYAA 1S54A 4NTFA 4EUKB 1LN6A 1CGNA 4IAQA 1FBKA 2Q7RA 3LNRA 5AZDA 4MD2A 1VMAA 2OQMA 3K1IC 3C18A 3V2WA 3EGDA 1MQVA 4I1OB 5JT4A 4AE4A 4XEFA 1A7DA 3VG9A 4BJ1A 3OAXA 1AEPA 1IW6A 3H65A 3IQTA 5E3CA 2YEVA 1M2OA 1FR0A 2KQ9A 3UZCA 3T9OA 2VC9A 1P8UA 1JV7A 2VT4A 4KC9A 5BR2A 3DJNB 1JV6A 4WGZA 3QDCA 2BRDA 2DGJA 1CPQA 4U5BE 2HSBA 1EHKB 2FAPB 4J4QA 1J8MF 2CYDA 2A6HF 1XMEB
chains in the Genus database with same CATH topology
3NSBA 1GU8A 4UHRA 5A45A 4CDAA 3OE6A 4FPDA 2F93A 5KKHA 3UTVA 1MGYA 5C1MA 1M0KA 2KSAA 1UCQA 3U8PA 1IW9A 1QKPA 2J8WA 2NTUA 2ZFEA 1XJIA 1CPRA 4U9EA 3NMKA 3L1MA 5G2CA 4NC3A 2J4YA 3P0GA 1QHJA 4FBZA 2YLGA 5B6ZA 1KG8A 3OE9A 3QVZA 1R2NA 4DS7E 1O0AA 5G2DA 5A44A 2Y00A 3DDLA 4G7SB 4XXJA 1KGBA 5J7AA 3BVDB 5TGZA 3C9LA 1L9HA 5ITCA 3M4BA 5JJJA 4UG2A 5AWZA 5H2NA 5DYSA 3NY9A 4DAJA 1AT9A 2Z55A 3PQRA 2YL1A 3M4CA 4CDVA 4ER9A 3QJTB 3QJRB 5G36A 3VVKA 3QAKA 3S8GB 1TN0A 4QRYA 1KMEA 1S8JA 4GYCA 1BM1A 1AP9A 3IQ6A 3NY8A 2XLEA 1GZMA 2R4SA 3IQ5A 1QPUA 4GP5B 4DJHA 4EA3A 4XT3A 4G7QB 3COCA 2XLDA 5EN0A 3X3BA 2XM4A 2LNLA 4MQSA 3VGAA 4JQ6A 4MD1A 3UG9A 3DE8A 3UTYA 2ZZLA 5FJGA 5JJNA 5H2LA 4JEAA 2YL3A 2JAGA 3ABWA 3QBKA 1QM8A 1U19A 3VRCA 4FA7B 3S3CB 2Y02A 2Y04A 2YKZA 1EKYA 3HARA 4CDYA 4N4WA 4GP8B 5H2PA 5B2NA 2YDVA 3QJSB 1E85A 1KG9A 3AM6A 1PXSA 2F95A 3RFMA 4KLYA 3ZQVA 5B6WA 2YCWA 5AGFA 3PDSA 1L0MA 1BRDA 1M0LA 3D4SA 1APCA 5DHGA 5B35A 1PY6A 5JJEA 4ULVA 1VGOA 3EH5B 3PBLA 1FBBA 3VW7A 4TL3A 1C8RA 3HAOA 4CJGA 4WW3A 1JFPA 1IXFA 5JP7A 5LWEA 1S53A 1E84A 3QJQB 3FOPA 1P8HA 5A8EA 2XLOA 1X0K1 2XL8A 2RH1A 3CODA 2KSYA 3QW0A 3PXOA 2M3GA 4K5YA 2WJKA 2R4RA 3HASA 5B6XA 4LDOA 2YCXA 3MBVA 1CWQA 3HNIA 3RZEA 4EJ4A 4L6RA 1Q5JA 3REYA 4BV0A 5JSLA 4BWBA 3ZPRA 4XTOA 3EH3B 5JUAA 2Z73A 3HAQA 1BBHA 1DZEA 3KJ6A 1YYXA 2HPYA 4X31A 2XL6A 3HAPA 3EH4B 4PXKA 4BEYA 1F4ZA 5ETZA 5G54A 1NBBA 5H2HA 3OE8A 2EI4A 5B6VA 1E12A 5H2KA 1XIOA 1CGOA 2YCZA 4JEBA 2XLHA 4G7RB 4CX9A 1F88A 4X32A 2L6XA 2G87A 1E86A 3T45A 4QIDA 3HANA 1S8LA 5H2OA 2WJLA 4BEZA 2XM0A 4MQTA 3DQBA 1UAZA 1H68A 2XLMA 3NMIA 4JR8A 4GBRA 1HZXA 4IARA 3WQJA 5AHYA 3CAPA 3C62A 3C63A 4WGYA 1S05A 4L35A 3M79A 1RCPA 4BUOA 3M15A 2AT9A 5G28A 3QBGA 1H2SA 3C9MA 1M6TA 4G72B 2KSBA 1C3WA 2I21A 4MBSA 4PXFA 4CJOA 5H2IA 3A7KA 2I20A 3QW1A 2QPEB 4N6HA 4CIPA 3QJVB 4DKLA 3FOOA 4JKVA 4EIYA 4HYJA 2XLWA 1QKOA 1VJMA 1M0MA 4KNFA 5H2JA 5B34A 3ZQYA 3UTXA 3EMLA 5G53A 1S52A 3NMJA 1BRRA 5H2MA 5JS5A 5DHHA 4LDLA 2KS9A 4GRVA 1R84A 3QBIA 4XT1A 2XLVA 4JE9A 3HNKA 3ZEVA 1A7VA 3ZPQA 2CCYA 4G71B 5AX0A 1S51A 1JAFA 3HNJA 1JGJA 2X72A 1PXRA 4D4XA 2YDOA 3SN6R 4FAAB 1X0I1 4WAVA 4A4MA 1E83A 4X1HA 4GPOA 3VHZA 4OV0A 3ZTZA 1GQAA 2YL7A 3DE9A 2ZIYA 3AYMA 4AMIA 2YCYA 5B6YA 3PWHA 3HNLA 3TOMA 1Q5IA 5G2AA 3S3DB 5AX1A 2YLIA 4BVNA 3QAPA 2YLDA 4LDEA 2YL0A 4XTNA 5JLIA 1C8SA 3TOLA 2QPDB 2PEDA 3ZWIA 3ZTMA 4AMJA 4U9DA 3ODUA 2BC5A 1LM3B 3VI0A 3UONA 1TN5A 4HWLA 1QQ3A 3NYAA 1X0SA 1S54A 4HYXA 4G70B 256BA 3QVYA 5AHZA 1LN6A 3UZAA 3OE0A 3X3CA 1CGNA 4IAQA 1FBKA 5JRAA 5AZDA 4MD2A 3V2WA 3V2YA 1MQVA 3NS0A 1GUEA 1YZAA 4GP4B 4XTLA 5JT4A 1YZCA 2I1XA 4QI1A 5F8UA 2Y01A 1BRXA 3S3BB 5B0WA 3VG9A 3S8FB 2I35A 3OAXA 2NTWA 1P8IA 4N4YB 3UTWA 1IW6A 3QBLA 4IB4A 3QJUB 2QLAA 3UZCA 1P8UA 1JV7A 2VT4A 1E0PA 5ITEA 5BR2A 5B3IA 2Y03A 3AYNA 1JV6A 5JVEA 4WGZA 3QDCA 1YYJA 2J9BA 2BRDA 5BR5A 1CPQA 1EHKB 1F50A 2JAFA 4J4QA 4Y9HA 1XMEB 4D4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSB A;  1GU8 A;  4UHR A;  5A45 A;  4CDA A;  3OE6 A;  4FPD A;  2F93 A;  5KKH A;  3UTV A;  1MGY A;  5C1M A;  1M0K A;  2KSA A;  1UCQ A;  3U8P A;  1IW9 A;  1QKP A;  2J8W A;  2NTU A;  2ZFE A;  1XJI A;  1CPR A;  4U9E A;  3NMK A;  3L1M A;  5G2C A;  4NC3 A;  2J4Y A;  3P0G A;  1QHJ A;  4FBZ A;  2YLG A;  5B6Z A;  1KG8 A;  3OE9 A;  3QVZ A;  1R2N A;  1O0A A;  5G2D A;  5A44 A;  2Y00 A;  3DDL A;  4G7S B;  4XXJ A;  1KGB A;  5J7A A;  3BVD B;  5TGZ A;  3C9L A;  1L9H A;  5ITC A;  3M4B A;  5JJJ A;  4UG2 A;  5AWZ A;  5H2N A;  5DYS A;  3NY9 A;  4DAJ A;  1AT9 A;  2Z55 A;  3PQR A;  2YL1 A;  3M4C A;  4CDV A;  4ER9 A;  3QJT B;  3QJR B;  5G36 A;  3VVK A;  3QAK A;  3S8G B;  1TN0 A;  4QRY A;  1KME A;  1S8J A;  4GYC A;  1BM1 A;  1AP9 A;  3IQ6 A;  3NY8 A;  2XLE A;  1GZM A;  2R4S A;  3IQ5 A;  1QPU A;  4GP5 B;  4DJH A;  4EA3 A;  4XT3 A;  4G7Q B;  3COC A;  2XLD A;  5EN0 A;  3X3B A;  2XM4 A;  2LNL A;  4MQS A;  3VGA A;  4JQ6 A;  4MD1 A;  3UG9 A;  3DE8 A;  3UTY A;  2ZZL A;  5FJG A;  5JJN A;  5H2L A;  4JEA A;  2YL3 A;  2JAG A;  3ABW A;  3QBK A;  1QM8 A;  1U19 A;  3VRC A;  4FA7 B;  3S3C B;  2Y02 A;  2Y04 A;  2YKZ A;  1EKY A;  3HAR A;  4CDY A;  4N4W A;  4GP8 B;  5H2P A;  5B2N A;  2YDV A;  3QJS B;  1E85 A;  1KG9 A;  3AM6 A;  1PXS A;  2F95 A;  3RFM A;  4KLY A;  3ZQV A;  5B6W A;  2YCW A;  5AGF A;  3PDS A;  1L0M A;  1BRD A;  1M0L A;  3D4S A;  1APC A;  5DHG A;  5B35 A;  1PY6 A;  5JJE A;  4ULV A;  1VGO A;  3EH5 B;  3PBL A;  1FBB A;  3VW7 A;  4TL3 A;  1C8R A;  3HAO A;  4CJG A;  4WW3 A;  1JFP A;  1IXF A;  5JP7 A;  5LWE A;  1S53 A;  1E84 A;  3QJQ B;  3FOP A;  1P8H A;  5A8E A;  2XLO A;  1X0K 1;  2XL8 A;  2RH1 A;  3COD A;  2KSY A;  3QW0 A;  3PXO A;  2M3G A;  4K5Y A;  2WJK A;  2R4R A;  3HAS A;  5B6X A;  4LDO A;  2YCX A;  3MBV A;  1CWQ A;  3HNI A;  3RZE A;  4EJ4 A;  4L6R A;  1Q5J A;  3REY A;  4BV0 A;  5JSL A;  4BWB A;  3ZPR A;  4XTO A;  3EH3 B;  5JUA A;  2Z73 A;  3HAQ A;  1BBH A;  1DZE A;  3KJ6 A;  1YYX A;  2HPY A;  4X31 A;  2XL6 A;  3HAP A;  3EH4 B;  4PXK A;  4BEY A;  1F4Z A;  5ETZ A;  5G54 A;  1NBB A;  5H2H A;  3OE8 A;  2EI4 A;  5B6V A;  1E12 A;  5H2K A;  1XIO A;  1CGO A;  2YCZ A;  4JEB A;  2XLH A;  4G7R B;  4CX9 A;  1F88 A;  4X32 A;  2L6X A;  2G87 A;  1E86 A;  3T45 A;  4QID A;  3HAN A;  1S8L A;  5H2O A;  2WJL A;  4BEZ A;  2XM0 A;  4MQT A;  3DQB A;  1UAZ A;  1H68 A;  2XLM A;  3NMI A;  4JR8 A;  4GBR A;  1HZX A;  4IAR A;  3WQJ A;  5AHY A;  3CAP A;  3C62 A;  3C63 A;  4WGY A;  1S05 A;  4L35 A;  3M79 A;  1RCP A;  4BUO A;  3M15 A;  2AT9 A;  5G28 A;  3QBG A;  1H2S A;  3C9M A;  1M6T A;  4G72 B;  2KSB A;  1C3W A;  2I21 A;  4MBS A;  4PXF A;  4CJO A;  5H2I A;  3A7K A;  2I20 A;  3QW1 A;  2QPE B;  4N6H A;  4CIP A;  3QJV B;  4DKL A;  3FOO A;  4JKV A;  4EIY A;  4HYJ A;  2XLW A;  1QKO A;  1VJM A;  1M0M A;  4KNF A;  5H2J A;  5B34 A;  3ZQY A;  3UTX A;  3EML A;  5G53 A;  1S52 A;  3NMJ A;  1BRR A;  5H2M A;  5JS5 A;  5DHH A;  4LDL A;  2KS9 A;  4GRV A;  1R84 A;  3QBI A;  4XT1 A;  2XLV A;  4JE9 A;  3HNK A;  3ZEV A;  1A7V A;  3ZPQ A;  2CCY A;  4G71 B;  5AX0 A;  1S51 A;  1JAF A;  3HNJ A;  1JGJ A;  2X72 A;  1PXR A;  4D4X A;  2YDO A;  3SN6 R;  4FAA B;  1X0I 1;  4WAV A;  4A4M A;  1E83 A;  4X1H A;  4GPO A;  3VHZ A;  4OV0 A;  3ZTZ A;  1GQA A;  2YL7 A;  3DE9 A;  2ZIY A;  3AYM A;  4AMI A;  2YCY A;  5B6Y A;  3PWH A;  3HNL A;  3TOM A;  1Q5I A;  5G2A A;  3S3D B;  5AX1 A;  2YLI A;  4BVN A;  3QAP A;  2YLD A;  4LDE A;  2YL0 A;  4XTN A;  5JLI A;  1C8S A;  3TOL A;  2QPD B;  2PED A;  3ZWI A;  3ZTM A;  4AMJ A;  4U9D A;  3ODU A;  2BC5 A;  1LM3 B;  3VI0 A;  3UON A;  1TN5 A;  4HWL A;  1QQ3 A;  3NYA A;  1X0S A;  1S54 A;  4HYX A;  4G70 B;  256B A;  3QVY A;  5AHZ A;  1LN6 A;  3UZA A;  3OE0 A;  3X3C A;  1CGN A;  4IAQ A;  1FBK A;  5JRA A;  5AZD A;  4MD2 A;  3V2W A;  3V2Y A;  1MQV A;  3NS0 A;  1GUE A;  1YZA A;  4GP4 B;  4XTL A;  5JT4 A;  1YZC A;  2I1X A;  4QI1 A;  5F8U A;  2Y01 A;  1BRX A;  3S3B B;  5B0W A;  3VG9 A;  3S8F B;  2I35 A;  3OAX A;  2NTW A;  1P8I A;  4N4Y B;  3UTW A;  1IW6 A;  3QBL A;  4IB4 A;  3QJU B;  2QLA A;  3UZC A;  1P8U A;  1JV7 A;  2VT4 A;  1E0P A;  5ITE A;  5BR2 A;  5B3I A;  2Y03 A;  3AYN A;  1JV6 A;  5JVE A;  4WGZ A;  3QDC A;  1YYJ A;  2J9B A;  2BRD A;  5BR5 A;  1CPQ A;  1EHK B;  1F50 A;  2JAF A;  4J4Q A;  4Y9H A;  1XME B;  4D4N A; 
#chains in the Genus database with same CATH topology
 3NSB A;  5KYX A;  2BL2 A;  2AWY A;  2W45 A;  5A45 A;  2YWA A;  1RKC A;  2XS1 A;  4NY3 A;  5AC4 A;  2ZXO A;  2EPK X;  1NFN A;  5L3Q A;  2JX0 A;  4ZLC A;  4G7Z F;  2NTU A;  1C02 A;  3WG7 C;  1CPR A;  3NKE A;  3RIP A;  4DBR A;  4NC3 A;  4MS2 A;  1WWP A;  4I44 A;  1HE1 A;  3OE9 A;  1OR3 A;  2J9W A;  1TFO B;  5A44 A;  2Y00 A;  3DDL A;  4G7S B;  4LLC A;  3UMI A;  2XRH A;  5J7A A;  2PP4 A;  3BVD B;  1L9H A;  4UG2 A;  3GEH A;  5AWZ A;  5H2N A;  5DYS A;  3NY9 A;  3N24 A;  4LER A;  1AT9 A;  4C7O A;  3EGD B;  4LAC B;  4ER9 A;  3V5Z A;  4AE4 B;  1I5N A;  2Y69 C;  4DRJ B;  4LDQ A;  4O79 A;  1BM1 A;  2OU6 A;  2Q3T A;  4YWQ A;  4IAO A;  1GM5 A;  1AP9 A;  3CAX A;  2EIK C;  2H8A A;  3DZA A;  2R4S A;  2M64 A;  3GOR A;  4XPW A;  4GP5 B;  3LEO A;  3CSK A;  3VGA A;  2P0N A;  3N0T A;  1QVX A;  1DOV A;  4G7O F;  3NKD A;  5JJN A;  3DI5 A;  5H2L A;  3POV A;  2MWQ A;  4XQ1 A;  1U19 A;  3S3C B;  2Y02 A;  1EKY A;  2LFF A;  2KYH A;  5A6B A;  3OEO A;  4CDY A;  3EFO B;  3QMK A;  3C8G A;  3DWW A;  5B2N A;  5EGY A;  4OIR F;  3AOU A;  1PXS A;  3RFM A;  4Q5S F;  5B6W A;  3WOD F;  1OCC C;  3WHN A;  4C3E A;  3PDS A;  1BRD A;  1VOM A;  1APC A;  5A6J A;  5B35 A;  2Y3B A;  4XTK A;  1PV3 A;  3LAY A;  4ULV A;  1VGO A;  4TL3 A;  3G50 A;  3MLG A;  2NUT A;  4JCZ A;  1S53 A;  1E84 A;  3FOP A;  4DOZ A;  2YHS A;  2DI3 A;  2YZS A;  2PX0 A;  1FTS A;  3LUT B;  1H9T A;  2LD6 A;  3HJC A;  2RH1 A;  4FAP B;  3B71 A;  3PXO A;  2YCX A;  1CWQ A;  4O6N A;  1TWC A;  3RZE A;  5KYW A;  4EJ4 A;  1Q5J A;  3ZC4 A;  4YT8 A;  4NTA A;  4Q7C A;  5A6A A;  3ZPR A;  3U2L A;  2G3V A;  2OEX A;  3EH3 B;  3ASN C;  1YYX A;  4CS8 C;  4PXK A;  3T6J A;  4BEY A;  1F4Z A;  5ETZ A;  5G54 A;  1GGQ A;  5H2H A;  3EHN A;  4MQ9 F;  2EI4 A;  5B6V A;  4I1M A;  1CGO A;  1RKE A;  1D1A A;  1YLM A;  2R02 A;  2OCC C;  2R7S A;  3PDM P;  1D1C A;  2XLH A;  5L0J A;  4J7T A;  4CX9 A;  4M63 A;  1BR4 A;  1T6Q A;  1ZW3 A;  3JZ0 A;  4I3M A;  1FAP B;  4Q4Z F;  2G87 A;  5BQI A;  3ABL C;  1Z6A A;  3EG9 A;  2EIL C;  1Q0D A;  2JPU A;  4BEZ A;  4MQT A;  1SZI A;  1Z63 A;  4OIN F;  1H68 A;  2XLM A;  3NMI A;  1KU2 A;  3H2V A;  3I5P A;  3V5X A;  5AHY A;  4JCH A;  3C63 A;  3NYJ A;  4L35 A;  1T5O A;  1RCP A;  3M15 A;  3WAQ A;  5G28 A;  3PCV A;  4U5G A;  4W8P A;  4MBS A;  4PXF A;  2RSE B;  3HTK C;  2A0U A;  3EQL F;  3DJU B;  3QJV B;  3O6X A;  5IY5 C;  4IJJ A;  3DMD A;  2A69 F;  1I4Z A;  3FOO A;  3IQC A;  2GAQ A;  1FMW A;  3L34 A;  1QKO A;  4KNF A;  3UTX A;  4E7S A;  5G53 A;  1EQ1 A;  1JR8 A;  4MVQ A;  1TWA A;  1BRR A;  4HE8 D;  2P61 A;  4YT5 A;  5DS6 A;  4LDL A;  3KYJ A;  1K05 A;  5KYW B;  1R84 A;  4JE9 A;  3ZEV A;  2R03 A;  1FFT C;  2YRF A;  2CCY A;  3ECS A;  1PXR A;  3RQF A;  3SN6 R;  4G7H F;  3NYL A;  1XZQ A;  4A4M A;  1E83 A;  4X1H A;  4GPO A;  2L6G A;  3VHZ A;  3GWL A;  5T1D B;  4OV0 A;  1QKR A;  1UFB A;  2YL7 A;  3AYM A;  4AMI A;  2YCY A;  5COF A;  2QE9 A;  3PWH A;  3HNL A;  5AX1 A;  1Y4C A;  3SXY A;  2PFD A;  1WAS A;  2PED A;  4K1O A;  2GFH A;  3ZTM A;  3ODU A;  2DB4 A;  2HJM A;  3JRM O;  1H7I A;  2HSQ A;  1X0S A;  4HYX A;  3VYW A;  2Y39 A;  5D92 A;  3GM2 A;  3F46 A;  3IPM O;  1ZVZ A;  4N6C A;  1GUE A;  1YZA A;  2EIJ C;  4XTL A;  2W9Y A;  2Y3D A;  4JW1 A;  3S3B B;  1JOG A;  3DM9 B;  4LDK A;  4P9F A;  1OW7 A;  1O87 A;  3GAN A;  1Z3I X;  5KYN A;  1LI7 A;  2WZL A;  3QBL A;  4IB4 A;  1NU7 D;  2F22 A;  1MNE A;  5JVE A;  1RJ9 B;  4CSA C;  5BR5 A;  3GEE A;  3J06 A;  4GEH A;  1KTM A;  1ORY A;  3TK0 A;  2JAF A;  5E33 A;  4J32 B;  4D4N A;  3GOD A;  4A2N B;  2D4U A;  1GU8 A;  3AG4 C;  4UHR A;  3FHD A;  2G3K A;  1YAU O;  3E9V A;  4FPD A;  5TJ5 E;  5C1M A;  1M0K A;  1UCQ A;  4PJL A;  2LCH A;  2IOQ A;  3X2Q C;  3C8G D;  5L0H A;  1NG1 A;  1QKP A;  4AL0 A;  3MFN A;  5EHH A;  1VLS A;  1XJI A;  4EBJ A;  3L1M A;  3JYY A;  4FBZ A;  2YLG A;  4OIQ F;  3NG1 A;  4NCQ A;  3B0U X;  1OW6 A;  2Q9B A;  1O0A A;  5G2D A;  4N06 A;  3PHF 2;  4XPY A;  2HJ3 A;  4XXJ A;  1ZYR F;  4MVM A;  3MYI A;  1O5H A;  4O7G A;  5ITC A;  3M4B A;  4IWB A;  5JJJ A;  3ZVR A;  5EK0 A;  3K33 A;  1ZHY A;  4DAJ A;  2CDQ A;  3JTL O;  2WVQ A;  2YL1 A;  3M4C A;  3S28 A;  3QJR B;  4XLN F;  2FGY A;  4K0D A;  2A1D D;  5E2Q A;  3RF3 A;  1TN0 A;  1M2V B;  4BJ6 C;  1KME A;  1S8J A;  1NU9 C;  4BEM J;  2R05 A;  2BE5 F;  3IQ6 A;  1NLX A;  2KSF A;  2R9R B;  4O6M A;  3EPV A;  5DS5 A;  3B29 A;  4KNW A;  2OG2 A;  4PK4 A;  4WAB A;  3SXZ A;  2XLD A;  5EN0 A;  2J0W A;  1C17 M;  2XM4 A;  3DM5 A;  2R7V A;  2LNL A;  1I4Y A;  2M4E A;  4JQ6 A;  3DE8 A;  3DAG A;  1TR2 A;  2ZZL A;  4IRU A;  4JVS A;  1J8Y F;  3LS0 A;  3I5Q A;  1U0B B;  2YKZ A;  1O3U A;  4BG0 A;  3RFY A;  3SEO A;  3DXJ F;  1WN0 A;  3EH2 A;  5F5H A;  2IXP A;  4RBN A;  2OJQ A;  4GP8 B;  2A6E F;  1ORJ A;  1BR2 A;  1VLT A;  3AM6 A;  3ZQV A;  1MMN A;  2WZG A;  3W2W A;  5JJE A;  4EBK A;  3EGX A;  3VW7 A;  1V54 C;  4JZA A;  4WW3 A;  2QY9 A;  1JFP A;  4OIP F;  2QUP A;  5JP7 A;  3AJM A;  3CQZ A;  1P8H A;  5A8E A;  1W2W A;  1NFO A;  1X0K 1;  5CI8 A;  3JYH A;  3QW0 A;  4H4K C;  4K5Y A;  2WJK A;  2WL8 A;  2HZ8 A;  1HW1 A;  5B1A C;  2Q00 A;  4YN0 B;  4JC7 A;  2KJG A;  4E18 A;  3REY A;  1ZHW A;  3FAP B;  5JSL A;  3OWT A;  1SMY F;  1QZX A;  3S0X A;  4C3D A;  2Z73 A;  1BBH A;  3KJ6 A;  3SNH A;  3RQE A;  2HPY A;  4UDV A;  4ANJ A;  2R7O A;  2XL6 A;  1YJG A;  4IGG A;  2J7P A;  1LIH A;  1N1C A;  5H2K A;  2LP4 A;  3T6B A;  2FFH A;  5D91 A;  4JEB A;  1Q0M A;  4A4A A;  1ZHX A;  1Q0F A;  4P9T A;  2Y3G A;  4X32 A;  2OEV A;  2HMQ A;  1NSG B;  1WGW A;  1AUE A;  1E86 A;  1LS4 A;  4PJM A;  3FVY A;  1LS1 A;  1SYQ A;  3SYN A;  3W4Y A;  1FFH A;  3W8I A;  4KI2 A;  2Q4F A;  3UGP A;  4YL1 A;  3LNM B;  5KYX B;  1AVO B;  1T9K A;  3U9J A;  4JR8 A;  3VM6 A;  2NG1 A;  1BZ4 A;  3A11 A;  1S05 A;  4YL3 A;  5DQZ A;  2J9V A;  3QTH A;  1HMD A;  3C9M A;  1M6T A;  4G72 B;  3JT1 A;  4DRI B;  2I21 A;  4CJO A;  3GM1 A;  4MVZ A;  3Q6M A;  5H2I A;  2I15 A;  2J9U A;  3FMS A;  3FDQ A;  3NDB B;  4HYJ A;  3ZQY A;  3EML A;  3UMK A;  3AQB A;  1S52 A;  2VH3 A;  5H2M A;  5L0F A;  1R4T A;  5JS5 A;  2J45 A;  1YAR O;  2ZD9 A;  2KS9 A;  1TQG A;  3L0I A;  3QBI A;  4XT1 A;  3NYM A;  2XLV A;  1JMW A;  2EPN A;  4MTG A;  1A7V A;  3ASO C;  3ZPQ A;  3K7D A;  4G71 B;  1JAF A;  1K04 A;  1JGJ A;  2YQY A;  2DYS C;  4C7O B;  1LI5 A;  5K0I A;  1LE2 A;  3ZTZ A;  1GQA A;  2VB6 A;  3DE9 A;  3S9O A;  2KC3 A;  1IW7 F;  3TOM A;  3S3D B;  3LEV A;  3QAP A;  2VCC A;  2RD9 A;  4LDE A;  3OA1 A;  5T3T A;  3AGU A;  2NSG A;  3TOL A;  2QPD B;  3ZWI A;  4U9D A;  1EA8 A;  2BC5 A;  1LM3 B;  1WOL A;  3VI0 A;  4U5E E;  4HWL A;  1YA7 O;  2TMV P;  4BEJ A;  2B0H A;  3DD7 A;  3ATP A;  5L0G A;  1OR2 A;  3K1H A;  4QI0 A;  4G70 B;  1ST6 A;  2UUI A;  3UZA A;  3OE0 A;  3RVY A;  3X3C A;  1HMO A;  2EPL X;  1CGM E;  3V2Y A;  5KYU A;  4GP4 B;  1LE4 A;  3G4Z A;  1U89 A;  4QI1 A;  2Y01 A;  3B0V C;  5B0W A;  3C8G B;  3S8F B;  2I35 A;  3UMH A;  4Z9I A;  2ZXW C;  2NTW A;  4N4Y B;  3UTW A;  1JPJ A;  1VB5 A;  3ABK C;  3RKO F;  1V4A A;  4Z9H A;  1WAT A;  1E0P A;  5ITE A;  2IXM A;  2NUP A;  3EH1 A;  3RYL A;  5KYY A;  2NUT B;  3SP1 A;  2P7V A;  1Q0K A;  2J46 A;  5BUO A;  3V7O A;  4BPM A;  4G78 A;  4XEK A;  4CDA A;  2IYL D;  4XLP F;  3UTV A;  5KKH A;  3KYI A;  3M1C B;  1MGY A;  2KSA A;  2W4M A;  3U8P A;  5F28 E;  1Z5Z A;  3JRT A;  1IW9 A;  1PCX A;  1D0Y A;  2J8W A;  2ZFE A;  3UR3 C;  5HSW A;  3Q6N A;  2R7T A;  4U9E A;  3NMK A;  4WJ0 A;  2I8B A;  5G2C A;  3SXK A;  2J4Y A;  3P0G A;  1QHJ A;  1ZU4 A;  4PFP A;  3LS1 A;  1TFK B;  4CIH A;  3QVZ A;  3QZC A;  2A68 F;  4CS9 A;  1RKE B;  1KGB A;  4KNV A;  4NTB A;  1YVI A;  5TGZ A;  4JRZ A;  3C9L A;  2CNW D;  4MVR A;  4EWC A;  2AVK A;  1S7Z A;  1LKX A;  3HLZ A;  2XS8 A;  4EHP A;  3EG9 B;  3SXM A;  2HV6 A;  1A0B A;  5G36 A;  4JTC B;  3VVK A;  3QAK A;  4H54 A;  4GYC A;  4MTF A;  3X1O A;  3NY8 A;  1GS9 A;  2XLE A;  1LVK A;  3U0C A;  4OIO F;  1OCZ C;  3VAY A;  4PJJ A;  3IQ5 A;  2J7P D;  2A0B A;  4DJH A;  4XT3 A;  1HW2 A;  3C7J A;  4XWJ A;  1D1B A;  3VF0 A;  4MD1 A;  3UG9 A;  3UTY A;  1WTY A;  2HKV A;  3LJB A;  5FZT A;  2JAG A;  2X51 A;  3ABW A;  1QM8 A;  1RMV A;  4FA7 B;  5A6K A;  2Y04 A;  1HY5 A;  4DXW A;  3HAR A;  3Q7G A;  4PFO A;  2YVK A;  4N4W A;  1YA9 A;  3QJS B;  4DBQ A;  4BJT A;  3KPH A;  1Z23 A;  2ZPA A;  1E85 A;  1KG9 A;  2YCW A;  4HEA J;  5AGF A;  2R7W A;  5FCL A;  1L0M A;  4ZLD A;  3D4S A;  2IXN A;  2L6F A;  1ORS C;  4U5H A;  1FBB A;  2LSE A;  2H7V C;  1QSP A;  1FNT c;  3HAO A;  1SF8 A;  3B9Q A;  1U6H A;  4R32 A;  3MYF A;  3CEX A;  1G4U S;  5LWE A;  3HKK A;  3DAF A;  3CZ6 A;  4BJ5 A;  4YL0 A;  4U5F E;  2XL8 A;  4DVY P;  2ZXR A;  3TQO A;  2O9X A;  4GYT A;  2M3G A;  4LDO A;  2XSE A;  4J7Y A;  3US6 A;  2PF4 E;  1MND A;  2Q9C A;  4L6R A;  3JCU Q;  2IBF A;  3LLK A;  5E3A A;  1V74 B;  1R5I D;  4XTO A;  3K1I A;  5JUA A;  1DZE A;  4AX2 A;  3HAP A;  3EH4 B;  1T6U A;  1TWH A;  2R7U A;  2V26 A;  4MW8 A;  3S84 A;  2VCA A;  3OE8 A;  1E12 A;  1XIO A;  5DLJ A;  4JUR I;  5DVW A;  3B0P A;  2Z15 A;  3TUL A;  2QTV A;  1F88 A;  2KW3 C;  2CW0 F;  2D5R B;  4W8K A;  2ETS A;  3T45 A;  1YDI A;  1OKK D;  2LK4 A;  3F47 A;  1S8L A;  5H2O A;  2WJL A;  1VK5 A;  5L0I A;  4J30 B;  2VCB A;  3U5S A;  1ZU5 A;  3ZDL A;  2R7R A;  3DQB A;  2C04 A;  5L0C A;  4DRH B;  2R25 A;  4GBR A;  1HZX A;  4IAR A;  4XEV A;  3S90 A;  3CAP A;  2G62 A;  3C62 A;  2P6V A;  4WGY A;  3M79 A;  2L7A A;  3QBG A;  1H2S A;  2KSB A;  5HV9 A;  1C3W A;  3RQG A;  4C3B A;  2DYR C;  2JD3 A;  3QW1 A;  2QPE B;  4N6H A;  2EPO A;  2B0J A;  4DVZ A;  4DKL A;  2AU5 A;  1K40 A;  3EHM A;  4EIY A;  4JJG A;  3U3F A;  3T6G B;  5BQG A;  1H6G A;  3TD7 A;  1D0X A;  3NRH A;  1B68 A;  1VYI A;  3EFO A;  2CNW A;  3V5Y A;  3L8J A;  3HNK A;  4PAC A;  5AX0 A;  3HNJ A;  1V55 C;  2P1A A;  2YDO A;  4FAA B;  1X0I 1;  4WAV A;  1KNY A;  2ZIY A;  4QDL A;  3O10 A;  2HS5 A;  1BR1 A;  4G0H A;  1OXK A;  2ASR A;  4BVN A;  1VYK A;  2YL0 A;  4XTN A;  5BQH A;  5JLI A;  4O6Y A;  4AMJ A;  4KBL A;  1G8X A;  2L81 A;  1PD0 A;  256B A;  3QVY A;  5AHZ A;  5JRA A;  2L9J A;  5B3S C;  5AC5 A;  3ABM C;  3GM3 A;  4CS7 A;  3NS0 A;  1D0Z A;  3U9M A;  3UGO A;  2XXA A;  1YZC A;  3KKB A;  2I1X A;  5F8U A;  3GWN A;  1BRX A;  3O39 A;  3L8I A;  3FAJ A;  4E17 A;  2NPU A;  1P8I A;  3W2V A;  2Q9A A;  3K6B A;  4JTA B;  3QJU B;  2QLA A;  4E0H A;  2KNH A;  3EZI A;  5B3I A;  2Y03 A;  3AYN A;  1YYJ A;  3O55 A;  2OOC A;  2J9B A;  1OXB A;  3EGX B;  2OKU A;  1G5Z A;  2HUJ A;  1F50 A;  2NSF A;  2E87 A;  1OW8 A;  4HFK B;  3S29 A;  4Y9H A;  1NZE A;  1H9G A;  1G4W R;  2H7B A;  3R2P A;  1A7E A;  2WB7 A;  1XWJ A;  3OE6 A;  4QI2 A;  2F93 A;  1QLE C;  2PNO A;  1M56 C;  3E70 C;  4OD5 A;  4YK5 A;  3PMR A;  1Y6D A;  2IXO A;  3DKA A;  4CS8 A;  1TWG A;  4MVS A;  4PR9 A;  5B6Z A;  1SR2 A;  1KG8 A;  4MND A;  1R2N A;  4DS7 E;  4LLE A;  3C8Z A;  4FES A;  3K66 A;  4YT2 A;  4ULW A;  2LFD A;  3U3B A;  5T3W A;  3UNG C;  5COM A;  2KK1 A;  2GDC A;  4X0R A;  1OKK A;  2Z55 A;  3PQR A;  4CDV A;  3QJT B;  2HMZ A;  3U8V A;  4MVU A;  3IEE A;  3ZSU A;  2XXA B;  4F4B A;  3S8G B;  1L7C A;  2ICW G;  1LPE A;  4QRY A;  4PJN A;  1UG7 A;  1TKN A;  2MHR A;  5B1B C;  1GZM A;  2GWW A;  1QPU A;  2OJE D;  3GEI A;  4U5C E;  4EA3 A;  4RDA A;  1JRA A;  4G7Q B;  3COC A;  2R7X A;  1PD1 A;  3X3B A;  5A69 A;  1C03 A;  4MQS A;  1EI7 A;  1IZM A;  4HFF B;  2WZF A;  3AG2 C;  4DJ9 A;  3AGT A;  1Z7Q c;  5FJG A;  4JEA A;  2YL3 A;  3QBK A;  3R7C A;  2CGE A;  3VRC A;  4JIO A;  3IHU A;  4GQH A;  1M57 C;  3TJ5 A;  1MMA A;  5H2P A;  2YDV A;  3ITF A;  3AG3 C;  2F95 A;  2C03 A;  5CIV A;  4KLY A;  2AP3 A;  1OQC A;  4RD9 A;  3RVZ A;  1M0L A;  4AK9 A;  3H2U A;  2PBE A;  4YT4 A;  5DHG A;  1PY6 A;  4YJW A;  1RJ9 A;  2EIM C;  3EH5 B;  3PBL A;  1DOW A;  3EJN A;  1C8R A;  4CJG A;  1ZHZ A;  2EPM X;  1IXF A;  2LQG A;  3RH3 A;  3QJQ B;  2XLO A;  3COD A;  2KSY A;  3G4X A;  2J0X A;  5B6X A;  3JSE O;  2MYS A;  2R4R A;  3HAS A;  3MBV A;  1T6I A;  3HNI A;  2ZXP A;  1FMV A;  2HFI A;  4AL1 A;  3EZH A;  3KH2 A;  3MX3 A;  4NQF A;  2W4B A;  4BV0 A;  4BWB A;  1MMG A;  5COG A;  4ONS A;  1VTM P;  3TJ6 A;  1E2X A;  3I4U A;  3HAQ A;  4X31 A;  4LDR A;  5KYU B;  2WVO A;  1Q0G A;  3SZR A;  1NBB A;  4B6I A;  4Z9J A;  4CS9 C;  3MBG A;  4CBE A;  4E7Z A;  2YCZ A;  4G7R B;  3N2Z B;  2IM8 A;  1ZHT A;  3A9C A;  4JTD B;  1F1M A;  3ZG1 A;  3KMI A;  2L6X A;  2KGO A;  2NUP B;  2VAS A;  4CSA A;  3S27 A;  4QID A;  2L6H A;  2GA0 A;  3HAN A;  5KYY B;  2Y3H A;  1M2V A;  3LLI A;  2XM0 A;  4E0I A;  1UAZ A;  1T01 A;  2XL4 A;  5DQT A;  3W8H A;  3WQJ A;  1XZP A;  5CI9 A;  3U2M A;  1OCO C;  3T4R A;  4MTO A;  3Q7L A;  4BUO A;  2AT9 A;  2LIG A;  3ZIB A;  5F5F A;  2HV7 A;  1ZW2 A;  1JPN A;  2EIN C;  3A7K A;  2I20 A;  4CIP A;  4P6I C;  4EKW A;  1HE9 A;  2WVN A;  2X0C A;  4JKV A;  3AQC A;  1BDJ B;  3FXH A;  2XLW A;  1VJM A;  1M0M A;  5H2J A;  2AWC A;  5B34 A;  1A41 A;  3JSZ A;  4OD4 A;  2PX3 A;  3NMJ A;  5L3V A;  5DHH A;  5GPG B;  1ZZP A;  4GRV A;  4U5D E;  1RXQ A;  5A6B D;  2R7Q A;  4JJF A;  1L3P A;  3KL4 A;  1S51 A;  3LES A;  2X72 A;  4FX5 A;  4D4X A;  2UUH A;  2H7O A;  3BRJ A;  4K7B A;  4XPX A;  3BEH A;  1OCR C;  5B6Y A;  5DS4 A;  2V3C C;  4BJ6 A;  1Q5I A;  3AG1 C;  5G2A A;  2YLI A;  2QNL A;  2YLD A;  4BJ5 C;  1MMD A;  1C8S A;  3RW0 A;  4FWV A;  4MW3 A;  4MVO A;  5L0D A;  3UON A;  4EBB A;  1TN5 A;  1QQ3 A;  3NYA A;  1S54 A;  4NTF A;  4EUK B;  1LN6 A;  1CGN A;  4IAQ A;  1FBK A;  2Q7R A;  3LNR A;  5AZD A;  4MD2 A;  1VMA A;  2OQM A;  3K1I C;  3C18 A;  3V2W A;  3EGD A;  1MQV A;  4I1O B;  5JT4 A;  4AE4 A;  4XEF A;  1A7D A;  3VG9 A;  4BJ1 A;  3OAX A;  1AEP A;  1IW6 A;  3H65 A;  3IQT A;  5E3C A;  2YEV A;  1M2O A;  1FR0 A;  2KQ9 A;  3UZC A;  3T9O A;  2VC9 A;  1P8U A;  1JV7 A;  2VT4 A;  4KC9 A;  5BR2 A;  3DJN B;  1JV6 A;  4WGZ A;  3QDC A;  2BRD A;  2DGJ A;  1CPQ A;  4U5B E;  2HSB A;  1EHK B;  2FAP B;  4J4Q A;  1J8M F;  2CYD A;  2A6H F;  1XME B; 
#chains in the Genus database with same CATH homology
 3NSB A;  1GU8 A;  4UHR A;  5A45 A;  4CDA A;  3OE6 A;  4FPD A;  2F93 A;  5KKH A;  3UTV A;  1MGY A;  5C1M A;  1M0K A;  2KSA A;  1UCQ A;  3U8P A;  1IW9 A;  1QKP A;  2J8W A;  2NTU A;  2ZFE A;  1XJI A;  1CPR A;  4U9E A;  3NMK A;  3L1M A;  5G2C A;  4NC3 A;  2J4Y A;  3P0G A;  1QHJ A;  4FBZ A;  2YLG A;  5B6Z A;  1KG8 A;  3OE9 A;  3QVZ A;  1R2N A;  4DS7 E;  1O0A A;  5G2D A;  5A44 A;  2Y00 A;  3DDL A;  4G7S B;  4XXJ A;  1KGB A;  5J7A A;  3BVD B;  5TGZ A;  3C9L A;  1L9H A;  5ITC A;  3M4B A;  5JJJ A;  4UG2 A;  5AWZ A;  5H2N A;  5DYS A;  3NY9 A;  4DAJ A;  1AT9 A;  2Z55 A;  3PQR A;  2YL1 A;  3M4C A;  4CDV A;  4ER9 A;  3QJT B;  3QJR B;  5G36 A;  3VVK A;  3QAK A;  3S8G B;  1TN0 A;  4QRY A;  1KME A;  1S8J A;  4GYC A;  1BM1 A;  1AP9 A;  3IQ6 A;  3NY8 A;  2XLE A;  1GZM A;  2R4S A;  3IQ5 A;  1QPU A;  4GP5 B;  4DJH A;  4EA3 A;  4XT3 A;  4G7Q B;  3COC A;  2XLD A;  5EN0 A;  3X3B A;  2XM4 A;  2LNL A;  4MQS A;  3VGA A;  4JQ6 A;  4MD1 A;  3UG9 A;  3DE8 A;  3UTY A;  2ZZL A;  5FJG A;  5JJN A;  5H2L A;  4JEA A;  2YL3 A;  2JAG A;  3ABW A;  3QBK A;  1QM8 A;  1U19 A;  3VRC A;  4FA7 B;  3S3C B;  2Y02 A;  2Y04 A;  2YKZ A;  1EKY A;  3HAR A;  4CDY A;  4N4W A;  4GP8 B;  5H2P A;  5B2N A;  2YDV A;  3QJS B;  1E85 A;  1KG9 A;  3AM6 A;  1PXS A;  2F95 A;  3RFM A;  4KLY A;  3ZQV A;  5B6W A;  2YCW A;  5AGF A;  3PDS A;  1L0M A;  1BRD A;  1M0L A;  3D4S A;  1APC A;  5DHG A;  5B35 A;  1PY6 A;  5JJE A;  4ULV A;  1VGO A;  3EH5 B;  3PBL A;  1FBB A;  3VW7 A;  4TL3 A;  1C8R A;  3HAO A;  4CJG A;  4WW3 A;  1JFP A;  1IXF A;  5JP7 A;  5LWE A;  1S53 A;  1E84 A;  3QJQ B;  3FOP A;  1P8H A;  5A8E A;  2XLO A;  1X0K 1;  2XL8 A;  2RH1 A;  3COD A;  2KSY A;  3QW0 A;  3PXO A;  2M3G A;  4K5Y A;  2WJK A;  2R4R A;  3HAS A;  5B6X A;  4LDO A;  2YCX A;  3MBV A;  1CWQ A;  3HNI A;  3RZE A;  4EJ4 A;  4L6R A;  1Q5J A;  3REY A;  4BV0 A;  5JSL A;  4BWB A;  3ZPR A;  4XTO A;  3EH3 B;  5JUA A;  2Z73 A;  3HAQ A;  1BBH A;  1DZE A;  3KJ6 A;  1YYX A;  2HPY A;  4X31 A;  2XL6 A;  3HAP A;  3EH4 B;  4PXK A;  4BEY A;  1F4Z A;  5ETZ A;  5G54 A;  1NBB A;  5H2H A;  3OE8 A;  2EI4 A;  5B6V A;  1E12 A;  5H2K A;  1XIO A;  1CGO A;  2YCZ A;  4JEB A;  2XLH A;  4G7R B;  4CX9 A;  1F88 A;  4X32 A;  2L6X A;  2G87 A;  1E86 A;  3T45 A;  4QID A;  3HAN A;  1S8L A;  5H2O A;  2WJL A;  4BEZ A;  2XM0 A;  4MQT A;  3DQB A;  1UAZ A;  1H68 A;  2XLM A;  3NMI A;  4JR8 A;  4GBR A;  1HZX A;  4IAR A;  3WQJ A;  5AHY A;  3CAP A;  3C62 A;  3C63 A;  4WGY A;  1S05 A;  4L35 A;  3M79 A;  1RCP A;  4BUO A;  3M15 A;  2AT9 A;  5G28 A;  3QBG A;  1H2S A;  3C9M A;  1M6T A;  4G72 B;  2KSB A;  1C3W A;  2I21 A;  4MBS A;  4PXF A;  4CJO A;  5H2I A;  3A7K A;  2I20 A;  3QW1 A;  2QPE B;  4N6H A;  4CIP A;  3QJV B;  4DKL A;  3FOO A;  4JKV A;  4EIY A;  4HYJ A;  2XLW A;  1QKO A;  1VJM A;  1M0M A;  4KNF A;  5H2J A;  5B34 A;  3ZQY A;  3UTX A;  3EML A;  5G53 A;  1S52 A;  3NMJ A;  1BRR A;  5H2M A;  5JS5 A;  5DHH A;  4LDL A;  2KS9 A;  4GRV A;  1R84 A;  3QBI A;  4XT1 A;  2XLV A;  4JE9 A;  3HNK A;  3ZEV A;  1A7V A;  3ZPQ A;  2CCY A;  4G71 B;  5AX0 A;  1S51 A;  1JAF A;  3HNJ A;  1JGJ A;  2X72 A;  1PXR A;  4D4X A;  2YDO A;  3SN6 R;  4FAA B;  1X0I 1;  4WAV A;  4A4M A;  1E83 A;  4X1H A;  4GPO A;  3VHZ A;  4OV0 A;  3ZTZ A;  1GQA A;  2YL7 A;  3DE9 A;  2ZIY A;  3AYM A;  4AMI A;  2YCY A;  5B6Y A;  3PWH A;  3HNL A;  3TOM A;  1Q5I A;  5G2A A;  3S3D B;  5AX1 A;  2YLI A;  4BVN A;  3QAP A;  2YLD A;  4LDE A;  2YL0 A;  4XTN A;  5JLI A;  1C8S A;  3TOL A;  2QPD B;  2PED A;  3ZWI A;  3ZTM A;  4AMJ A;  4U9D A;  3ODU A;  2BC5 A;  1LM3 B;  3VI0 A;  3UON A;  1TN5 A;  4HWL A;  1QQ3 A;  3NYA A;  1X0S A;  1S54 A;  4HYX A;  4G70 B;  256B A;  3QVY A;  5AHZ A;  1LN6 A;  3UZA A;  3OE0 A;  3X3C A;  1CGN A;  4IAQ A;  1FBK A;  5JRA A;  5AZD A;  4MD2 A;  3V2W A;  3V2Y A;  1MQV A;  3NS0 A;  1GUE A;  1YZA A;  4GP4 B;  4XTL A;  5JT4 A;  1YZC A;  2I1X A;  4QI1 A;  5F8U A;  2Y01 A;  1BRX A;  3S3B B;  5B0W A;  3VG9 A;  3S8F B;  2I35 A;  3OAX A;  2NTW A;  1P8I A;  4N4Y B;  3UTW A;  1IW6 A;  3QBL A;  4IB4 A;  3QJU B;  2QLA A;  3UZC A;  1P8U A;  1JV7 A;  2VT4 A;  1E0P A;  5ITE A;  5BR2 A;  5B3I A;  2Y03 A;  3AYN A;  1JV6 A;  5JVE A;  4WGZ A;  3QDC A;  1YYJ A;  2J9B A;  2BRD A;  5BR5 A;  1CPQ A;  1EHK B;  1F50 A;  2JAF A;  4J4Q A;  4Y9H A;  1XME B;  4D4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...