4EIYA

Crystal structure of the chimeric protein of a2aar-bril in complex with zm241385 at 1.8a resolution
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
405
structure length
390
Chain Sequence
GAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine receptor A2a/Soluble cytochrome b562 chimera
publication title Structural basis for allosteric regulation of GPCRs by sodium ions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 173
structure length 390
sequence length 405
ec nomenclature
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4eiyA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4eiyA01
1YYJA 2YDOA 1S8JA 5G28A 3HNIA 1BRDA 3V2YA 2ZFEA 3HARA 3V2WA 3OE8A 1S53A 2NTUA 4WAVA 2XLVA 2J4YA 1DZEA 2JAGA 1TN5A 3S3CB 2BC5A 4MD2A 3ZTMA 5ETZA 3UZCA 2YCYA 4CDYA 5JJNA 1NBBA 5A45A 5JLIA 3C9LA 4MBSA 5JSLA 1JAFA 2X72A 3AM6A 3QDCA 3NYAA 1P8HA 4EIYA 1PY6A 2YL0A 3UONA 1IW9A 3S8FB 3D4SA 4L35A 4GBRA 5C1MA 2YCXA 1M6TA 3QJQB 4GPOA 2LNLA 1YZCA 5JS5A 1LN6A 2ZIYA 3REYA 5TGZA 2R4SA 2F95A 5H2HA 3DE8A 3ABWA 1KG9A 5B6ZA 3ZEVA 2YLGA 1L9HA 5JRAA 4X32A 1H68A 3PQRA 2J8WA 4BVNA 4FAAB 4JEAA 2Y02A 4CDVA 4LDLA 2Y04A 4N4YB 4IARA 3QJRB 4GP5B 4J4QA 5B35A 5A44A 3HNKA 2QPEB 1S51A 4U9EA 3UTWA 2R4RA 2Y00A 2J9BA 3PXOA 4WGYA 3CAPA 5ITEA 3UTYA 3EH4B 1BM1A 3NY9A 4PXFA 4KNFA 3NMJA 1AP9A 4XTLA 1FBBA 5G53A 4MQSA 4XXJA 3ZTZA 3VRCA 5JJEA 3AYNA 4JKVA 5A8EA 1JGJA 1F4ZA 1XJIA 2VT4A 5AWZA 3HNLA 1BBHA 2Z73A 1E86A 2YDVA 2YL3A 1QQ3A 1F50A 4CJOA 5AX1A 3KJ6A 2Y01A 5H2NA 3QVZA 3RFMA 2YL1A 2Y03A 3QJUB 5G2CA 4QI1A 5AGFA 2XLDA 3QBLA 1JV7A 3S8GB 5JUAA 3OE6A 2XLHA 4G71B 1CGOA 4HWLA 1E84A 4MQTA 5B6VA 4ULVA 4FBZA 5H2MA 3ZPRA 3EH3B 1IXFA 2AT9A 3HNJA 1E83A 2XM4A 4EJ4A 5JVEA 2JAFA 4X1HA 4QRYA 4D4XA 3NMKA 1LM3B 3NS0A 4G7SB 5B6YA 5ITCA 4CJGA 1UCQA 1S52A 3VG9A 3MBVA 1A7VA 2NTWA 3EH5B 3AYMA 3FOOA 1QKPA 5B6WA 5DHHA 2XL8A 4G72B 3VI0A 3BVDB 1GQAA 2YLIA 4GRVA 4IB4A 2CCYA 1GUEA 4XT1A 3M79A 3HAQA 1E0PA 5G54A 4JEBA 2QLAA 3M4BA 3HAOA 3M15A 2XL6A 4N6HA 3ZPQA 3FOPA 4PXKA 3L1MA 1AT9A 2I21A 3VW7A 3COCA 2ZZLA 3QW0A 4WGZA 3ZQVA 3PDSA 4FA7B 1M0KA 4QIDA 1E85A 4ER9A 5JT4A 3RZEA 3OE9A 1CPRA 2HPYA 3VVKA 3X3CA 3QBKA 5H2LA 4GP4B 3C63A 1X0K1 2YLDA 4L6RA 5H2PA 2YCZA 1MQVA 4HYXA 1S05A 4DKLA 2I1XA 5B0WA 5DYSA 1PXSA 4A4MA 1QPUA 1FBKA 3T45A 5AHYA 1EKYA 1CGNA 1P8IA 3QJTB 4UG2A 4K5YA 5LWEA 3QAKA 5JJJA 2KSYA 3QJSB 1YYXA 1CPQA 5B3IA 3NSBA 1C3WA 4BEZA 1CWQA 1XIOA 4BV0A 1S8LA 5H2KA 1Q5JA 1O0AA 3UTXA 1XMEB 4XT3A 3HAPA 1KGBA 5H2IA 2YL7A 5AZDA 2G87A 3QW1A 4JQ6A 3ZQYA 4HYJA 4AMIA 1P8UA 1Q5IA 3HASA 4N4WA 4EA3A 2L6XA 4BUOA 2KSBA 5J7AA 5H2OA 4GYCA 3M4CA 5AX0A 4G70B 1PXRA 3DDLA 3SN6R 1UAZA 1JV6A 3CODA 4XTOA 4LDOA 4KLYA 2BRDA 3UG9A 2I35A 2KS9A 1QM8A 4Y9HA 2QPDB 1C8SA 4BWBA 1H2SA 3DQBA 3PWHA 1YZAA 3C62A 1E12A 3ZWIA 1QHJA 1VGOA 5DHGA 4D4NA 4WW3A 2WJKA 2RH1A 4U9DA 3ODUA 5B2NA 1TN0A 3VGAA 4GP8B 2WJLA 2Z55A 1VJMA 1EHKB 5BR5A 5F8UA 4NC3A 3QBIA 2XLMA 3IQ6A 4JR8A 4CDAA 1M0MA 3NY8A 1GZMA 3U8PA 3S3DB 4XTNA 3VHZA 2PEDA 5FJGA 1X0SA 2EI4A 1U19A 1GU8A 3EMLA 3IQ5A 2F93A 1C8RA 4G7QB 1HZXA 1APCA 5B6XA 1M0LA 4CX9A 5B34A 5G36A 1L0MA 256BA 1MGYA 2XLWA 3OE0A 3NMIA 1F88A 1R84A 3TOLA 4UHRA 2KSAA 5G2AA 4DAJA 3QJVB 3HANA 4JE9A 4FPDA 4LDEA 3DE9A 5JP7A 2XM0A 2M3GA 1S54A 4G7RB 5G2DA 4MD1A 5EN0A 4DJHA 5BR2A 4AMJA 4IAQA 3UTVA 2YCWA 1IW6A 3A7KA 1BRXA 3P0GA 5KKHA 3OAXA 4OV0A 3PBLA 4BEYA 4CIPA 5AHZA 1RCPA 2XLEA 2I20A 2YKZA 1BRRA 4X31A 1QKOA 5H2JA 3S3BB 1KMEA 3QBGA 3QVYA 1KG8A 3WQJA 1JFPA 3QAPA 2XLOA 1R2NA 3X3BA 1X0I1 3TOMA 3C9MA 4TL3A 3UZAA
chains in the Genus database with same CATH superfamily
1YYJA 2XL4A 1S8JA 4IJJA 1OXBA 2ZXRA 2HMZA 3O6XA 5COMA 2KSFA 4CBEA 1QSPA 2AWCA 2ZXPA 2Z15A 1DZEA 1O5HA 3AG2C 4YJWA 3V5XA 3NKDA 3G4XA 1O3UA 1FR0A 1D1AA 4CIHA 1K04A 2VASA 5JLIA 1RXQA 5JSLA 2X72A 3K7DA 1SZIA 3NG1A 1IW9A 4KNVA 3S8FB 4Q4ZF 4GBRA 2EIKC 4LACB 1M6TA 3QJQB 4U5CE 4GPOA 2Q00A 2HSQA 4GYTA 2IXMA 1A7EA 3DWWA 4LERA 4UDVA 1T6IA 2X51A 2D4UA 2YLGA 2DB4A 3EGXA 2MHRA 1H68A 3L8JA 1FFHA 3KL4A 4C7OB 2HZ8A 4FAAB 1IW7F 4Z9IA 4LDLA 4N4YB 3V5YA 4A2NB 1KNYA 2FGYA 1LS1A 4XEVA 1TWHA 4BJTA 5B35A 2QPEB 3DZAA 5D91A 1S51A 2EIJC 3TK0A 2J9BA 1R5ID 4WGYA 1LIHA 3MX3A 3S27A 2DI3A 3US6A 4HEAJ 3UTYA 3EH4B 1FMWA 4BG0A 1AP9A 4LLCA 4XTLA 1FBBA 3LLIA 3ZTZA 4Q7CA 1SF8A 4JTCB 3RQFA 2OJQA 3U9JA 3NYLA 1BBHA 2KK1A 3N24A 1Y4CA 4E18A 1Z5ZA 4LLEA 2CYDA 2AWYA 1RMVA 2KW3C 5G2CA 3RH3A 2XLDA 2UUHA 2G3KA 3AG1C 1TWGA 2Y3DA 1CGOA 2A6EF 2ZD9A 5T3TA 4ULVA 1HW2A 3RQGA 3M1CB 3F47A 3GWNA 4X0RA 3ZPRA 3ASNC 3EH3B 2AT9A 5JVEA 3UGPA 4AK9A 1ORYA 3WAQA 3SP1A 5ITCA 2Q9AA 3MBVA 5T1DB 1JRAA 1I4YA 2H7VC 5KYYB 3BEHA 1K05A 4K7BA 2XL8A 4G72B 3VI0A 1WN0A 1MMNA 1NFOA 4XT1A 3R7CA 4JEBA 2I21A 5F5FA 3TQOA 2PX0A 4O6NA 1JPNA 4FA7B 1E85A 4ER9A 2OU6A 3OE9A 1B68A 4O79A 3A9CA 3QBKA 4MW3A 1X0K1 5H2PA 2A69F 2YCZA 4I44A 4NTBA 3FAJA 1S05A 1ZHYA 1M2VA 5EGYA 5DYSA 1G8XA 2W45A 3JCUQ 5AHYA 4U5FE 4DOZA 1P8IA 4K5YA 3QAKA 2A68F 3NSBA 4BEZA 3VYWA 1CWQA 3HTKC 2LSEA 3UTXA 2HSBA 1XMEB 4XT3A 1TQGA 3HAPA 2IOQA 2CDQA 1KGBA 3JZ0A 3QW1A 2R7VA 4LDRA 3ZQYA 1TR2A 1RKEA 2DGJA 4CS7A 2L6XA 1OXKA 3E9VA 3DMDA 3N2ZB 2EPNA 4IGGA 3DDLA 2Y3GA 3CODA 4KLYA 2BRDA 3CAXA 3QZCA 4E7ZA 3O10A 1WTYA 2KS9A 2VCBA 1JMWA 1OCOC 4BWBA 3U2LA 3SEOA 1W2WA 2NPUA 4ZLCA 5COFA 4D4NA 5DHGA 4P6IC 1ZHXA 2LD6A 3LJBA 5FCLA 1VJMA 4JJFA 5BR5A 3QBIA 4JR8A 1M0MA 5E33A 3NY8A 4F4BA 4HE8D 2C04A 4XTNA 1PCXA 2PEDA 2NUPB 3C8GD 4M63A 1U19A 3W8IA 2F93A 1NZEA 5B6XA 1L0MA 256BA 4JCZA 5K0IA 3FAPB 3JYHA 1HE1A 4UHRA 3WHNA 5G2AA 4PFPA 3QJVB 2L9JA 4JE9A 4MVUA 1UFBA 3S9OA 4FPDA 5JP7A 1D1CA 1NFNA 4JVSA 4XPWA 2XM0A 1S54A 1C03A 2XSEA 4AMJA 1Q0FA 3EHNA 1OR3A 4PACA 3KMIA 1IW6A 5KKHA 1VLSA 3PBLA 4CIPA 4Z9JA 4B6IA 5AHZA 4J7TA 5A6KA 3WG7C 1BRRA 4QI2A 3VAYA 3S0XA 5H2JA 5DQTA 2J9VA 1K40A 1JFPA 2XLOA 1R2NA 2BL2A 1XWJA 3TOMA 3RVZA 4JIOA 3C9MA 4MTFA 4NCQA 4XPYA 5G28A 1BRDA 1V54C 1Z3IX 3HARA 2NTUA 2ASRA 4WAVA 2XLVA 3O39A 2J4YA 2PP4A 3EGXB 3GWLA 5FZTA 3S3CB 4ONSA 2R7UA 4MD2A 2AU5A 1E2XA 4G7OF 2WB7A 1T6UA 3AGUA 4YWQA 3UZCA 3C8ZA 4CDYA 2HMQA 3FDQA 2PBEA 4FWVA 1JAFA 4XTKA 3AM6A 1FMVA 4AE4A 4EIYA 2PFDA 1PY6A 2H8AA 1HMDA 3UONA 4ULWA 3D4SA 4C3BA 2YCXA 4JURI 4BJ5C 3ZG1A 4DRHB 5JS5A 2ZIYA 2W9YA 2R4SA 5CI9A 5H2HA 3ABWA 1KG9A 3AJMA 3CSKA 1ZZPA 1DOWA 5JRAA 3K6BA 5BQHA 4X32A 4BVNA 2HJMA 2NUTA 2R7SA 4JEAA 2Y02A 1V4AA 1YLMA 1IZMA 1VLTA 3U8VA 2A0BA 4JTAB 2J7PD 1SMYF 4XLPF 2R4RA 2Y00A 2LK4A 4E7SA 3PXOA 1H9TA 3I5QA 4MTGA 1BM1A 3NY9A 4KNFA 4OIPF 2MWQA 2ZXWC 3UNGC 1OW6A 4YT5A 1AEPA 5JJEA 4XQ1A 4JKVA 5A8EA 5KYUA 3L0IA 4O6MA 1XJIA 4K0DA 4NY3A 3POVA 2Z73A 2YDVA 1F50A 3JSZA 4CJOA 5H2NA 1SYQA 4OIQF 2YL1A 3ABLC 3NKEA 1T01A 4MS2A 5AGFA 1Q0DA 2XLHA 4MQTA 1YA7O 4FBZA 2YRFA 3Q7GA 3EZIA 3ATPA 3JRMO 5H2MA 5BQIA 1IXFA 3HNJA 2FFHA 3RYLA 1FTSA 4DXWA 2LIGA 4AL1A 3LEVA 1VYIA 3NMKA 2R7QA 1M2VB 4CJGA 1A41A 3LNMB 3VG9A 1BR1A 2OG2A 1Q0MA 2NTWA 3MYFA 1YARO 2CNWD 3EH5B 4I3MA 1LKXA 3LESA 1GQAA 1FAPB 2J9UA 2CCYA 5L0DA 3LS1A 1T6QA 2M4EA 3HAQA 1E0PA 4A4AA 4YL3A 4AL0A 2Y3BA 2QLAA 1D0YA 3HAOA 3UR3C 4N6HA 2YHSA 3ZPQA 3L1MA 3EQLF 2HV7A 3ITFA 1QLEC 1BR4A 3UMIA 1TKNA 1CGME 1RJ9A 3B71A 3DJNB 1RKEB 3ZQVA 3PDSA 1PV3A 3L34A 3GM3A 3VVKA 3X3CA 3LS0A 3C63A 4L6RA 1MQVA 2R7OA 4DKLA 1PXSA 1VTMP 4BEJA 1FBKA 2L6GA 5KYXB 3QJTB 5LWEA 1RKCA 5JJJA 3QJSB 4YT4A 1YYXA 1CPQA 4PJJA 5B3IA 5L0CA 3R2PA 4CS9C 2VCAA 2YWAA 1S8LA 1HW1A 3DXJF 2AP3A 1Q5JA 2F22A 4EKWA 3B0VC 2G87A 2GDCA 5DQZA 5A69A 2GFHA 4OD5A 2I8BA 4HYJA 4EA3A 4BUOA 4YK5A 3FXHA 4GYCA 1U0BB 4G70B 2P1AA 3Q6MA 3SN6R 4BPMA 1JOGA 2O9XA 4LDOA 1NSGB 4PJMA 3T6BA 3RQEA 3JRTA 3LEOA 5A6JA 4FAPB 4RBNA 4EUKB 2NSGA 3PWHA 2AVKA 4R32A 1VGOA 4KC9A 2H7BA 1GM5A 2KNHA 3SZRA 3UMKA 3RKOF 3JTLO 3ODUA 3AQCA 5B2NA 3AG3C 2P0NA 4GP8B 1QZXA 1M57C 2Q4FA 2YZSA 3IQ6A 3OEOA 4CDAA 4EBJA 1GZMA 3U8PA 3S3DB 3ZIBA 2J45A 1X0SA 4PJNA 3HLZA 2JX0A 3EMLA 2HJ3A 1C8RA 2OKUA 1HZXA 3KYJA 1M0LA 4AX2A 4OINF 5G36A 3JT1A 2XLWA 3NMIA 2P6VA 2EPKX 1F88A 1R84A 3T6GB 3TOLA 2KSAA 1MNDA 3HANA 2EINC 3ZC4A 4MVQA 4JZAA 5B1BC 2M3GA 3TJ6A 4U5DE 2GWWA 5BR2A 1U6HA 4NQFA 5IY5C 2IBFA 2I15A 3OAXA 1OKKD 4Z9HA 1ST6A 2I20A 1HE9A 3AG4C 4X31A 2A0UA 3S84A 1ORJA 1QKOA 1YAUO 5L3QA 1KMEA 4AE4B 5B1AC 1ORSC 3C8GA 3QAPA 4PFOA 2EPOA 3UZAA 3ABKC 3K66A 1WWPA 2YDOA 1TFOB 1R4TA 2ZFEA 3V2YA 1YJGA 3V2WA 2IM8A 4YL1A 4W8PA 2W4BA 2YEVA 3EG9A 2JAGA 1TN5A 4MVSA 4DS7E 2BE5F 4G7ZF 2NUTB 1L3PA 5ETZA 3WODF 4EBBA 4OIRF 5JJNA 2UUIA 3BRJA 3TD7A 2RD9A 4P9FA 3C9LA 4MBSA 2L7AA 3QDCA 1ZHWA 1P8HA 2EIMC 3T6JA 3U2MA 4BJ5A 3S29A 2LNLA 3LNRA 1YZCA 1T9KA 3MFNA 3REYA 5TGZA 1D0XA 2F95A 4J7YA 3PHF2 4RD9A 2R7RA 4E17A 5B6ZA 2Y3HA 5KYUB 1Q0GA 3PQRA 4DVYP 2J8WA 2R7WA 2OJED 2R03A 4EHPA 4XEFA 3I4UA 5E2QA 3HKKA 2Y04A 3DJUB 2MYSA 4MNDA 4J4QA 2B0HA 3HNKA 3B0PA 3UTWA 1G4WR 1VB5A 5D92A 3CAPA 2V26A 5COGA 2QY9A 2Q7RA 4W8KA 3W8HA 3NMJA 4KBLA 3E70C 3FHDA 2J46A 2L6FA 1I4ZA 4YN0B 2OEXA 5A6BD 3C18A 1A7DA 4U5GA 1WGWA 1BZ4A 1PD1A 3L8IA 3MLGA 3VRCA 2WZFA 3AYNA 1JGJA 2P61A 4PK4A 4U5EE 2VT4A 5AWZA 2LP4A 2A6HF 4GQHA 1E86A 2EPMX 1AVOB 4MVZA 5AX1A 3QVZA 2IXNA 2PX3A 2JPUA 3W2WA 1OW7A 2WZLA 3DM9B 3K1HA 3RW0A 1A0BA 3JSEO 4G71B 1E84A 2J7PA 5B6VA 3W2VA 1FNTc 2QTVA 2D5RB 2R05A 3HJCA 5CI8A 1RJ9B 1V55C 3Q6NA 3SNHA 1E83A 4PJLA 3IQTA 3PCVA 1ZU4A 4QRYA 4D4XA 3NS0A 4OD4A 1HMOA 5B6YA 2ZXOA 1S52A 3G4ZA 4OIOF 1MMAA 1NG1A 4E0HA 3AYMA 3FOOA 5EHHA 3F46A 5B6WA 5DHHA 3BVDB 2YLIA 3U3FA 4GRVA 4IB4A 4MQ9F 5L0HA 1GUEA 2L81A 1DOVA 1VK5A 1G4US 3M79A 3DM5A 5E3CA 4C3DA 3M15A 2XL6A 3CZ6A 4XEKA 2RSEB 4Q5SF 3U0CA 3T9OA 1PD0A 4PR9A 3KH2A 4HFFB 4WGZA 5DS5A 3GM2A 3MYIA 4QIDA 5JT4A 4CSAC 2OEVA 1YA9A 2LCHA 2YLDA 1BR2A 5L0JA 2WVQA 4HYXA 3GANA 2I1XA 5B0WA 2HKVA 1QPUA 2HS5A 3T45A 3MBGA 4UG2A 1F1MA 5L0GA 1LE4A 4CS9A 2KSYA 5DVWA 3ZDLA 4LDKA 4H4KC 4BV0A 1H7IA 2CNWA 4N06A 2KJGA 2JD3A 3AOUA 3EHMA 1QKRA 5L3VA 2H7OA 5H2IA 2KYHA 1TWCA 3RFYA 4WABA 1VYKA 1ZHZA 5A6AA 1V74B 4AMIA 5BQGA 3CEXA 1Q5IA 2ETSA 4N4WA 1O87A 2KSBA 5J7AA 2KQ9A 5AX0A 3U3BA 1PXRA 2P7VA 1JV6A 2J0XA 4XTOA 2I35A 2WL8A 1QM8A 4Y9HA 2QPDB 1OQCA 2ZPAA 3S90A 3H65A 1GS9A 4BJ6A 1YZAA 1VMAA 3ZWIA 1QHJA 1ZVZA 2EPLX 4JJGA 4DVZA 3SXYA 2CW0F 2RH1A 4U9DA 3A11A 3FVYA 5TJ5E 1TN0A 3VGAA 2WJLA 2Z55A 4I1OB 1EHKB 3ECSA 5F8UA 2XLMA 3I5PA 1KTMA 1LPEA 3VHZA 4MTOA 3G50A 5DS6A 3SXZA 5FJGA 2WZGA 1J8MF 1GU8A 4JW1A 1APCA 2YQYA 4CX9A 1MGYA 3C8GB 3IEEA 3KPHA 3OE0A 4IWBA 2IYLD 3GEIA 5T3WA 2LQGA 3DD7A 2QE9A 2XXAA 5L0FA 2J0WA 4LDEA 4EWCA 3DI5A 2Q3TA 1YDIA 4G7RB 5G2DA 4MD1A 1J8YF 3UTVA 1H6GA 3A7KA 3LAYA 1BRXA 3P0GA 4DJ9A 3EG9B 1OCCC 1NU7D 3DAGA 4G0HA 3EFOA 4N6CA 1RCPA 2XLEA 2YKZA 2CGEA 3S3BB 1HY5A 3QVYA 3EGDA 3IQCA 1KG8A 3B9QA 1S7ZA 2WVNA 2R7XA 3GEHA 3X3BA 1X0I1 3GODA 3NYJA 1Z7Qc 4XLNF 4TL3A 4K1OA 2Y39A 1ZW3A 4DRJB 3HNIA 2M64A 2R02A 1S53A 3OE8A 4YL0A 3J06A 3GM1A 2BC5A 4P9TA 4CS8A 3ZTMA 4H54A 2YCYA 2IXOA 3EH1A 1NBBA 4BJ6C 5A45A 1OKKA 4ANJA 5GPGB 4G7HF 3NYAA 1WATA 4KNWA 2YL0A 4L35A 4O6YA 5C1MA 2TMVP 5KYWA 1UG7A 2HFIA 1ZW2A 1LN6A 2OOCA 2V3CC 5E3AA 3DE8A 3EPVA 3ZEVA 1L9HA 4NTAA 3AQBA 1Z23A 4XWJA 4DBQA 3NRHA 3H2UA 4CDVA 4JTDB 1BDJB 4IARA 2R7TA 1NU9C 3DAFA 3QJRB 4GP5B 5A44A 1OR2A 3ZVRA 4U9EA 1Y6DA 2G3VA 5EK0A 5ITEA 3LUTB 3RF3A 3ZSUA 4FESA 4PXFA 3OA1A 1M2OA 5G53A 3CQZA 4MQSA 4MVRA 4XXJA 1XZQA 2C03A 3AGTA 2W4MA 4EBKA 3W4YA 4GEHA 1F4ZA 2OQMA 3HNLA 4C7OA 3B29A 1MMGA 3SYNA 1ZU5A 2HV6A 1TWAA 2YL3A 1QQ3A 2DYRC 3KJ6A 4KI2A 2Y01A 3RFMA 2XRHA 2Y03A 3QJUB 1OCZC 5KYNA 4QI1A 3QBLA 1JV7A 3S8GB 5JUAA 3OE6A 4G78A 4HWLA 2VB6A 2XS8A 1LS4A 3PMRA 1SR2A 1MNEA 3QMKA 2ICWG 1MMDA 1NLXA 4CS8C 4ZLDA 1M56C 4HFKB 3KKBA 5KYXA 2NG1A 2XM4A 3ABMC 4EJ4A 3ASOC 2JAFA 4X1HA 1D1BA 1WOLA 3K1IA 4JC7A 1LM3B 1Q0KA 1EI7A 5DS4A 5A6BA 3U5SA 4G7SB 1I5NA 1UCQA 1A7VA 3TJ5A 1QKPA 1LI5A 3N0TA 3NYMA 1AUEA 1U89A 3SXKA 4QI0A 5G54A 3LLKA 3M4BA 4DBRA 2QUPA 3FOPA 4WJ0A 4PXKA 1AT9A 5L0IA 2PF4E 3VW7A 3COCA 2ZZLA 3QW0A 2LFDA 2Y69C 4CSAA 1EQ1A 1EA8A 3GORA 4BJ1A 3X2QC 1M0KA 3RZEA 2EILC 1CPRA 2HPYA 5H2LA 4GP4B 4YT2A 4YT8A 2FAPB 3TULA 2X0CA 4A4MA 3NDBB 1GGQA 1EKYA 1CGNA 1TFKB 4J30B 5KYYA 4JRZA 2YVKA 4IAOA 1C3WA 3K33A 1XIOA 3IHUA 4JCHA 2NSFA 2XS1A 4MW8A 5H2KA 1OCRC 1QVXA 2J9WA 3DKAA 1C17M 1O0AA 2A1DD 2PNOA 4U5BE 3GEEA 2YL7A 3H2VA 1WASA 5AZDA 1N1CA 3RVYA 1T5OA 4JQ6A 5F28E 3JYYA 1P8UA 4NTFA 1VOMA 3HASA 5AC5A 3IPMO 3KYIA 5H2OA 1Z6AA 3M4CA 3VF0A 3UMHA 1UAZA 3O55A 1FFTC 3EZHA 3U9MA 3EH2A 3UG9A 4MVMA 3FMSA 3T4RA 1C8SA 2DYSC 4O7GA 2GAQA 2XXAB 2VCCA 1H2SA 3DQBA 2QNLA 1JR8A 2R9RB 3C62A 1E12A 4QDLA 5B3SC 4WW3A 1D0ZA 2WJKA 3K1IC 1LE2A 3VM6A 2WVOA 4RDAA 1JPJA 2KGOA 4XPXA 2E87A 4NC3A 3PDMP 5CIVA 3EFOB 1XZPA 1H9GA 5HV9A 2KC3A 2EI4A 1ZYRF 2G62A 3IQ5A 3OWTA 2OCCC 4G7QB 3V7OA 4BEMJ 5DLJA 3EGDB 5B34A 2B0JA 3V5ZA 2IXPA 3S28A 1LVKA 1KU2A 1C02A 4DAJA 3X1OA 3DE9A 2VC9A 3C7JA 2L6HA 4J32B 1YVIA 4FX5A 5EN0A 4DJHA 1G5ZA 5BUOA 1L7CA 4IAQA 2YCWA 2GA0A 4DRIB 3B0UX 4C3EA 2LFFA 2R25A 2VH3A 4OV0A 3Q7LA 3RIPA 4BEYA 3EJNA 4U5HA 4IRUA 2NUPA 5HSWA 1LI7A 4I1MA 3QBGA 5AC4A 1OW8A 5F5HA 1ZHTA 3QTHA 3WQJA 5KYWB 2Q9BA 4E0IA 1Z63A 2HUJA 4LDQA 4MVOA 3SXMA 2Q9CA 3UGOA
chains in the Genus database with same CATH topology
1YYJA 2YDOA 1S8JA 5G28A 3HNIA 1BRDA 3V2YA 2ZFEA 3HARA 3V2WA 3OE8A 1S53A 2NTUA 4WAVA 2XLVA 2J4YA 1DZEA 4DS7E 2JAGA 1TN5A 3S3CB 2BC5A 4MD2A 3ZTMA 5ETZA 3UZCA 2YCYA 4CDYA 5JJNA 1NBBA 5A45A 5JLIA 3C9LA 4MBSA 5JSLA 1JAFA 2X72A 3AM6A 3QDCA 3NYAA 1P8HA 4EIYA 1PY6A 2YL0A 3UONA 1IW9A 3S8FB 3D4SA 4L35A 4GBRA 5C1MA 2YCXA 1M6TA 3QJQB 4GPOA 2LNLA 1YZCA 5JS5A 1LN6A 2ZIYA 3REYA 5TGZA 2R4SA 2F95A 5H2HA 3DE8A 3ABWA 1KG9A 5B6ZA 3ZEVA 2YLGA 1L9HA 5JRAA 4X32A 1H68A 3PQRA 2J8WA 4BVNA 4FAAB 4JEAA 2Y02A 4CDVA 4LDLA 2Y04A 4N4YB 4IARA 3QJRB 4GP5B 4J4QA 5B35A 5A44A 3HNKA 2QPEB 1S51A 4U9EA 3UTWA 2R4RA 2Y00A 2J9BA 3PXOA 4WGYA 3CAPA 5ITEA 3UTYA 3EH4B 1BM1A 3NY9A 4PXFA 4KNFA 3NMJA 1AP9A 4XTLA 1FBBA 5G53A 4MQSA 4XXJA 3ZTZA 3VRCA 5JJEA 3AYNA 4JKVA 5A8EA 1JGJA 1F4ZA 1XJIA 2VT4A 5AWZA 3HNLA 1BBHA 2Z73A 1E86A 2YDVA 2YL3A 1QQ3A 1F50A 4CJOA 5AX1A 3KJ6A 2Y01A 5H2NA 3QVZA 3RFMA 2YL1A 2Y03A 3QJUB 5G2CA 4QI1A 5AGFA 2XLDA 3QBLA 1JV7A 3S8GB 5JUAA 3OE6A 2XLHA 4G71B 1CGOA 4HWLA 1E84A 4MQTA 5B6VA 4ULVA 4FBZA 5H2MA 3ZPRA 3EH3B 1IXFA 2AT9A 3HNJA 1E83A 2XM4A 4EJ4A 5JVEA 2JAFA 4X1HA 4QRYA 4D4XA 3NMKA 1LM3B 3NS0A 4G7SB 5B6YA 5ITCA 4CJGA 1UCQA 1S52A 3VG9A 3MBVA 1A7VA 2NTWA 3EH5B 3AYMA 3FOOA 1QKPA 5B6WA 5DHHA 2XL8A 4G72B 3VI0A 3BVDB 1GQAA 2YLIA 4GRVA 4IB4A 2CCYA 1GUEA 4XT1A 3M79A 3HAQA 1E0PA 5G54A 4JEBA 2QLAA 3M4BA 3HAOA 3M15A 2XL6A 4N6HA 3ZPQA 3FOPA 4PXKA 3L1MA 1AT9A 2I21A 3VW7A 3COCA 2ZZLA 3QW0A 4WGZA 3ZQVA 3PDSA 4FA7B 1M0KA 4QIDA 1E85A 4ER9A 5JT4A 3RZEA 3OE9A 1CPRA 2HPYA 3VVKA 3X3CA 3QBKA 5H2LA 4GP4B 3C63A 1X0K1 2YLDA 4L6RA 5H2PA 2YCZA 1MQVA 4HYXA 1S05A 4DKLA 2I1XA 5B0WA 5DYSA 1PXSA 4A4MA 1QPUA 1FBKA 3T45A 5AHYA 1EKYA 1CGNA 1P8IA 3QJTB 4UG2A 4K5YA 5LWEA 3QAKA 5JJJA 2KSYA 3QJSB 1YYXA 1CPQA 5B3IA 3NSBA 1C3WA 4BEZA 1CWQA 1XIOA 4BV0A 1S8LA 5H2KA 1Q5JA 1O0AA 3UTXA 1XMEB 4XT3A 3HAPA 1KGBA 5H2IA 2YL7A 5AZDA 2G87A 3QW1A 4JQ6A 3ZQYA 4HYJA 4AMIA 1P8UA 1Q5IA 3HASA 4N4WA 4EA3A 2L6XA 4BUOA 2KSBA 5J7AA 5H2OA 4GYCA 3M4CA 5AX0A 4G70B 1PXRA 3DDLA 3SN6R 1UAZA 1JV6A 3CODA 4XTOA 4LDOA 4KLYA 2BRDA 3UG9A 2I35A 2KS9A 1QM8A 4Y9HA 2QPDB 1C8SA 4BWBA 1H2SA 3DQBA 3PWHA 1YZAA 3C62A 1E12A 3ZWIA 1QHJA 1VGOA 5DHGA 4D4NA 4WW3A 2WJKA 2RH1A 4U9DA 3ODUA 5B2NA 1TN0A 3VGAA 4GP8B 2WJLA 2Z55A 1VJMA 1EHKB 5BR5A 5F8UA 4NC3A 3QBIA 2XLMA 3IQ6A 4JR8A 4CDAA 1M0MA 3NY8A 1GZMA 3U8PA 3S3DB 4XTNA 3VHZA 2PEDA 5FJGA 1X0SA 2EI4A 1U19A 1GU8A 3EMLA 3IQ5A 2F93A 1C8RA 4G7QB 1HZXA 1APCA 5B6XA 1M0LA 4CX9A 5B34A 5G36A 1L0MA 256BA 1MGYA 2XLWA 3OE0A 3NMIA 1F88A 1R84A 3TOLA 4UHRA 2KSAA 5G2AA 4DAJA 3QJVB 3HANA 4JE9A 4FPDA 4LDEA 3DE9A 5JP7A 2XM0A 2M3GA 1S54A 4G7RB 5G2DA 4MD1A 5EN0A 4DJHA 5BR2A 4AMJA 4IAQA 3UTVA 2YCWA 1IW6A 3A7KA 1BRXA 3P0GA 5KKHA 3OAXA 4OV0A 3PBLA 4BEYA 4CIPA 5AHZA 1RCPA 2XLEA 2I20A 2YKZA 1BRRA 4X31A 1QKOA 5H2JA 3S3BB 1KMEA 3QBGA 3QVYA 1KG8A 3WQJA 1JFPA 3QAPA 2XLOA 1R2NA 3X3BA 1X0I1 3TOMA 3C9MA 4TL3A 3UZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYJ A;  2YDO A;  1S8J A;  5G28 A;  3HNI A;  1BRD A;  3V2Y A;  2ZFE A;  3HAR A;  3V2W A;  3OE8 A;  1S53 A;  2NTU A;  4WAV A;  2XLV A;  2J4Y A;  1DZE A;  2JAG A;  1TN5 A;  3S3C B;  2BC5 A;  4MD2 A;  3ZTM A;  5ETZ A;  3UZC A;  2YCY A;  4CDY A;  5JJN A;  1NBB A;  5A45 A;  5JLI A;  3C9L A;  4MBS A;  5JSL A;  1JAF A;  2X72 A;  3AM6 A;  3QDC A;  3NYA A;  1P8H A;  4EIY A;  1PY6 A;  2YL0 A;  3UON A;  1IW9 A;  3S8F B;  3D4S A;  4L35 A;  4GBR A;  5C1M A;  2YCX A;  1M6T A;  3QJQ B;  4GPO A;  2LNL A;  1YZC A;  5JS5 A;  1LN6 A;  2ZIY A;  3REY A;  5TGZ A;  2R4S A;  2F95 A;  5H2H A;  3DE8 A;  3ABW A;  1KG9 A;  5B6Z A;  3ZEV A;  2YLG A;  1L9H A;  5JRA A;  4X32 A;  1H68 A;  3PQR A;  2J8W A;  4BVN A;  4FAA B;  4JEA A;  2Y02 A;  4CDV A;  4LDL A;  2Y04 A;  4N4Y B;  4IAR A;  3QJR B;  4GP5 B;  4J4Q A;  5B35 A;  5A44 A;  3HNK A;  2QPE B;  1S51 A;  4U9E A;  3UTW A;  2R4R A;  2Y00 A;  2J9B A;  3PXO A;  4WGY A;  3CAP A;  5ITE A;  3UTY A;  3EH4 B;  1BM1 A;  3NY9 A;  4PXF A;  4KNF A;  3NMJ A;  1AP9 A;  4XTL A;  1FBB A;  5G53 A;  4MQS A;  4XXJ A;  3ZTZ A;  3VRC A;  5JJE A;  3AYN A;  4JKV A;  5A8E A;  1JGJ A;  1F4Z A;  1XJI A;  2VT4 A;  5AWZ A;  3HNL A;  1BBH A;  2Z73 A;  1E86 A;  2YDV A;  2YL3 A;  1QQ3 A;  1F50 A;  4CJO A;  5AX1 A;  3KJ6 A;  2Y01 A;  5H2N A;  3QVZ A;  3RFM A;  2YL1 A;  2Y03 A;  3QJU B;  5G2C A;  4QI1 A;  5AGF A;  2XLD A;  3QBL A;  1JV7 A;  3S8G B;  5JUA A;  3OE6 A;  2XLH A;  4G71 B;  1CGO A;  4HWL A;  1E84 A;  4MQT A;  5B6V A;  4ULV A;  4FBZ A;  5H2M A;  3ZPR A;  3EH3 B;  1IXF A;  2AT9 A;  3HNJ A;  1E83 A;  2XM4 A;  4EJ4 A;  5JVE A;  2JAF A;  4X1H A;  4QRY A;  4D4X A;  3NMK A;  1LM3 B;  3NS0 A;  4G7S B;  5B6Y A;  5ITC A;  4CJG A;  1UCQ A;  1S52 A;  3VG9 A;  3MBV A;  1A7V A;  2NTW A;  3EH5 B;  3AYM A;  3FOO A;  1QKP A;  5B6W A;  5DHH A;  2XL8 A;  4G72 B;  3VI0 A;  3BVD B;  1GQA A;  2YLI A;  4GRV A;  4IB4 A;  2CCY A;  1GUE A;  4XT1 A;  3M79 A;  3HAQ A;  1E0P A;  5G54 A;  4JEB A;  2QLA A;  3M4B A;  3HAO A;  3M15 A;  2XL6 A;  4N6H A;  3ZPQ A;  3FOP A;  4PXK A;  3L1M A;  1AT9 A;  2I21 A;  3VW7 A;  3COC A;  2ZZL A;  3QW0 A;  4WGZ A;  3ZQV A;  3PDS A;  4FA7 B;  1M0K A;  4QID A;  1E85 A;  4ER9 A;  5JT4 A;  3RZE A;  3OE9 A;  1CPR A;  2HPY A;  3VVK A;  3X3C A;  3QBK A;  5H2L A;  4GP4 B;  3C63 A;  1X0K 1;  2YLD A;  4L6R A;  5H2P A;  2YCZ A;  1MQV A;  4HYX A;  1S05 A;  4DKL A;  2I1X A;  5B0W A;  5DYS A;  1PXS A;  4A4M A;  1QPU A;  1FBK A;  3T45 A;  5AHY A;  1EKY A;  1CGN A;  1P8I A;  3QJT B;  4UG2 A;  4K5Y A;  5LWE A;  3QAK A;  5JJJ A;  2KSY A;  3QJS B;  1YYX A;  1CPQ A;  5B3I A;  3NSB A;  1C3W A;  4BEZ A;  1CWQ A;  1XIO A;  4BV0 A;  1S8L A;  5H2K A;  1Q5J A;  1O0A A;  3UTX A;  1XME B;  4XT3 A;  3HAP A;  1KGB A;  5H2I A;  2YL7 A;  5AZD A;  2G87 A;  3QW1 A;  4JQ6 A;  3ZQY A;  4HYJ A;  4AMI A;  1P8U A;  1Q5I A;  3HAS A;  4N4W A;  4EA3 A;  2L6X A;  4BUO A;  2KSB A;  5J7A A;  5H2O A;  4GYC A;  3M4C A;  5AX0 A;  4G70 B;  1PXR A;  3DDL A;  3SN6 R;  1UAZ A;  1JV6 A;  3COD A;  4XTO A;  4LDO A;  4KLY A;  2BRD A;  3UG9 A;  2I35 A;  2KS9 A;  1QM8 A;  4Y9H A;  2QPD B;  1C8S A;  4BWB A;  1H2S A;  3DQB A;  3PWH A;  1YZA A;  3C62 A;  1E12 A;  3ZWI A;  1QHJ A;  1VGO A;  5DHG A;  4D4N A;  4WW3 A;  2WJK A;  2RH1 A;  4U9D A;  3ODU A;  5B2N A;  1TN0 A;  3VGA A;  4GP8 B;  2WJL A;  2Z55 A;  1VJM A;  1EHK B;  5BR5 A;  5F8U A;  4NC3 A;  3QBI A;  2XLM A;  3IQ6 A;  4JR8 A;  4CDA A;  1M0M A;  3NY8 A;  1GZM A;  3U8P A;  3S3D B;  4XTN A;  3VHZ A;  2PED A;  5FJG A;  1X0S A;  2EI4 A;  1U19 A;  1GU8 A;  3EML A;  3IQ5 A;  2F93 A;  1C8R A;  4G7Q B;  1HZX A;  1APC A;  5B6X A;  1M0L A;  4CX9 A;  5B34 A;  5G36 A;  1L0M A;  256B A;  1MGY A;  2XLW A;  3OE0 A;  3NMI A;  1F88 A;  1R84 A;  3TOL A;  4UHR A;  2KSA A;  5G2A A;  4DAJ A;  3QJV B;  3HAN A;  4JE9 A;  4FPD A;  4LDE A;  3DE9 A;  5JP7 A;  2XM0 A;  2M3G A;  1S54 A;  4G7R B;  5G2D A;  4MD1 A;  5EN0 A;  4DJH A;  5BR2 A;  4AMJ A;  4IAQ A;  3UTV A;  2YCW A;  1IW6 A;  3A7K A;  1BRX A;  3P0G A;  5KKH A;  3OAX A;  4OV0 A;  3PBL A;  4BEY A;  4CIP A;  5AHZ A;  1RCP A;  2XLE A;  2I20 A;  2YKZ A;  1BRR A;  4X31 A;  1QKO A;  5H2J A;  3S3B B;  1KME A;  3QBG A;  3QVY A;  1KG8 A;  3WQJ A;  1JFP A;  3QAP A;  2XLO A;  1R2N A;  3X3B A;  1X0I 1;  3TOM A;  3C9M A;  4TL3 A;  3UZA A; 
#chains in the Genus database with same CATH topology
 1YYJ A;  2XL4 A;  1S8J A;  4IJJ A;  1OXB A;  2ZXR A;  2HMZ A;  3O6X A;  5COM A;  2KSF A;  4CBE A;  1QSP A;  2AWC A;  2ZXP A;  2Z15 A;  1DZE A;  1O5H A;  3AG2 C;  4YJW A;  3V5X A;  3NKD A;  3G4X A;  1O3U A;  1FR0 A;  1D1A A;  4CIH A;  1K04 A;  2VAS A;  5JLI A;  1RXQ A;  5JSL A;  2X72 A;  3K7D A;  1SZI A;  3NG1 A;  1IW9 A;  4KNV A;  3S8F B;  4Q4Z F;  4GBR A;  2EIK C;  4LAC B;  1M6T A;  3QJQ B;  4U5C E;  4GPO A;  2Q00 A;  2HSQ A;  4GYT A;  2IXM A;  1A7E A;  3DWW A;  4LER A;  4UDV A;  1T6I A;  2X51 A;  2D4U A;  2YLG A;  2DB4 A;  3EGX A;  2MHR A;  1H68 A;  3L8J A;  1FFH A;  3KL4 A;  4C7O B;  2HZ8 A;  4FAA B;  1IW7 F;  4Z9I A;  4LDL A;  4N4Y B;  3V5Y A;  4A2N B;  1KNY A;  2FGY A;  1LS1 A;  4XEV A;  1TWH A;  4BJT A;  5B35 A;  2QPE B;  3DZA A;  5D91 A;  1S51 A;  2EIJ C;  3TK0 A;  2J9B A;  1R5I D;  4WGY A;  1LIH A;  3MX3 A;  3S27 A;  2DI3 A;  3US6 A;  4HEA J;  3UTY A;  3EH4 B;  1FMW A;  4BG0 A;  1AP9 A;  4LLC A;  4XTL A;  1FBB A;  3LLI A;  3ZTZ A;  4Q7C A;  1SF8 A;  4JTC B;  3RQF A;  2OJQ A;  3U9J A;  3NYL A;  1BBH A;  2KK1 A;  3N24 A;  1Y4C A;  4E18 A;  1Z5Z A;  4LLE A;  2CYD A;  2AWY A;  1RMV A;  2KW3 C;  5G2C A;  3RH3 A;  2XLD A;  2UUH A;  2G3K A;  3AG1 C;  1TWG A;  2Y3D A;  1CGO A;  2A6E F;  2ZD9 A;  5T3T A;  4ULV A;  1HW2 A;  3RQG A;  3M1C B;  3F47 A;  3GWN A;  4X0R A;  3ZPR A;  3ASN C;  3EH3 B;  2AT9 A;  5JVE A;  3UGP A;  4AK9 A;  1ORY A;  3WAQ A;  3SP1 A;  5ITC A;  2Q9A A;  3MBV A;  5T1D B;  1JRA A;  1I4Y A;  2H7V C;  5KYY B;  3BEH A;  1K05 A;  4K7B A;  2XL8 A;  4G72 B;  3VI0 A;  1WN0 A;  1MMN A;  1NFO A;  4XT1 A;  3R7C A;  4JEB A;  2I21 A;  5F5F A;  3TQO A;  2PX0 A;  4O6N A;  1JPN A;  4FA7 B;  1E85 A;  4ER9 A;  2OU6 A;  3OE9 A;  1B68 A;  4O79 A;  3A9C A;  3QBK A;  4MW3 A;  1X0K 1;  5H2P A;  2A69 F;  2YCZ A;  4I44 A;  4NTB A;  3FAJ A;  1S05 A;  1ZHY A;  1M2V A;  5EGY A;  5DYS A;  1G8X A;  2W45 A;  3JCU Q;  5AHY A;  4U5F E;  4DOZ A;  1P8I A;  4K5Y A;  3QAK A;  2A68 F;  3NSB A;  4BEZ A;  3VYW A;  1CWQ A;  3HTK C;  2LSE A;  3UTX A;  2HSB A;  1XME B;  4XT3 A;  1TQG A;  3HAP A;  2IOQ A;  2CDQ A;  1KGB A;  3JZ0 A;  3QW1 A;  2R7V A;  4LDR A;  3ZQY A;  1TR2 A;  1RKE A;  2DGJ A;  4CS7 A;  2L6X A;  1OXK A;  3E9V A;  3DMD A;  3N2Z B;  2EPN A;  4IGG A;  3DDL A;  2Y3G A;  3COD A;  4KLY A;  2BRD A;  3CAX A;  3QZC A;  4E7Z A;  3O10 A;  1WTY A;  2KS9 A;  2VCB A;  1JMW A;  1OCO C;  4BWB A;  3U2L A;  3SEO A;  1W2W A;  2NPU A;  4ZLC A;  5COF A;  4D4N A;  5DHG A;  4P6I C;  1ZHX A;  2LD6 A;  3LJB A;  5FCL A;  1VJM A;  4JJF A;  5BR5 A;  3QBI A;  4JR8 A;  1M0M A;  5E33 A;  3NY8 A;  4F4B A;  4HE8 D;  2C04 A;  4XTN A;  1PCX A;  2PED A;  2NUP B;  3C8G D;  4M63 A;  1U19 A;  3W8I A;  2F93 A;  1NZE A;  5B6X A;  1L0M A;  256B A;  4JCZ A;  5K0I A;  3FAP B;  3JYH A;  1HE1 A;  4UHR A;  3WHN A;  5G2A A;  4PFP A;  3QJV B;  2L9J A;  4JE9 A;  4MVU A;  1UFB A;  3S9O A;  4FPD A;  5JP7 A;  1D1C A;  1NFN A;  4JVS A;  4XPW A;  2XM0 A;  1S54 A;  1C03 A;  2XSE A;  4AMJ A;  1Q0F A;  3EHN A;  1OR3 A;  4PAC A;  3KMI A;  1IW6 A;  5KKH A;  1VLS A;  3PBL A;  4CIP A;  4Z9J A;  4B6I A;  5AHZ A;  4J7T A;  5A6K A;  3WG7 C;  1BRR A;  4QI2 A;  3VAY A;  3S0X A;  5H2J A;  5DQT A;  2J9V A;  1K40 A;  1JFP A;  2XLO A;  1R2N A;  2BL2 A;  1XWJ A;  3TOM A;  3RVZ A;  4JIO A;  3C9M A;  4MTF A;  4NCQ A;  4XPY A;  5G28 A;  1BRD A;  1V54 C;  1Z3I X;  3HAR A;  2NTU A;  2ASR A;  4WAV A;  2XLV A;  3O39 A;  2J4Y A;  2PP4 A;  3EGX B;  3GWL A;  5FZT A;  3S3C B;  4ONS A;  2R7U A;  4MD2 A;  2AU5 A;  1E2X A;  4G7O F;  2WB7 A;  1T6U A;  3AGU A;  4YWQ A;  3UZC A;  3C8Z A;  4CDY A;  2HMQ A;  3FDQ A;  2PBE A;  4FWV A;  1JAF A;  4XTK A;  3AM6 A;  1FMV A;  4AE4 A;  4EIY A;  2PFD A;  1PY6 A;  2H8A A;  1HMD A;  3UON A;  4ULW A;  3D4S A;  4C3B A;  2YCX A;  4JUR I;  4BJ5 C;  3ZG1 A;  4DRH B;  5JS5 A;  2ZIY A;  2W9Y A;  2R4S A;  5CI9 A;  5H2H A;  3ABW A;  1KG9 A;  3AJM A;  3CSK A;  1ZZP A;  1DOW A;  5JRA A;  3K6B A;  5BQH A;  4X32 A;  4BVN A;  2HJM A;  2NUT A;  2R7S A;  4JEA A;  2Y02 A;  1V4A A;  1YLM A;  1IZM A;  1VLT A;  3U8V A;  2A0B A;  4JTA B;  2J7P D;  1SMY F;  4XLP F;  2R4R A;  2Y00 A;  2LK4 A;  4E7S A;  3PXO A;  1H9T A;  3I5Q A;  4MTG A;  1BM1 A;  3NY9 A;  4KNF A;  4OIP F;  2MWQ A;  2ZXW C;  3UNG C;  1OW6 A;  4YT5 A;  1AEP A;  5JJE A;  4XQ1 A;  4JKV A;  5A8E A;  5KYU A;  3L0I A;  4O6M A;  1XJI A;  4K0D A;  4NY3 A;  3POV A;  2Z73 A;  2YDV A;  1F50 A;  3JSZ A;  4CJO A;  5H2N A;  1SYQ A;  4OIQ F;  2YL1 A;  3ABL C;  3NKE A;  1T01 A;  4MS2 A;  5AGF A;  1Q0D A;  2XLH A;  4MQT A;  1YA7 O;  4FBZ A;  2YRF A;  3Q7G A;  3EZI A;  3ATP A;  3JRM O;  5H2M A;  5BQI A;  1IXF A;  3HNJ A;  2FFH A;  3RYL A;  1FTS A;  4DXW A;  2LIG A;  4AL1 A;  3LEV A;  1VYI A;  3NMK A;  2R7Q A;  1M2V B;  4CJG A;  1A41 A;  3LNM B;  3VG9 A;  1BR1 A;  2OG2 A;  1Q0M A;  2NTW A;  3MYF A;  1YAR O;  2CNW D;  3EH5 B;  4I3M A;  1LKX A;  3LES A;  1GQA A;  1FAP B;  2J9U A;  2CCY A;  5L0D A;  3LS1 A;  1T6Q A;  2M4E A;  3HAQ A;  1E0P A;  4A4A A;  4YL3 A;  4AL0 A;  2Y3B A;  2QLA A;  1D0Y A;  3HAO A;  3UR3 C;  4N6H A;  2YHS A;  3ZPQ A;  3L1M A;  3EQL F;  2HV7 A;  3ITF A;  1QLE C;  1BR4 A;  3UMI A;  1TKN A;  1CGM E;  1RJ9 A;  3B71 A;  3DJN B;  1RKE B;  3ZQV A;  3PDS A;  1PV3 A;  3L34 A;  3GM3 A;  3VVK A;  3X3C A;  3LS0 A;  3C63 A;  4L6R A;  1MQV A;  2R7O A;  4DKL A;  1PXS A;  1VTM P;  4BEJ A;  1FBK A;  2L6G A;  5KYX B;  3QJT B;  5LWE A;  1RKC A;  5JJJ A;  3QJS B;  4YT4 A;  1YYX A;  1CPQ A;  4PJJ A;  5B3I A;  5L0C A;  3R2P A;  4CS9 C;  2VCA A;  2YWA A;  1S8L A;  1HW1 A;  3DXJ F;  2AP3 A;  1Q5J A;  2F22 A;  4EKW A;  3B0V C;  2G87 A;  2GDC A;  5DQZ A;  5A69 A;  2GFH A;  4OD5 A;  2I8B A;  4HYJ A;  4EA3 A;  4BUO A;  4YK5 A;  3FXH A;  4GYC A;  1U0B B;  4G70 B;  2P1A A;  3Q6M A;  3SN6 R;  4BPM A;  1JOG A;  2O9X A;  4LDO A;  1NSG B;  4PJM A;  3T6B A;  3RQE A;  3JRT A;  3LEO A;  5A6J A;  4FAP B;  4RBN A;  4EUK B;  2NSG A;  3PWH A;  2AVK A;  4R32 A;  1VGO A;  4KC9 A;  2H7B A;  1GM5 A;  2KNH A;  3SZR A;  3UMK A;  3RKO F;  3JTL O;  3ODU A;  3AQC A;  5B2N A;  3AG3 C;  2P0N A;  4GP8 B;  1QZX A;  1M57 C;  2Q4F A;  2YZS A;  3IQ6 A;  3OEO A;  4CDA A;  4EBJ A;  1GZM A;  3U8P A;  3S3D B;  3ZIB A;  2J45 A;  1X0S A;  4PJN A;  3HLZ A;  2JX0 A;  3EML A;  2HJ3 A;  1C8R A;  2OKU A;  1HZX A;  3KYJ A;  1M0L A;  4AX2 A;  4OIN F;  5G36 A;  3JT1 A;  2XLW A;  3NMI A;  2P6V A;  2EPK X;  1F88 A;  1R84 A;  3T6G B;  3TOL A;  2KSA A;  1MND A;  3HAN A;  2EIN C;  3ZC4 A;  4MVQ A;  4JZA A;  5B1B C;  2M3G A;  3TJ6 A;  4U5D E;  2GWW A;  5BR2 A;  1U6H A;  4NQF A;  5IY5 C;  2IBF A;  2I15 A;  3OAX A;  1OKK D;  4Z9H A;  1ST6 A;  2I20 A;  1HE9 A;  3AG4 C;  4X31 A;  2A0U A;  3S84 A;  1ORJ A;  1QKO A;  1YAU O;  5L3Q A;  1KME A;  4AE4 B;  5B1A C;  1ORS C;  3C8G A;  3QAP A;  4PFO A;  2EPO A;  3UZA A;  3ABK C;  3K66 A;  1WWP A;  2YDO A;  1TFO B;  1R4T A;  2ZFE A;  3V2Y A;  1YJG A;  3V2W A;  2IM8 A;  4YL1 A;  4W8P A;  2W4B A;  2YEV A;  3EG9 A;  2JAG A;  1TN5 A;  4MVS A;  4DS7 E;  2BE5 F;  4G7Z F;  2NUT B;  1L3P A;  5ETZ A;  3WOD F;  4EBB A;  4OIR F;  5JJN A;  2UUI A;  3BRJ A;  3TD7 A;  2RD9 A;  4P9F A;  3C9L A;  4MBS A;  2L7A A;  3QDC A;  1ZHW A;  1P8H A;  2EIM C;  3T6J A;  3U2M A;  4BJ5 A;  3S29 A;  2LNL A;  3LNR A;  1YZC A;  1T9K A;  3MFN A;  3REY A;  5TGZ A;  1D0X A;  2F95 A;  4J7Y A;  3PHF 2;  4RD9 A;  2R7R A;  4E17 A;  5B6Z A;  2Y3H A;  5KYU B;  1Q0G A;  3PQR A;  4DVY P;  2J8W A;  2R7W A;  2OJE D;  2R03 A;  4EHP A;  4XEF A;  3I4U A;  5E2Q A;  3HKK A;  2Y04 A;  3DJU B;  2MYS A;  4MND A;  4J4Q A;  2B0H A;  3HNK A;  3B0P A;  3UTW A;  1G4W R;  1VB5 A;  5D92 A;  3CAP A;  2V26 A;  5COG A;  2QY9 A;  2Q7R A;  4W8K A;  3W8H A;  3NMJ A;  4KBL A;  3E70 C;  3FHD A;  2J46 A;  2L6F A;  1I4Z A;  4YN0 B;  2OEX A;  5A6B D;  3C18 A;  1A7D A;  4U5G A;  1WGW A;  1BZ4 A;  1PD1 A;  3L8I A;  3MLG A;  3VRC A;  2WZF A;  3AYN A;  1JGJ A;  2P61 A;  4PK4 A;  4U5E E;  2VT4 A;  5AWZ A;  2LP4 A;  2A6H F;  4GQH A;  1E86 A;  2EPM X;  1AVO B;  4MVZ A;  5AX1 A;  3QVZ A;  2IXN A;  2PX3 A;  2JPU A;  3W2W A;  1OW7 A;  2WZL A;  3DM9 B;  3K1H A;  3RW0 A;  1A0B A;  3JSE O;  4G71 B;  1E84 A;  2J7P A;  5B6V A;  3W2V A;  1FNT c;  2QTV A;  2D5R B;  2R05 A;  3HJC A;  5CI8 A;  1RJ9 B;  1V55 C;  3Q6N A;  3SNH A;  1E83 A;  4PJL A;  3IQT A;  3PCV A;  1ZU4 A;  4QRY A;  4D4X A;  3NS0 A;  4OD4 A;  1HMO A;  5B6Y A;  2ZXO A;  1S52 A;  3G4Z A;  4OIO F;  1MMA A;  1NG1 A;  4E0H A;  3AYM A;  3FOO A;  5EHH A;  3F46 A;  5B6W A;  5DHH A;  3BVD B;  2YLI A;  3U3F A;  4GRV A;  4IB4 A;  4MQ9 F;  5L0H A;  1GUE A;  2L81 A;  1DOV A;  1VK5 A;  1G4U S;  3M79 A;  3DM5 A;  5E3C A;  4C3D A;  3M15 A;  2XL6 A;  3CZ6 A;  4XEK A;  2RSE B;  4Q5S F;  3U0C A;  3T9O A;  1PD0 A;  4PR9 A;  3KH2 A;  4HFF B;  4WGZ A;  5DS5 A;  3GM2 A;  3MYI A;  4QID A;  5JT4 A;  4CSA C;  2OEV A;  1YA9 A;  2LCH A;  2YLD A;  1BR2 A;  5L0J A;  2WVQ A;  4HYX A;  3GAN A;  2I1X A;  5B0W A;  2HKV A;  1QPU A;  2HS5 A;  3T45 A;  3MBG A;  4UG2 A;  1F1M A;  5L0G A;  1LE4 A;  4CS9 A;  2KSY A;  5DVW A;  3ZDL A;  4LDK A;  4H4K C;  4BV0 A;  1H7I A;  2CNW A;  4N06 A;  2KJG A;  2JD3 A;  3AOU A;  3EHM A;  1QKR A;  5L3V A;  2H7O A;  5H2I A;  2KYH A;  1TWC A;  3RFY A;  4WAB A;  1VYK A;  1ZHZ A;  5A6A A;  1V74 B;  4AMI A;  5BQG A;  3CEX A;  1Q5I A;  2ETS A;  4N4W A;  1O87 A;  2KSB A;  5J7A A;  2KQ9 A;  5AX0 A;  3U3B A;  1PXR A;  2P7V A;  1JV6 A;  2J0X A;  4XTO A;  2I35 A;  2WL8 A;  1QM8 A;  4Y9H A;  2QPD B;  1OQC A;  2ZPA A;  3S90 A;  3H65 A;  1GS9 A;  4BJ6 A;  1YZA A;  1VMA A;  3ZWI A;  1QHJ A;  1ZVZ A;  2EPL X;  4JJG A;  4DVZ A;  3SXY A;  2CW0 F;  2RH1 A;  4U9D A;  3A11 A;  3FVY A;  5TJ5 E;  1TN0 A;  3VGA A;  2WJL A;  2Z55 A;  4I1O B;  1EHK B;  3ECS A;  5F8U A;  2XLM A;  3I5P A;  1KTM A;  1LPE A;  3VHZ A;  4MTO A;  3G50 A;  5DS6 A;  3SXZ A;  5FJG A;  2WZG A;  1J8M F;  1GU8 A;  4JW1 A;  1APC A;  2YQY A;  4CX9 A;  1MGY A;  3C8G B;  3IEE A;  3KPH A;  3OE0 A;  4IWB A;  2IYL D;  3GEI A;  5T3W A;  2LQG A;  3DD7 A;  2QE9 A;  2XXA A;  5L0F A;  2J0W A;  4LDE A;  4EWC A;  3DI5 A;  2Q3T A;  1YDI A;  4G7R B;  5G2D A;  4MD1 A;  1J8Y F;  3UTV A;  1H6G A;  3A7K A;  3LAY A;  1BRX A;  3P0G A;  4DJ9 A;  3EG9 B;  1OCC C;  1NU7 D;  3DAG A;  4G0H A;  3EFO A;  4N6C A;  1RCP A;  2XLE A;  2YKZ A;  2CGE A;  3S3B B;  1HY5 A;  3QVY A;  3EGD A;  3IQC A;  1KG8 A;  3B9Q A;  1S7Z A;  2WVN A;  2R7X A;  3GEH A;  3X3B A;  1X0I 1;  3GOD A;  3NYJ A;  1Z7Q c;  4XLN F;  4TL3 A;  4K1O A;  2Y39 A;  1ZW3 A;  4DRJ B;  3HNI A;  2M64 A;  2R02 A;  1S53 A;  3OE8 A;  4YL0 A;  3J06 A;  3GM1 A;  2BC5 A;  4P9T A;  4CS8 A;  3ZTM A;  4H54 A;  2YCY A;  2IXO A;  3EH1 A;  1NBB A;  4BJ6 C;  5A45 A;  1OKK A;  4ANJ A;  5GPG B;  4G7H F;  3NYA A;  1WAT A;  4KNW A;  2YL0 A;  4L35 A;  4O6Y A;  5C1M A;  2TMV P;  5KYW A;  1UG7 A;  2HFI A;  1ZW2 A;  1LN6 A;  2OOC A;  2V3C C;  5E3A A;  3DE8 A;  3EPV A;  3ZEV A;  1L9H A;  4NTA A;  3AQB A;  1Z23 A;  4XWJ A;  4DBQ A;  3NRH A;  3H2U A;  4CDV A;  4JTD B;  1BDJ B;  4IAR A;  2R7T A;  1NU9 C;  3DAF A;  3QJR B;  4GP5 B;  5A44 A;  1OR2 A;  3ZVR A;  4U9E A;  1Y6D A;  2G3V A;  5EK0 A;  5ITE A;  3LUT B;  3RF3 A;  3ZSU A;  4FES A;  4PXF A;  3OA1 A;  1M2O A;  5G53 A;  3CQZ A;  4MQS A;  4MVR A;  4XXJ A;  1XZQ A;  2C03 A;  3AGT A;  2W4M A;  4EBK A;  3W4Y A;  4GEH A;  1F4Z A;  2OQM A;  3HNL A;  4C7O A;  3B29 A;  1MMG A;  3SYN A;  1ZU5 A;  2HV6 A;  1TWA A;  2YL3 A;  1QQ3 A;  2DYR C;  3KJ6 A;  4KI2 A;  2Y01 A;  3RFM A;  2XRH A;  2Y03 A;  3QJU B;  1OCZ C;  5KYN A;  4QI1 A;  3QBL A;  1JV7 A;  3S8G B;  5JUA A;  3OE6 A;  4G78 A;  4HWL A;  2VB6 A;  2XS8 A;  1LS4 A;  3PMR A;  1SR2 A;  1MNE A;  3QMK A;  2ICW G;  1MMD A;  1NLX A;  4CS8 C;  4ZLD A;  1M56 C;  4HFK B;  3KKB A;  5KYX A;  2NG1 A;  2XM4 A;  3ABM C;  4EJ4 A;  3ASO C;  2JAF A;  4X1H A;  1D1B A;  1WOL A;  3K1I A;  4JC7 A;  1LM3 B;  1Q0K A;  1EI7 A;  5DS4 A;  5A6B A;  3U5S A;  4G7S B;  1I5N A;  1UCQ A;  1A7V A;  3TJ5 A;  1QKP A;  1LI5 A;  3N0T A;  3NYM A;  1AUE A;  1U89 A;  3SXK A;  4QI0 A;  5G54 A;  3LLK A;  3M4B A;  4DBR A;  2QUP A;  3FOP A;  4WJ0 A;  4PXK A;  1AT9 A;  5L0I A;  2PF4 E;  3VW7 A;  3COC A;  2ZZL A;  3QW0 A;  2LFD A;  2Y69 C;  4CSA A;  1EQ1 A;  1EA8 A;  3GOR A;  4BJ1 A;  3X2Q C;  1M0K A;  3RZE A;  2EIL C;  1CPR A;  2HPY A;  5H2L A;  4GP4 B;  4YT2 A;  4YT8 A;  2FAP B;  3TUL A;  2X0C A;  4A4M A;  3NDB B;  1GGQ A;  1EKY A;  1CGN A;  1TFK B;  4J30 B;  5KYY A;  4JRZ A;  2YVK A;  4IAO A;  1C3W A;  3K33 A;  1XIO A;  3IHU A;  4JCH A;  2NSF A;  2XS1 A;  4MW8 A;  5H2K A;  1OCR C;  1QVX A;  2J9W A;  3DKA A;  1C17 M;  1O0A A;  2A1D D;  2PNO A;  4U5B E;  3GEE A;  2YL7 A;  3H2V A;  1WAS A;  5AZD A;  1N1C A;  3RVY A;  1T5O A;  4JQ6 A;  5F28 E;  3JYY A;  1P8U A;  4NTF A;  1VOM A;  3HAS A;  5AC5 A;  3IPM O;  3KYI A;  5H2O A;  1Z6A A;  3M4C A;  3VF0 A;  3UMH A;  1UAZ A;  3O55 A;  1FFT C;  3EZH A;  3U9M A;  3EH2 A;  3UG9 A;  4MVM A;  3FMS A;  3T4R A;  1C8S A;  2DYS C;  4O7G A;  2GAQ A;  2XXA B;  2VCC A;  1H2S A;  3DQB A;  2QNL A;  1JR8 A;  2R9R B;  3C62 A;  1E12 A;  4QDL A;  5B3S C;  4WW3 A;  1D0Z A;  2WJK A;  3K1I C;  1LE2 A;  3VM6 A;  2WVO A;  4RDA A;  1JPJ A;  2KGO A;  4XPX A;  2E87 A;  4NC3 A;  3PDM P;  5CIV A;  3EFO B;  1XZP A;  1H9G A;  5HV9 A;  2KC3 A;  2EI4 A;  1ZYR F;  2G62 A;  3IQ5 A;  3OWT A;  2OCC C;  4G7Q B;  3V7O A;  4BEM J;  5DLJ A;  3EGD B;  5B34 A;  2B0J A;  3V5Z A;  2IXP A;  3S28 A;  1LVK A;  1KU2 A;  1C02 A;  4DAJ A;  3X1O A;  3DE9 A;  2VC9 A;  3C7J A;  2L6H A;  4J32 B;  1YVI A;  4FX5 A;  5EN0 A;  4DJH A;  1G5Z A;  5BUO A;  1L7C A;  4IAQ A;  2YCW A;  2GA0 A;  4DRI B;  3B0U X;  4C3E A;  2LFF A;  2R25 A;  2VH3 A;  4OV0 A;  3Q7L A;  3RIP A;  4BEY A;  3EJN A;  4U5H A;  4IRU A;  2NUP A;  5HSW A;  1LI7 A;  4I1M A;  3QBG A;  5AC4 A;  1OW8 A;  5F5H A;  1ZHT A;  3QTH A;  3WQJ A;  5KYW B;  2Q9B A;  4E0I A;  1Z63 A;  2HUJ A;  4LDQ A;  4MVO A;  3SXM A;  2Q9C A;  3UGO A; 
#chains in the Genus database with same CATH homology
 1YYJ A;  2YDO A;  1S8J A;  5G28 A;  3HNI A;  1BRD A;  3V2Y A;  2ZFE A;  3HAR A;  3V2W A;  3OE8 A;  1S53 A;  2NTU A;  4WAV A;  2XLV A;  2J4Y A;  1DZE A;  4DS7 E;  2JAG A;  1TN5 A;  3S3C B;  2BC5 A;  4MD2 A;  3ZTM A;  5ETZ A;  3UZC A;  2YCY A;  4CDY A;  5JJN A;  1NBB A;  5A45 A;  5JLI A;  3C9L A;  4MBS A;  5JSL A;  1JAF A;  2X72 A;  3AM6 A;  3QDC A;  3NYA A;  1P8H A;  4EIY A;  1PY6 A;  2YL0 A;  3UON A;  1IW9 A;  3S8F B;  3D4S A;  4L35 A;  4GBR A;  5C1M A;  2YCX A;  1M6T A;  3QJQ B;  4GPO A;  2LNL A;  1YZC A;  5JS5 A;  1LN6 A;  2ZIY A;  3REY A;  5TGZ A;  2R4S A;  2F95 A;  5H2H A;  3DE8 A;  3ABW A;  1KG9 A;  5B6Z A;  3ZEV A;  2YLG A;  1L9H A;  5JRA A;  4X32 A;  1H68 A;  3PQR A;  2J8W A;  4BVN A;  4FAA B;  4JEA A;  2Y02 A;  4CDV A;  4LDL A;  2Y04 A;  4N4Y B;  4IAR A;  3QJR B;  4GP5 B;  4J4Q A;  5B35 A;  5A44 A;  3HNK A;  2QPE B;  1S51 A;  4U9E A;  3UTW A;  2R4R A;  2Y00 A;  2J9B A;  3PXO A;  4WGY A;  3CAP A;  5ITE A;  3UTY A;  3EH4 B;  1BM1 A;  3NY9 A;  4PXF A;  4KNF A;  3NMJ A;  1AP9 A;  4XTL A;  1FBB A;  5G53 A;  4MQS A;  4XXJ A;  3ZTZ A;  3VRC A;  5JJE A;  3AYN A;  4JKV A;  5A8E A;  1JGJ A;  1F4Z A;  1XJI A;  2VT4 A;  5AWZ A;  3HNL A;  1BBH A;  2Z73 A;  1E86 A;  2YDV A;  2YL3 A;  1QQ3 A;  1F50 A;  4CJO A;  5AX1 A;  3KJ6 A;  2Y01 A;  5H2N A;  3QVZ A;  3RFM A;  2YL1 A;  2Y03 A;  3QJU B;  5G2C A;  4QI1 A;  5AGF A;  2XLD A;  3QBL A;  1JV7 A;  3S8G B;  5JUA A;  3OE6 A;  2XLH A;  4G71 B;  1CGO A;  4HWL A;  1E84 A;  4MQT A;  5B6V A;  4ULV A;  4FBZ A;  5H2M A;  3ZPR A;  3EH3 B;  1IXF A;  2AT9 A;  3HNJ A;  1E83 A;  2XM4 A;  4EJ4 A;  5JVE A;  2JAF A;  4X1H A;  4QRY A;  4D4X A;  3NMK A;  1LM3 B;  3NS0 A;  4G7S B;  5B6Y A;  5ITC A;  4CJG A;  1UCQ A;  1S52 A;  3VG9 A;  3MBV A;  1A7V A;  2NTW A;  3EH5 B;  3AYM A;  3FOO A;  1QKP A;  5B6W A;  5DHH A;  2XL8 A;  4G72 B;  3VI0 A;  3BVD B;  1GQA A;  2YLI A;  4GRV A;  4IB4 A;  2CCY A;  1GUE A;  4XT1 A;  3M79 A;  3HAQ A;  1E0P A;  5G54 A;  4JEB A;  2QLA A;  3M4B A;  3HAO A;  3M15 A;  2XL6 A;  4N6H A;  3ZPQ A;  3FOP A;  4PXK A;  3L1M A;  1AT9 A;  2I21 A;  3VW7 A;  3COC A;  2ZZL A;  3QW0 A;  4WGZ A;  3ZQV A;  3PDS A;  4FA7 B;  1M0K A;  4QID A;  1E85 A;  4ER9 A;  5JT4 A;  3RZE A;  3OE9 A;  1CPR A;  2HPY A;  3VVK A;  3X3C A;  3QBK A;  5H2L A;  4GP4 B;  3C63 A;  1X0K 1;  2YLD A;  4L6R A;  5H2P A;  2YCZ A;  1MQV A;  4HYX A;  1S05 A;  4DKL A;  2I1X A;  5B0W A;  5DYS A;  1PXS A;  4A4M A;  1QPU A;  1FBK A;  3T45 A;  5AHY A;  1EKY A;  1CGN A;  1P8I A;  3QJT B;  4UG2 A;  4K5Y A;  5LWE A;  3QAK A;  5JJJ A;  2KSY A;  3QJS B;  1YYX A;  1CPQ A;  5B3I A;  3NSB A;  1C3W A;  4BEZ A;  1CWQ A;  1XIO A;  4BV0 A;  1S8L A;  5H2K A;  1Q5J A;  1O0A A;  3UTX A;  1XME B;  4XT3 A;  3HAP A;  1KGB A;  5H2I A;  2YL7 A;  5AZD A;  2G87 A;  3QW1 A;  4JQ6 A;  3ZQY A;  4HYJ A;  4AMI A;  1P8U A;  1Q5I A;  3HAS A;  4N4W A;  4EA3 A;  2L6X A;  4BUO A;  2KSB A;  5J7A A;  5H2O A;  4GYC A;  3M4C A;  5AX0 A;  4G70 B;  1PXR A;  3DDL A;  3SN6 R;  1UAZ A;  1JV6 A;  3COD A;  4XTO A;  4LDO A;  4KLY A;  2BRD A;  3UG9 A;  2I35 A;  2KS9 A;  1QM8 A;  4Y9H A;  2QPD B;  1C8S A;  4BWB A;  1H2S A;  3DQB A;  3PWH A;  1YZA A;  3C62 A;  1E12 A;  3ZWI A;  1QHJ A;  1VGO A;  5DHG A;  4D4N A;  4WW3 A;  2WJK A;  2RH1 A;  4U9D A;  3ODU A;  5B2N A;  1TN0 A;  3VGA A;  4GP8 B;  2WJL A;  2Z55 A;  1VJM A;  1EHK B;  5BR5 A;  5F8U A;  4NC3 A;  3QBI A;  2XLM A;  3IQ6 A;  4JR8 A;  4CDA A;  1M0M A;  3NY8 A;  1GZM A;  3U8P A;  3S3D B;  4XTN A;  3VHZ A;  2PED A;  5FJG A;  1X0S A;  2EI4 A;  1U19 A;  1GU8 A;  3EML A;  3IQ5 A;  2F93 A;  1C8R A;  4G7Q B;  1HZX A;  1APC A;  5B6X A;  1M0L A;  4CX9 A;  5B34 A;  5G36 A;  1L0M A;  256B A;  1MGY A;  2XLW A;  3OE0 A;  3NMI A;  1F88 A;  1R84 A;  3TOL A;  4UHR A;  2KSA A;  5G2A A;  4DAJ A;  3QJV B;  3HAN A;  4JE9 A;  4FPD A;  4LDE A;  3DE9 A;  5JP7 A;  2XM0 A;  2M3G A;  1S54 A;  4G7R B;  5G2D A;  4MD1 A;  5EN0 A;  4DJH A;  5BR2 A;  4AMJ A;  4IAQ A;  3UTV A;  2YCW A;  1IW6 A;  3A7K A;  1BRX A;  3P0G A;  5KKH A;  3OAX A;  4OV0 A;  3PBL A;  4BEY A;  4CIP A;  5AHZ A;  1RCP A;  2XLE A;  2I20 A;  2YKZ A;  1BRR A;  4X31 A;  1QKO A;  5H2J A;  3S3B B;  1KME A;  3QBG A;  3QVY A;  1KG8 A;  3WQJ A;  1JFP A;  3QAP A;  2XLO A;  1R2N A;  3X3B A;  1X0I 1;  3TOM A;  3C9M A;  4TL3 A;  3UZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...