4EIYA

Crystal structure of the chimeric protein of a2aar-bril in complex with zm241385 at 1.8a resolution
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
405
structure length
390
Chain Sequence
GAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Adenosine receptor A2a/Soluble cytochrome b562 chimera
publication title Structural basis for allosteric regulation of GPCRs by sodium ions.
pubmed doi rcsb
source organism Homo sapiens
total genus 173
structure length 390
sequence length 405
ec nomenclature
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4eiyA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4eiyA01
1F50A 5G54A 2XLVA 1E83A 1E84A 3UTWA 1R84A 1FBKA 2XLOA 3TOLA 5AHZA 1JV6A 1M0MA 5JVEA 1KG8A 5AX1A 4FAAB 4X1HA 1EKYA 2XLMA 1QQ3A 5A45A 5DYSA 2RH1A 4D4XA 3V2WA 2R4SA 3QBIA 4MQSA 1YZAA 3FOOA 5JJJA 5AX0A 1BBHA 1LM3B 4HYXA 2XL8A 5G36A 2YDOA 4BUOA 5JT4A 256BA 1S05A 2YKZA 4BV0A 3NY9A 4JR8A 1Q5JA 4XT1A 4CJGA 3HNKA 5F8UA 2L6XA 1GQAA 3NY8A 1JV7A 5AWZA 2YL7A 2KS9A 1CPQA 4GRVA 4XT3A 3S8GB 3ZPRA 2Y02A 2G87A 5B6XA 3T45A 2VT4A 4IARA 5H2MA 3UONA 2YL0A 1FBBA 3D4SA 1PY6A 2J8WA 3UTVA 4U9DA 1S51A 1P8HA 3HNLA 5B6YA 1KMEA 3ZWIA 3ZTZA 2J4YA 2Z55A 1NBBA 3NMKA 1LN6A 3NS0A 2R4RA 3V2YA 5H2OA 4PXKA 3M79A 4GP8B 3NSBA 4XTLA 5H2NA 4HYJA 5JUAA 4DAJA 5AGFA 4MD1A 3PXOA 2YCYA 5G2CA 2NTWA 1BRXA 4CX9A 3QJTB 4CDYA 1IW6A 2JAFA 3PBLA 4X31A 1H68A 1TN5A 5AZDA 4BEYA 5EN0A 1GZMA 4JKVA 1XJIA 1JFPA 4G72B 1F4ZA 1UAZA 1P8UA 3CAPA 3S3BB 4ER9A 4G7QB 4Y9HA 1KG9A 1JAFA 3HAPA 3QJVB 2XLHA 4BEZA 4JQ6A 4OV0A 1RCPA 4G7SB 2KSBA 2ZFEA 3S3CB 1YZCA 5B3IA 5A44A 1PXSA 3VG9A 5JRAA 2J9BA 3SN6R 3P0GA 5ITCA 5FJGA 3HNJA 3QAPA 1QKPA 1E85A 2ZZLA 3AM6A 3ZPQA 3A7KA 5JSLA 1H2SA 5H2HA 5G2AA 4BWBA 3QJUB 5JLIA 3ZEVA 4IB4A 3UZCA 1E86A 5LWEA 1S52A 1VJMA 4WGZA 3MBVA 2QPEB 2I20A 2I21A 3TOMA 4QI1A 5B6VA 3M15A 2BRDA 4GPOA 2F93A 2YL1A 3IQ6A 3QVZA 1CGOA 2YCZA 2YLGA 1S8LA 1R2NA 1CGNA 2Y04A 2XL6A 2YCWA 1APCA 2YCXA 3M4CA 4BVNA 3PDSA 3UZAA 2JAGA 3ABWA 4CJOA 3QVYA 2M3GA 4QRYA 3L1MA 4G7RB 4MQTA 1TN0A 3REYA 3WQJA 5H2JA 4JEAA 1YYJA 4WAVA 5ETZA 4CIPA 2I35A 1O0AA 2ZIYA 1QHJA 3QW1A 2WJLA 3PQRA 3UTXA 3QAKA 4XTOA 3QDCA 1M6TA 1S53A 3C63A 4XTNA 2KSYA 5KKHA 3EH5B 1QKOA 4JE9A 1M0LA 4CDAA 4N4YB 1S54A 2YLDA 1QPUA 4X32A 3HAQA 3VHZA 1F88A 4G70B 2X72A 1CPRA 4N6HA 3IQ5A 3NMJA 3RFMA 3OE6A 5H2KA 2NTUA 2WJKA 3HANA 5ITEA 5JJNA 5TGZA 2QPDB 1Q5IA 3ZQYA 3BVDB 1AT9A 4JEBA 1X0K1 3DE8A 1DZEA 4GP5B 1CWQA 1UCQA 2Y03A 3PWHA 3QW0A 4GBRA 4UG2A 1S8JA 3OE0A 5AHYA 3S3DB 4NC3A 1BRRA 2QLAA 3VRCA 2AT9A 3CODA 2KSAA 3KJ6A 2YDVA 1IXFA 4IAQA 4G71B 3M4BA 4J4QA 4KNFA 1U19A 2PEDA 3HASA 1PXRA 2XLDA 1VGOA 1HZXA 3HARA 3OE9A 3DDLA 1P8IA 2I1XA 4MBSA 3AYMA 3C9LA 5DHGA 4CDVA 1GU8A 4LDLA 4ULVA 4LDEA 3C9MA 3NYAA 3U8PA 3X3BA 4AMIA 2XLWA 1A7VA 5H2IA 3ODUA 4EJ4A 4PXFA 3C62A 3HNIA 1C3WA 5A8EA 4QIDA 5G2DA 4D4NA 3EH3B 1YYXA 5B6ZA 5B34A 3DQBA 3VI0A 4FBZA 4GYCA 4LDOA 5G28A 1X0SA 2HPYA 1AP9A 4UHRA 5B2NA 4GP4B 3QBKA 1JGJA 3X3CA 2F95A 3QBGA 3VVKA 4TL3A 2YLIA 5H2PA 4U9EA 5G53A 1L0MA 4N4WA 3NMIA 1KGBA 3EH4B 5H2LA 4WGYA 1C8SA 3EMLA 3VW7A 2BC5A 4L35A 4HWLA 4XXJA 5BR2A 3QJQB 2Y01A 2CCYA 1M0KA 5BR5A 3ZTMA 5B6WA 3ZQVA 2XLEA 1GUEA 1XIOA 3QJSB 4MD2A 2YL3A 1E0PA 2Z73A 5JS5A 4EA3A 1BM1A 2EI4A 1IW9A 5JP7A 4WW3A 3FOPA 5B35A 3OE8A 4FPDA 4DKLA 4L6RA 1MQVA 1EHKB 2XM4A 4K5YA 4DJHA 3COCA 5C1MA 3S8FB 2XM0A 5J7AA 4KLYA 1BRDA 3OAXA 5JJEA 3VGAA 3HAOA 5DHHA 1XMEB 1E12A 4FA7B 3QBLA 1MGYA 3DE9A 1C8RA 3AYNA 5B0WA 3UG9A 1QM8A 1L9HA 2Y00A 3UTYA 3QJRB 4EIYA 4A4MA 2LNLA 4AMJA 1X0I1 3RZEA
chains in the Genus database with same CATH superfamily
1F50A 2XLVA 2EPNA 3RIPA 3UTWA 2IXNA 2IM8A 3TOLA 5A69A 1JV6A 1M0MA 4YT5A 1LPEA 5JVEA 3T6JA 3K6BA 2YQYA 3LEVA 2VCCA 3AQCA 2EIJC 1RMVA 2OOCA 3NKEA 2J9VA 1G5ZA 2AWYA 3AGUA 4W8PA 2J0WA 3QBIA 1YZAA 5JJJA 1MMGA 1LM3B 4HYXA 4A2NB 2YDOA 1JRAA 1JOGA 3ABLC 5JT4A 4MTGA 256BA 3SNHA 3VYWA 2PBEA 4XT1A 4RDAA 3GANA 2G62A 2P0NA 1ZHWA 2LK4A 1Q0FA 3FAJA 1OW7A 4KNVA 4ANJA 5B6XA 3LS1A 1M2VA 2KGOA 1OCRC 3D4SA 2FFHA 2W4MA 3PMRA 1F1MA 4DS7E 2VCAA 2L81A 4JTCB 1LI5A 1RJ9B 2V3CC 3KH2A 2R7XA 3FMSA 3NMKA 1OCCC 2CNWD 5CI8A 1SMYF 3AG1C 5FZTA 5KYNA 3G50A 4O6NA 3RVZA 2L9JA 3LUTB 2WZFA 3PXOA 2YCYA 4LDQA 3UNGC 3PDMP 2PX3A 2DGJA 3QJTB 3ZSUA 4CDYA 2JAFA 3PBLA 4X31A 2VH3A 2HKVA 5EN0A 1GZMA 3OWTA 4JRZA 4G72B 4YWQA 5EGYA 3Q7LA 1F4ZA 3V5ZA 3SXMA 2IOQA 4ER9A 4G7QB 2LSEA 3QJVB 3PHF2 4JQ6A 4OV0A 2KSBA 1QLEC 1Z5ZA 5B3IA 5A44A 1PXSA 2J9BA 3SN6R 2H7OA 3POVA 3P0GA 3T6GB 5AC5A 4U5HA 5L0HA 2ZZLA 1B68A 1H2SA 2E87A 1FAPB 4BWBA 1Z6AA 1LVKA 2D4UA 3ZEVA 1ZVZA 1RJ9A 3U2LA 1LS1A 2P6VA 4OIRF 2IBFA 3U5SA 2A0BA 2H7BA 2Y3HA 3MBVA 4MVMA 1QZXA 3DI5A 2EILC 1K05A 2I21A 3U3FA 2R7RA 1LKXA 3GM1A 2L6GA 3RQEA 1CGOA 4FESA 4CS8A 2NUTB 2YLGA 3KMIA 2CDQA 4ZLCA 1R2NA 4MTFA 2Y04A 2Q4FA 2B0JA 1J8YF 2Z15A 2XSEA 2NUPA 3W8HA 4BVNA 3UR3C 2JAGA 3ABWA 4CJOA 1VMAA 1ZU5A 4I3MA 1O3UA 1PCXA 4G7RB 1TN0A 3REYA 2EINC 5A6BA 3MFNA 4ULWA 2GAQA 1NSGB 4Z9IA 4PACA 3UGOA 4WAVA 5ETZA 1KU2A 4HE8D 2J45A 2H7VC 5GPGB 2VB6A 2WJLA 5IY5C 3PQRA 2KW3C 5DQTA 2Y69C 3QAKA 3UTXA 1M6TA 4XTNA 2KSYA 4JE9A 2PNOA 1ZHZA 3LLIA 2YLDA 4HEAJ 1QPUA 1H9TA 2C04A 2Y39A 3VHZA 2AWCA 1F88A 2X72A 3EFOB 3NMJA 4C3EA 1VK5A 1VTMP 1H7IA 1MMAA 4NQFA 3RFMA 1V54C 2VC9A 2L6FA 1OCZC 4DXWA 3GORA 4K1OA 4KI2A 1M56C 3NDBB 2P61A 1Q5IA 3ZQYA 5L0JA 1TWCA 1Z7Qc 3O39A 2NUTA 2ZXRA 5E33A 2Y03A 3PWHA 1S8JA 2XS8A 2ZXPA 3I5PA 2GWWA 3S3DB 3BRJA 2AT9A 4P9TA 2YDVA 4G71B 2QNLA 1E2XA 4EKWA 2HZ8A 1U19A 3FDQA 3ZIBA 1Q0KA 2ZXOA 2PEDA 3VAYA 3HASA 2MYSA 1VGOA 3OE9A 1JR8A 3HTKC 5DHGA 3ABKC 4LDEA 2LFFA 3NYAA 1AUEA 1ZU4A 2V26A 2A68F 3NG1A 4DBRA 4YJWA 3ODUA 3ASNC 3K1HA 4LLEA 1C3WA 3NKDA 2KYHA 2R7VA 3JCUQ 5BUOA 1YYXA 2HUJA 3WHNA 1U0BB 3DQBA 1R4TA 1ORSC 3EFOA 1X0SA 2VASA 2HPYA 3N0TA 5B2NA 3NYLA 4MW8A 3TJ5A 2KC3A 2Y3DA 3QTHA 2A1DD 2I8BA 2EPMX 3AJMA 5F28E 3JRTA 2F95A 3VVKA 1G8XA 3DM9B 1A41A 2BL2A 1L0MA 2QTVA 3NMIA 1YA9A 1KGBA 4WGYA 1EA8A 3WODF 4HWLA 2R05A 5BR2A 1FFTC 3O10A 4JJGA 1M0KA 2XRHA 5B6WA 3EHNA 2YZSA 3ITFA 3JSEO 3IHUA 4IAOA 1XIOA 4PK4A 1V55C 5CI9A 1BM1A 1IW9A 5JP7A 2KNHA 4G7OF 3OE8A 4XLPF 4FPDA 1MQVA 4MVRA 4K5YA 5C1MA 2HS5A 4KNWA 4BG0A 3S8FB 2XM0A 4G78A 5JJEA 5KYYB 1SYQA 3AYNA 3B71A 4RD9A 3UTYA 3QJRB 3HKKA 1FMVA 4AMJA 1YARO 3VF0A 1NZEA 2NPUA 2R7SA 2YHSA 1HMOA 5AHZA 4E7SA 1T9KA 4XEFA 2LP4A 4Z9HA 4K7BA 1EKYA 2XLMA 1H9GA 5A45A 5DYSA 3RQGA 2EPLX 2DYSC 4XTKA 5D91A 4C7OB 4KBLA 3FOOA 1BBHA 5G36A 3CQZA 3I4UA 1I4YA 1S05A 5FCLA 3NY9A 1YJGA 4CJGA 2OEXA 1JV7A 3NYJA 1BR4A 5KYYA 3EZIA 3GWLA 4XT3A 4GRVA 2KSFA 2G87A 3RFYA 5DS4A 2L7AA 1CGME 4QI0A 1PY6A 4U9DA 1R5ID 1AVOB 4Q7CA 3RW0A 1KMEA 2J4YA 1D1AA 3EQLF 5L0IA 4E0HA 3R2PA 2ZXWC 4GP8B 3FHDA 4XTLA 5H2NA 3JRMO 3J06A 2AVKA 4HYJA 4EHPA 3WAQA 4KC9A 5KYUB 3W4YA 2NTWA 3JZ0A 4C7OA 1NG1A 2IYLD 1H68A 4G0HA 5AZDA 3DKAA 1L3PA 2OJQA 1JFPA 1XJIA 2NSGA 1UAZA 1P8UA 2MHRA 3H2UA 2EIKC 3SZRA 4HFKB 1TWGA 3FVYA 4E17A 2X0CA 4NTAA 1RCPA 3B9QA 5D92A 3S3CB 3DM5A 1YZCA 2NG1A 3VG9A 4XQ1A 1OW8A 5FJGA 3HNJA 3QAPA 1ST6A 3IQTA 3A7KA 5JSLA 4MVUA 4JIOA 4FAPB 3QJUB 3ECSA 5JLIA 1ORYA 2QY9A 3B0VC 3RQFA 4NCQA 4CBEA 1T6IA 3G4ZA 1D0YA 1TR2A 2I20A 1HW1A 1ZHXA 4XEKA 3TOMA 3X1OA 4QI1A 2BRDA 1OW6A 2OEVA 3B0UX 3C8GB 3GM3A 5KYUA 3MYFA 4N06A 3Q6MA 2M64A 1XZQA 2NSFA 3V7OA 1UFBA 1LI7A 4YT4A 3PDSA 1LS4A 2M3GA 4QRYA 3L1MA 1K40A 4OIPF 4XWJA 2WZLA 4FWVA 2KJGA 5L3QA 1RXQA 1YYJA 3DXJF 1C17M 2OQMA 1VLSA 1ZZPA 3OA1A 3U3BA 4CIPA 4QI2A 2ZIYA 3L8JA 3QW1A 2XS1A 3SYNA 4LACB 4U5GA 4R32A 2I15A 1S53A 4BJ1A 1M0LA 1V4AA 4N4YB 3KYJA 4U5BE 3CSKA 2XXAB 1T5OA 3HAQA 2Q9BA 4AX2A 4N6HA 5F5FA 2ICWG 1DOWA 2PF4E 1LE4A 3S0XA 1SF8A 2WJKA 2PP4A 4GYTA 2G3VA 5L0FA 1WN0A 3C8GA 1X0K1 3DE8A 4YL3A 1MMDA 3U8VA 3QW0A 3RYLA 3OE0A 5AHYA 1JPNA 3UGPA 4NTFA 2GFHA 1IXFA 4XLNF 3O55A 3M4BA 3UMHA 2A0UA 3EGDB 1BR1A 3E9VA 3KPHA 4PR9A 4MBSA 3AYMA 5A6JA 4JTAB 2WVOA 3X3BA 2CGEA 2D5RB 4Z9JA 2XL4A 1A7VA 2P7VA 5H2IA 1QSPA 3K66A 4BEJA 3C62A 3HNIA 5B3SC 2YVKA 4D4NA 3OEOA 3EH3B 4PFOA 4JW1A 2XXAA 3TJ6A 4GYCA 3AGTA 5G28A 4EWCA 1AP9A 4UHRA 1M57C 2W4BA 4NTBA 4J7YA 1GM5A 3QBKA 3S90A 2IXPA 4C3DA 3QBGA 2A6HF 4TL3A 1O87A 1OXKA 3SXYA 1LIHA 4O7GA 3S27A 3M1CB 4OIQF 3VW7A 4L35A 2J7PA 1YA7O 4CS7A 2CCYA 3ZTMA 4JTDB 1WGWA 3V5XA 3G4XA 4MD2A 2YL3A 3JYHA 5BQGA 3FOPA 2C03A 2HSBA 4DKLA 1EHKB 2XM4A 1BR2A 5J7AA 4H54A 3LEOA 1BRDA 3U2MA 1N1CA 2LIGA 4WJ0A 2OG2A 1TWHA 4JJFA 3UMIA 4EIYA 3A9CA 5CIVA 5G54A 2A6EF 1E83A 3LAYA 4E18A 1E84A 1R84A 5AX1A 4FAAB 1UG7A 3MLGA 2WZGA 1HE1A 4X1HA 1D0XA 3ZG1A 2RH1A 5A6KA 3RKOF 5DLJA 5DQZA 2R4SA 5AX0A 2LQGA 1FNTc 3RVYA 4GQHA 4O6YA 4BJ5C 1NU7D 2OU6A 5A6BD 3NRHA 5DS6A 2YKZA 4BV0A 4J30B 4JR8A 3HNKA 3E70C 5F8UA 3CEXA 2L6XA 5F5HA 2KS9A 1D0ZA 1WOLA 1QKRA 2Y02A 2HMQA 2VT4A 4BJ5A 4IARA 3UONA 2YL0A 1OR3A 1FBBA 1OKKA 4YT2A 3UTVA 3FAPB 5E3CA 3HNLA 4MVOA 5B6YA 4CSAC 2AP3A 2WVNA 3ZTZA 3LLKA 2Z55A 1LN6A 4PXKA 3M79A 3QMKA 3NSBA 3RF3A 1OR2A 2JX0A 5JUAA 4DAJA 4OIOF 5AGFA 4MD1A 3C7JA 2Q9AA 2R7WA 4I1OB 5G2CA 1BRXA 3I5QA 4NY3A 1IW6A 1FMWA 3K33A 4AL0A 4F4BA 3UMKA 4CSAA 3S9OA 4J32B 4XEVA 3SEOA 1TN5A 4I1MA 1M2OA 4BEYA 4DRHB 4ONSA 1IW7F 1YDIA 3IEEA 4LLCA 3EG9B 4PFPA 4Y9HA 4OINF 1JAFA 3H2VA 1RKCA 3HAPA 1TKNA 2XLHA 4G7SB 3R7CA 1PD1A 3V5YA 5ITCA 4A4AA 3LNRA 3W8IA 1QKPA 1VLTA 1HY5A 2GDCA 4LDRA 3AM6A 3ZPQA 2HJMA 5G2AA 4X0RA 4YL1A 2EPKX 2LCHA 3S84A 4E0IA 1E86A 5LWEA 1VJMA 4WGZA 5BQHA 3M15A 5B6VA 4GPOA 3AG4C 3KL4A 3QVZA 3SXKA 2YCZA 4JC7A 3MBGA 3JTLO 3IQCA 1WASA 3LS0A 4EBJA 2DB4A 2XL6A 3LESA 2YCWA 1U89A 1KTMA 2YCXA 3M4CA 3BEHA 4C3BA 3QVYA 3EG9A 1G4WR 4O6MA 1MNDA 5TJ5E 2GA0A 4MQTA 3WQJA 5H2JA 3C18A 4DVYP 2MWQA 1O0AA 4J7TA 4XTOA 3QDCA 2Q9CA 3T9OA 1PD0A 3C63A 3DZAA 3EH5B 1QKOA 5KKHA 2DYRC 1WWPA 2KK1A 5KYWB 1S54A 5A6AA 4M63A 4MS2A 2R02A 2QE9A 5T3TA 4G70B 3N24A 1C03A 3SP1A 1CPRA 3GEEA 3TK0A 3SXZA 2VCBA 3OE6A 3A11A 4Q4ZF 2NTUA 1W2WA 5ITEA 3IPMO 1IZMA 5TGZA 1Y6DA 2CNWA 2KQ9A 1C02A 1U6HA 3BVDB 1AT9A 3EHMA 4JEBA 1O5HA 3HLZA 2Q00A 1DZEA 2IXOA 1CWQA 3DD7A 4UG2A 5L0GA 4DRJB 2R25A 3VM6A 3B29A 3DJNB 2QLAA 1TFOB 3CODA 4J4QA 4KNFA 4JCZA 2OKUA 3DAGA 1RKEB 5T3WA 1HZXA 2I1XA 4PJNA 5L0CA 2Q3TA 4CDVA 5DS5A 1GU8A 4ULVA 2OCCC 3C9MA 5E2QA 4EJ4A 4PXFA 5A8EA 4QIDA 5KYWA 5B6ZA 4U5FE 5B34A 4BEMJ 2HV6A 3EPVA 4FBZA 4EUKB 4LDOA 1HMDA 2R03A 3EGXB 4GP4B 2O9XA 4FX5A 3U9JA 5L3VA 3X3CA 3GEHA 2YLIA 5H2PA 4U9EA 2AU5A 5G53A 4N4WA 1G4US 1ZW2A 3L8IA 5EHHA 4MVZA 5H2LA 3DJUB 2BC5A 4AK9A 4XXJA 3QJQB 2Y01A 1VOMA 5BR5A 1HE9A 1BDJB 1GUEA 2HV7A 2WL8A 2Z73A 1RKEA 2W9YA 4E7ZA 3S28A 4I44A 4WW3A 1FTSA 1H6GA 2BE5F 5B35A 3TQOA 1EI7A 4DJHA 4K0DA 3COCA 2PX0A 5AC4A 1YAUO 4KLYA 3Q6NA 3OAXA 1FR0A 5KYXB 2Y3BA 3VGAA 2HSQA 3DAFA 5DHHA 1XMEB 3K1IC 4JZAA 2WVQA 4RBNA 4FA7B 3QBLA 1MGYA 4MNDA 2R7UA 2NUPB 5B0WA 5HV9A 3EGXA 2Y00A 4U5EE 4XPYA 4A4MA 3RZEA 2ETSA 2YEVA 3EH2A 5K0IA 3JT1A 1FBKA 2XLOA 5COMA 3K1IA 1KG8A 1T6QA 3AQBA 3T4RA 1A7EA 2X51A 1QQ3A 4B6IA 3AOUA 4D4XA 3V2WA 4CS8C 3CAXA 2RSEB 2R7QA 1NLXA 4PJJA 1EQ1A 4MQSA 2XL8A 1SR2A 2L6HA 4YN0B 3ASOC 3U0CA 4JURI 4BUOA 2PFDA 3RH3A 1K04A 1Q5JA 4MQ9F 4CS9C 3NY8A 1GQAA 1TWAA 5KYXA 2HMZA 3LJBA 3L0IA 4YK5A 3S29A 5AWZA 1ZYRF 2YL7A 4Q5SF 2P1AA 3GODA 4YL0A 4DRIB 3AG2C 5COFA 3TD7A 1CPQA 3S8GB 3MYIA 1VYIA 1JPJA 3ZPRA 3T45A 5H2MA 3ZC4A 2R7OA 2J8WA 1OXBA 4BJTA 1S51A 1P8HA 4CS9A 4BJ6C 1Z3IX 3EGDA 3ZWIA 5L0DA 3QZCA 1NBBA 2J0XA 3NS0A 2R4RA 3V2YA 1Q0DA 5H2OA 1Q0GA 4P9FA 2H8AA 1DOVA 3C8GD 4G7HF 3Q7GA 3W2WA 3HJCA 2CYDA 4LERA 1A7DA 4CX9A 5EK0A 3F47A 2R7TA 4BJ6A 1WTYA 2Y3GA 3O6XA 4JKVA 5B1BC 3CAPA 3S3BB 2RD9A 2JD3A 3KKBA 1ZW3A 1Y4CA 3JYYA 1KG9A 3LNMB 1ORJA 4BEZA 4CIHA 5B1AC 4LDKA 3C8ZA 2ZFEA 3T6BA 2LD6A 1V74B 5JRAA 4IJJA 1KNYA 4U5DE 4WABA 2Q7RA 3FXHA 1E85A 5HSWA 3AG3C 2R9RB 4U5CE 5H2HA 1OCOC 4OD4A 1YLMA 1QVXA 4IB4A 3UZCA 1S52A 3ATPA 3F46A 2ASRA 2QPEB 1TFKB 1GGQA 1Z23A 3NYMA 2F93A 2YL1A 3IQ6A 4EBKA 2F22A 1S8LA 1XWJA 2J7PD 1CGNA 4XPWA 1ZHYA 4EBBA 3U9MA 3ZVRA 1APCA 3UZAA 2IXMA 3EH1A 2ZD9A 4P6IC 1FFHA 4JEAA 1NFNA 1I5NA 4JVSA 2W45A 2I35A 5BQIA 3KYIA 4BPMA 4IRUA 1QHJA 2HJ3A 3PCVA 1ZHTA 4CDAA 3US6A 4X32A 1T01A 2UUHA 3EJNA 3TULA 1XZPA 2EIMC 3IQ5A 4G7ZF 5COGA 1A0BA 1YVIA 5H2KA 4DVZA 3HANA 5JJNA 2QPDB 5DVWA 2ZPAA 4AE4B 1HW2A 4GP5B 1Q0MA 1UCQA 4GBRA 1VB5A 4H4KC 3DMDA 2YWAA 2J9WA 4NC3A 1BRRA 1NFOA 3VRCA 3ABMC 4MVQA 4XPXA 2KSAA 3ZDLA 3KJ6A 3N2ZB 4IAQA 4PJMA 2DI3A 1OQCA 1D1CA 4MVSA 1S7ZA 2CW0F 3L34A 4DOZA 1PXRA 2XLDA 3HARA 3DDLA 4W8KA 1P8IA 4DBQA 3C9LA 2JPUA 4LDLA 2J46A 1VYKA 3U8PA 1T6UA 2TMVP 4AMIA 4HFFB 1L7CA 2XLWA 5T1DB 3CZ6A 3GM2A 2J9UA 1NU9C 5E3AA 5G2DA 4OD5A 4AL1A 3VI0A 4N6CA 3GEIA 1OKKD 3WG7C 4DJ9A 1JGJA 1BZ4A 4QDLA 2FAPB 1MNEA 3H65A 4AE4A 4MW3A 3X2QC 3EH4B 1C8SA 3EMLA 3B0PA 1MMNA 3GWNA 1WATA 2HFIA 4ZLDA 1I4ZA 1AEPA 3ZQVA 2XLEA 4UDVA 4IWBA 2QUPA 3W2VA 1PV3A 3JSZA 3QJSB 1LE2A 4IGGA 1E0PA 5JS5A 4EA3A 3MX3A 1JMWA 2WB7A 3K7DA 2EI4A 4JCHA 1Z63A 2LFDA 2YRFA 4PJLA 1D1BA 2G3KA 4L6RA 1SZIA 4GEHA 1GS9A 4O79A 2B0HA 2EPOA 3EZHA 2UUIA 3HAOA 4YT8A 2M4EA 1E12A 3DWWA 2OJED 2A69F 3DE9A 4MTOA 1C8RA 2FGYA 3UG9A 1TQGA 1QM8A 1L9HA 1M2VB 2LNLA 1X0I1 1J8MF
chains in the Genus database with same CATH topology
1F50A 5G54A 2XLVA 1E83A 1E84A 3UTWA 1R84A 1FBKA 2XLOA 3TOLA 5AHZA 1JV6A 1M0MA 5JVEA 1KG8A 5AX1A 4FAAB 4X1HA 1EKYA 2XLMA 1QQ3A 5A45A 5DYSA 2RH1A 4D4XA 3V2WA 2R4SA 3QBIA 4MQSA 1YZAA 3FOOA 5JJJA 5AX0A 1BBHA 1LM3B 4HYXA 2XL8A 5G36A 2YDOA 4BUOA 5JT4A 256BA 1S05A 2YKZA 4BV0A 3NY9A 4JR8A 1Q5JA 4XT1A 4CJGA 3HNKA 5F8UA 2L6XA 1GQAA 3NY8A 1JV7A 5AWZA 2YL7A 2KS9A 1CPQA 4GRVA 4XT3A 3S8GB 3ZPRA 2Y02A 2G87A 5B6XA 3T45A 2VT4A 4IARA 5H2MA 3UONA 2YL0A 1FBBA 3D4SA 1PY6A 2J8WA 3UTVA 4U9DA 1S51A 4DS7E 1P8HA 3HNLA 5B6YA 1KMEA 3ZWIA 3ZTZA 2J4YA 2Z55A 1NBBA 3NMKA 1LN6A 3NS0A 2R4RA 3V2YA 5H2OA 4PXKA 3M79A 4GP8B 3NSBA 4XTLA 5H2NA 4HYJA 5JUAA 4DAJA 5AGFA 4MD1A 3PXOA 2YCYA 5G2CA 2NTWA 1BRXA 4CX9A 3QJTB 4CDYA 1IW6A 2JAFA 3PBLA 4X31A 1H68A 1TN5A 5AZDA 4BEYA 5EN0A 1GZMA 4JKVA 1XJIA 1JFPA 4G72B 1F4ZA 1UAZA 1P8UA 3CAPA 3S3BB 4ER9A 4G7QB 4Y9HA 1KG9A 1JAFA 3HAPA 3QJVB 2XLHA 4BEZA 4JQ6A 4OV0A 1RCPA 4G7SB 2KSBA 2ZFEA 3S3CB 1YZCA 5B3IA 5A44A 1PXSA 3VG9A 5JRAA 2J9BA 3SN6R 3P0GA 5ITCA 5FJGA 3HNJA 3QAPA 1QKPA 1E85A 2ZZLA 3AM6A 3ZPQA 3A7KA 5JSLA 1H2SA 5H2HA 5G2AA 4BWBA 3QJUB 5JLIA 3ZEVA 4IB4A 3UZCA 1E86A 5LWEA 1S52A 1VJMA 4WGZA 3MBVA 2QPEB 2I20A 2I21A 3TOMA 4QI1A 5B6VA 3M15A 2BRDA 4GPOA 2F93A 2YL1A 3IQ6A 3QVZA 1CGOA 2YCZA 2YLGA 1S8LA 1R2NA 1CGNA 2Y04A 2XL6A 2YCWA 1APCA 2YCXA 3M4CA 4BVNA 3PDSA 3UZAA 2JAGA 3ABWA 4CJOA 3QVYA 2M3GA 4QRYA 3L1MA 4G7RB 4MQTA 1TN0A 3REYA 3WQJA 5H2JA 4JEAA 1YYJA 4WAVA 5ETZA 4CIPA 2I35A 1O0AA 2ZIYA 1QHJA 3QW1A 2WJLA 3PQRA 3UTXA 3QAKA 4XTOA 3QDCA 1M6TA 1S53A 3C63A 4XTNA 2KSYA 5KKHA 3EH5B 1QKOA 4JE9A 1M0LA 4CDAA 4N4YB 1S54A 2YLDA 1QPUA 4X32A 3HAQA 3VHZA 1F88A 4G70B 2X72A 1CPRA 4N6HA 3IQ5A 3NMJA 3RFMA 3OE6A 5H2KA 2NTUA 2WJKA 3HANA 5ITEA 5JJNA 5TGZA 2QPDB 1Q5IA 3ZQYA 3BVDB 1AT9A 4JEBA 1X0K1 3DE8A 1DZEA 4GP5B 1CWQA 1UCQA 2Y03A 3PWHA 3QW0A 4GBRA 4UG2A 1S8JA 3OE0A 5AHYA 3S3DB 4NC3A 1BRRA 2QLAA 3VRCA 2AT9A 3CODA 2KSAA 3KJ6A 2YDVA 1IXFA 4IAQA 4G71B 3M4BA 4J4QA 4KNFA 1U19A 2PEDA 3HASA 1PXRA 2XLDA 1VGOA 1HZXA 3HARA 3OE9A 3DDLA 1P8IA 2I1XA 4MBSA 3AYMA 3C9LA 5DHGA 4CDVA 1GU8A 4LDLA 4ULVA 4LDEA 3C9MA 3NYAA 3U8PA 3X3BA 4AMIA 2XLWA 1A7VA 5H2IA 3ODUA 4EJ4A 4PXFA 3C62A 3HNIA 1C3WA 5A8EA 4QIDA 5G2DA 4D4NA 3EH3B 1YYXA 5B6ZA 5B34A 3DQBA 3VI0A 4FBZA 4GYCA 4LDOA 5G28A 1X0SA 2HPYA 1AP9A 4UHRA 5B2NA 4GP4B 3QBKA 1JGJA 3X3CA 2F95A 3QBGA 3VVKA 4TL3A 2YLIA 5H2PA 4U9EA 5G53A 1L0MA 4N4WA 3NMIA 1KGBA 3EH4B 5H2LA 4WGYA 1C8SA 3EMLA 3VW7A 2BC5A 4L35A 4HWLA 4XXJA 5BR2A 3QJQB 2Y01A 2CCYA 1M0KA 5BR5A 3ZTMA 5B6WA 3ZQVA 2XLEA 1GUEA 1XIOA 3QJSB 4MD2A 2YL3A 1E0PA 2Z73A 5JS5A 4EA3A 1BM1A 2EI4A 1IW9A 5JP7A 4WW3A 3FOPA 5B35A 3OE8A 4FPDA 4DKLA 4L6RA 1MQVA 1EHKB 2XM4A 4K5YA 4DJHA 3COCA 5C1MA 3S8FB 2XM0A 5J7AA 4KLYA 1BRDA 3OAXA 5JJEA 3VGAA 3HAOA 5DHHA 1XMEB 1E12A 4FA7B 3QBLA 1MGYA 3DE9A 1C8RA 3AYNA 5B0WA 3UG9A 1QM8A 1L9HA 2Y00A 3UTYA 3QJRB 4EIYA 4A4MA 2LNLA 4AMJA 1X0I1 3RZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F50 A;  5G54 A;  2XLV A;  1E83 A;  1E84 A;  3UTW A;  1R84 A;  1FBK A;  2XLO A;  3TOL A;  5AHZ A;  1JV6 A;  1M0M A;  5JVE A;  1KG8 A;  5AX1 A;  4FAA B;  4X1H A;  1EKY A;  2XLM A;  1QQ3 A;  5A45 A;  5DYS A;  2RH1 A;  4D4X A;  3V2W A;  2R4S A;  3QBI A;  4MQS A;  1YZA A;  3FOO A;  5JJJ A;  5AX0 A;  1BBH A;  1LM3 B;  4HYX A;  2XL8 A;  5G36 A;  2YDO A;  4BUO A;  5JT4 A;  256B A;  1S05 A;  2YKZ A;  4BV0 A;  3NY9 A;  4JR8 A;  1Q5J A;  4XT1 A;  4CJG A;  3HNK A;  5F8U A;  2L6X A;  1GQA A;  3NY8 A;  1JV7 A;  5AWZ A;  2YL7 A;  2KS9 A;  1CPQ A;  4GRV A;  4XT3 A;  3S8G B;  3ZPR A;  2Y02 A;  2G87 A;  5B6X A;  3T45 A;  2VT4 A;  4IAR A;  5H2M A;  3UON A;  2YL0 A;  1FBB A;  3D4S A;  1PY6 A;  2J8W A;  3UTV A;  4U9D A;  1S51 A;  1P8H A;  3HNL A;  5B6Y A;  1KME A;  3ZWI A;  3ZTZ A;  2J4Y A;  2Z55 A;  1NBB A;  3NMK A;  1LN6 A;  3NS0 A;  2R4R A;  3V2Y A;  5H2O A;  4PXK A;  3M79 A;  4GP8 B;  3NSB A;  4XTL A;  5H2N A;  4HYJ A;  5JUA A;  4DAJ A;  5AGF A;  4MD1 A;  3PXO A;  2YCY A;  5G2C A;  2NTW A;  1BRX A;  4CX9 A;  3QJT B;  4CDY A;  1IW6 A;  2JAF A;  3PBL A;  4X31 A;  1H68 A;  1TN5 A;  5AZD A;  4BEY A;  5EN0 A;  1GZM A;  4JKV A;  1XJI A;  1JFP A;  4G72 B;  1F4Z A;  1UAZ A;  1P8U A;  3CAP A;  3S3B B;  4ER9 A;  4G7Q B;  4Y9H A;  1KG9 A;  1JAF A;  3HAP A;  3QJV B;  2XLH A;  4BEZ A;  4JQ6 A;  4OV0 A;  1RCP A;  4G7S B;  2KSB A;  2ZFE A;  3S3C B;  1YZC A;  5B3I A;  5A44 A;  1PXS A;  3VG9 A;  5JRA A;  2J9B A;  3SN6 R;  3P0G A;  5ITC A;  5FJG A;  3HNJ A;  3QAP A;  1QKP A;  1E85 A;  2ZZL A;  3AM6 A;  3ZPQ A;  3A7K A;  5JSL A;  1H2S A;  5H2H A;  5G2A A;  4BWB A;  3QJU B;  5JLI A;  3ZEV A;  4IB4 A;  3UZC A;  1E86 A;  5LWE A;  1S52 A;  1VJM A;  4WGZ A;  3MBV A;  2QPE B;  2I20 A;  2I21 A;  3TOM A;  4QI1 A;  5B6V A;  3M15 A;  2BRD A;  4GPO A;  2F93 A;  2YL1 A;  3IQ6 A;  3QVZ A;  1CGO A;  2YCZ A;  2YLG A;  1S8L A;  1R2N A;  1CGN A;  2Y04 A;  2XL6 A;  2YCW A;  1APC A;  2YCX A;  3M4C A;  4BVN A;  3PDS A;  3UZA A;  2JAG A;  3ABW A;  4CJO A;  3QVY A;  2M3G A;  4QRY A;  3L1M A;  4G7R B;  4MQT A;  1TN0 A;  3REY A;  3WQJ A;  5H2J A;  4JEA A;  1YYJ A;  4WAV A;  5ETZ A;  4CIP A;  2I35 A;  1O0A A;  2ZIY A;  1QHJ A;  3QW1 A;  2WJL A;  3PQR A;  3UTX A;  3QAK A;  4XTO A;  3QDC A;  1M6T A;  1S53 A;  3C63 A;  4XTN A;  2KSY A;  5KKH A;  3EH5 B;  1QKO A;  4JE9 A;  1M0L A;  4CDA A;  4N4Y B;  1S54 A;  2YLD A;  1QPU A;  4X32 A;  3HAQ A;  3VHZ A;  1F88 A;  4G70 B;  2X72 A;  1CPR A;  4N6H A;  3IQ5 A;  3NMJ A;  3RFM A;  3OE6 A;  5H2K A;  2NTU A;  2WJK A;  3HAN A;  5ITE A;  5JJN A;  5TGZ A;  2QPD B;  1Q5I A;  3ZQY A;  3BVD B;  1AT9 A;  4JEB A;  1X0K 1;  3DE8 A;  1DZE A;  4GP5 B;  1CWQ A;  1UCQ A;  2Y03 A;  3PWH A;  3QW0 A;  4GBR A;  4UG2 A;  1S8J A;  3OE0 A;  5AHY A;  3S3D B;  4NC3 A;  1BRR A;  2QLA A;  3VRC A;  2AT9 A;  3COD A;  2KSA A;  3KJ6 A;  2YDV A;  1IXF A;  4IAQ A;  4G71 B;  3M4B A;  4J4Q A;  4KNF A;  1U19 A;  2PED A;  3HAS A;  1PXR A;  2XLD A;  1VGO A;  1HZX A;  3HAR A;  3OE9 A;  3DDL A;  1P8I A;  2I1X A;  4MBS A;  3AYM A;  3C9L A;  5DHG A;  4CDV A;  1GU8 A;  4LDL A;  4ULV A;  4LDE A;  3C9M A;  3NYA A;  3U8P A;  3X3B A;  4AMI A;  2XLW A;  1A7V A;  5H2I A;  3ODU A;  4EJ4 A;  4PXF A;  3C62 A;  3HNI A;  1C3W A;  5A8E A;  4QID A;  5G2D A;  4D4N A;  3EH3 B;  1YYX A;  5B6Z A;  5B34 A;  3DQB A;  3VI0 A;  4FBZ A;  4GYC A;  4LDO A;  5G28 A;  1X0S A;  2HPY A;  1AP9 A;  4UHR A;  5B2N A;  4GP4 B;  3QBK A;  1JGJ A;  3X3C A;  2F95 A;  3QBG A;  3VVK A;  4TL3 A;  2YLI A;  5H2P A;  4U9E A;  5G53 A;  1L0M A;  4N4W A;  3NMI A;  1KGB A;  3EH4 B;  5H2L A;  4WGY A;  1C8S A;  3EML A;  3VW7 A;  2BC5 A;  4L35 A;  4HWL A;  4XXJ A;  5BR2 A;  3QJQ B;  2Y01 A;  2CCY A;  1M0K A;  5BR5 A;  3ZTM A;  5B6W A;  3ZQV A;  2XLE A;  1GUE A;  1XIO A;  3QJS B;  4MD2 A;  2YL3 A;  1E0P A;  2Z73 A;  5JS5 A;  4EA3 A;  1BM1 A;  2EI4 A;  1IW9 A;  5JP7 A;  4WW3 A;  3FOP A;  5B35 A;  3OE8 A;  4FPD A;  4DKL A;  4L6R A;  1MQV A;  1EHK B;  2XM4 A;  4K5Y A;  4DJH A;  3COC A;  5C1M A;  3S8F B;  2XM0 A;  5J7A A;  4KLY A;  1BRD A;  3OAX A;  5JJE A;  3VGA A;  3HAO A;  5DHH A;  1XME B;  1E12 A;  4FA7 B;  3QBL A;  1MGY A;  3DE9 A;  1C8R A;  3AYN A;  5B0W A;  3UG9 A;  1QM8 A;  1L9H A;  2Y00 A;  3UTY A;  3QJR B;  4EIY A;  4A4M A;  2LNL A;  4AMJ A;  1X0I 1;  3RZE A; 
#chains in the Genus database with same CATH topology
 1F50 A;  2XLV A;  2EPN A;  3RIP A;  3UTW A;  2IXN A;  2IM8 A;  3TOL A;  5A69 A;  1JV6 A;  1M0M A;  4YT5 A;  1LPE A;  5JVE A;  3T6J A;  3K6B A;  2YQY A;  3LEV A;  2VCC A;  3AQC A;  2EIJ C;  1RMV A;  2OOC A;  3NKE A;  2J9V A;  1G5Z A;  2AWY A;  3AGU A;  4W8P A;  2J0W A;  3QBI A;  1YZA A;  5JJJ A;  1MMG A;  1LM3 B;  4HYX A;  4A2N B;  2YDO A;  1JRA A;  1JOG A;  3ABL C;  5JT4 A;  4MTG A;  256B A;  3SNH A;  3VYW A;  2PBE A;  4XT1 A;  4RDA A;  3GAN A;  2G62 A;  2P0N A;  1ZHW A;  2LK4 A;  1Q0F A;  3FAJ A;  1OW7 A;  4KNV A;  4ANJ A;  5B6X A;  3LS1 A;  1M2V A;  2KGO A;  1OCR C;  3D4S A;  2FFH A;  2W4M A;  3PMR A;  1F1M A;  4DS7 E;  2VCA A;  2L81 A;  4JTC B;  1LI5 A;  1RJ9 B;  2V3C C;  3KH2 A;  2R7X A;  3FMS A;  3NMK A;  1OCC C;  2CNW D;  5CI8 A;  1SMY F;  3AG1 C;  5FZT A;  5KYN A;  3G50 A;  4O6N A;  3RVZ A;  2L9J A;  3LUT B;  2WZF A;  3PXO A;  2YCY A;  4LDQ A;  3UNG C;  3PDM P;  2PX3 A;  2DGJ A;  3QJT B;  3ZSU A;  4CDY A;  2JAF A;  3PBL A;  4X31 A;  2VH3 A;  2HKV A;  5EN0 A;  1GZM A;  3OWT A;  4JRZ A;  4G72 B;  4YWQ A;  5EGY A;  3Q7L A;  1F4Z A;  3V5Z A;  3SXM A;  2IOQ A;  4ER9 A;  4G7Q B;  2LSE A;  3QJV B;  3PHF 2;  4JQ6 A;  4OV0 A;  2KSB A;  1QLE C;  1Z5Z A;  5B3I A;  5A44 A;  1PXS A;  2J9B A;  3SN6 R;  2H7O A;  3POV A;  3P0G A;  3T6G B;  5AC5 A;  4U5H A;  5L0H A;  2ZZL A;  1B68 A;  1H2S A;  2E87 A;  1FAP B;  4BWB A;  1Z6A A;  1LVK A;  2D4U A;  3ZEV A;  1ZVZ A;  1RJ9 A;  3U2L A;  1LS1 A;  2P6V A;  4OIR F;  2IBF A;  3U5S A;  2A0B A;  2H7B A;  2Y3H A;  3MBV A;  4MVM A;  1QZX A;  3DI5 A;  2EIL C;  1K05 A;  2I21 A;  3U3F A;  2R7R A;  1LKX A;  3GM1 A;  2L6G A;  3RQE A;  1CGO A;  4FES A;  4CS8 A;  2NUT B;  2YLG A;  3KMI A;  2CDQ A;  4ZLC A;  1R2N A;  4MTF A;  2Y04 A;  2Q4F A;  2B0J A;  1J8Y F;  2Z15 A;  2XSE A;  2NUP A;  3W8H A;  4BVN A;  3UR3 C;  2JAG A;  3ABW A;  4CJO A;  1VMA A;  1ZU5 A;  4I3M A;  1O3U A;  1PCX A;  4G7R B;  1TN0 A;  3REY A;  2EIN C;  5A6B A;  3MFN A;  4ULW A;  2GAQ A;  1NSG B;  4Z9I A;  4PAC A;  3UGO A;  4WAV A;  5ETZ A;  1KU2 A;  4HE8 D;  2J45 A;  2H7V C;  5GPG B;  2VB6 A;  2WJL A;  5IY5 C;  3PQR A;  2KW3 C;  5DQT A;  2Y69 C;  3QAK A;  3UTX A;  1M6T A;  4XTN A;  2KSY A;  4JE9 A;  2PNO A;  1ZHZ A;  3LLI A;  2YLD A;  4HEA J;  1QPU A;  1H9T A;  2C04 A;  2Y39 A;  3VHZ A;  2AWC A;  1F88 A;  2X72 A;  3EFO B;  3NMJ A;  4C3E A;  1VK5 A;  1VTM P;  1H7I A;  1MMA A;  4NQF A;  3RFM A;  1V54 C;  2VC9 A;  2L6F A;  1OCZ C;  4DXW A;  3GOR A;  4K1O A;  4KI2 A;  1M56 C;  3NDB B;  2P61 A;  1Q5I A;  3ZQY A;  5L0J A;  1TWC A;  1Z7Q c;  3O39 A;  2NUT A;  2ZXR A;  5E33 A;  2Y03 A;  3PWH A;  1S8J A;  2XS8 A;  2ZXP A;  3I5P A;  2GWW A;  3S3D B;  3BRJ A;  2AT9 A;  4P9T A;  2YDV A;  4G71 B;  2QNL A;  1E2X A;  4EKW A;  2HZ8 A;  1U19 A;  3FDQ A;  3ZIB A;  1Q0K A;  2ZXO A;  2PED A;  3VAY A;  3HAS A;  2MYS A;  1VGO A;  3OE9 A;  1JR8 A;  3HTK C;  5DHG A;  3ABK C;  4LDE A;  2LFF A;  3NYA A;  1AUE A;  1ZU4 A;  2V26 A;  2A68 F;  3NG1 A;  4DBR A;  4YJW A;  3ODU A;  3ASN C;  3K1H A;  4LLE A;  1C3W A;  3NKD A;  2KYH A;  2R7V A;  3JCU Q;  5BUO A;  1YYX A;  2HUJ A;  3WHN A;  1U0B B;  3DQB A;  1R4T A;  1ORS C;  3EFO A;  1X0S A;  2VAS A;  2HPY A;  3N0T A;  5B2N A;  3NYL A;  4MW8 A;  3TJ5 A;  2KC3 A;  2Y3D A;  3QTH A;  2A1D D;  2I8B A;  2EPM X;  3AJM A;  5F28 E;  3JRT A;  2F95 A;  3VVK A;  1G8X A;  3DM9 B;  1A41 A;  2BL2 A;  1L0M A;  2QTV A;  3NMI A;  1YA9 A;  1KGB A;  4WGY A;  1EA8 A;  3WOD F;  4HWL A;  2R05 A;  5BR2 A;  1FFT C;  3O10 A;  4JJG A;  1M0K A;  2XRH A;  5B6W A;  3EHN A;  2YZS A;  3ITF A;  3JSE O;  3IHU A;  4IAO A;  1XIO A;  4PK4 A;  1V55 C;  5CI9 A;  1BM1 A;  1IW9 A;  5JP7 A;  2KNH A;  4G7O F;  3OE8 A;  4XLP F;  4FPD A;  1MQV A;  4MVR A;  4K5Y A;  5C1M A;  2HS5 A;  4KNW A;  4BG0 A;  3S8F B;  2XM0 A;  4G78 A;  5JJE A;  5KYY B;  1SYQ A;  3AYN A;  3B71 A;  4RD9 A;  3UTY A;  3QJR B;  3HKK A;  1FMV A;  4AMJ A;  1YAR O;  3VF0 A;  1NZE A;  2NPU A;  2R7S A;  2YHS A;  1HMO A;  5AHZ A;  4E7S A;  1T9K A;  4XEF A;  2LP4 A;  4Z9H A;  4K7B A;  1EKY A;  2XLM A;  1H9G A;  5A45 A;  5DYS A;  3RQG A;  2EPL X;  2DYS C;  4XTK A;  5D91 A;  4C7O B;  4KBL A;  3FOO A;  1BBH A;  5G36 A;  3CQZ A;  3I4U A;  1I4Y A;  1S05 A;  5FCL A;  3NY9 A;  1YJG A;  4CJG A;  2OEX A;  1JV7 A;  3NYJ A;  1BR4 A;  5KYY A;  3EZI A;  3GWL A;  4XT3 A;  4GRV A;  2KSF A;  2G87 A;  3RFY A;  5DS4 A;  2L7A A;  1CGM E;  4QI0 A;  1PY6 A;  4U9D A;  1R5I D;  1AVO B;  4Q7C A;  3RW0 A;  1KME A;  2J4Y A;  1D1A A;  3EQL F;  5L0I A;  4E0H A;  3R2P A;  2ZXW C;  4GP8 B;  3FHD A;  4XTL A;  5H2N A;  3JRM O;  3J06 A;  2AVK A;  4HYJ A;  4EHP A;  3WAQ A;  4KC9 A;  5KYU B;  3W4Y A;  2NTW A;  3JZ0 A;  4C7O A;  1NG1 A;  2IYL D;  1H68 A;  4G0H A;  5AZD A;  3DKA A;  1L3P A;  2OJQ A;  1JFP A;  1XJI A;  2NSG A;  1UAZ A;  1P8U A;  2MHR A;  3H2U A;  2EIK C;  3SZR A;  4HFK B;  1TWG A;  3FVY A;  4E17 A;  2X0C A;  4NTA A;  1RCP A;  3B9Q A;  5D92 A;  3S3C B;  3DM5 A;  1YZC A;  2NG1 A;  3VG9 A;  4XQ1 A;  1OW8 A;  5FJG A;  3HNJ A;  3QAP A;  1ST6 A;  3IQT A;  3A7K A;  5JSL A;  4MVU A;  4JIO A;  4FAP B;  3QJU B;  3ECS A;  5JLI A;  1ORY A;  2QY9 A;  3B0V C;  3RQF A;  4NCQ A;  4CBE A;  1T6I A;  3G4Z A;  1D0Y A;  1TR2 A;  2I20 A;  1HW1 A;  1ZHX A;  4XEK A;  3TOM A;  3X1O A;  4QI1 A;  2BRD A;  1OW6 A;  2OEV A;  3B0U X;  3C8G B;  3GM3 A;  5KYU A;  3MYF A;  4N06 A;  3Q6M A;  2M64 A;  1XZQ A;  2NSF A;  3V7O A;  1UFB A;  1LI7 A;  4YT4 A;  3PDS A;  1LS4 A;  2M3G A;  4QRY A;  3L1M A;  1K40 A;  4OIP F;  4XWJ A;  2WZL A;  4FWV A;  2KJG A;  5L3Q A;  1RXQ A;  1YYJ A;  3DXJ F;  1C17 M;  2OQM A;  1VLS A;  1ZZP A;  3OA1 A;  3U3B A;  4CIP A;  4QI2 A;  2ZIY A;  3L8J A;  3QW1 A;  2XS1 A;  3SYN A;  4LAC B;  4U5G A;  4R32 A;  2I15 A;  1S53 A;  4BJ1 A;  1M0L A;  1V4A A;  4N4Y B;  3KYJ A;  4U5B E;  3CSK A;  2XXA B;  1T5O A;  3HAQ A;  2Q9B A;  4AX2 A;  4N6H A;  5F5F A;  2ICW G;  1DOW A;  2PF4 E;  1LE4 A;  3S0X A;  1SF8 A;  2WJK A;  2PP4 A;  4GYT A;  2G3V A;  5L0F A;  1WN0 A;  3C8G A;  1X0K 1;  3DE8 A;  4YL3 A;  1MMD A;  3U8V A;  3QW0 A;  3RYL A;  3OE0 A;  5AHY A;  1JPN A;  3UGP A;  4NTF A;  2GFH A;  1IXF A;  4XLN F;  3O55 A;  3M4B A;  3UMH A;  2A0U A;  3EGD B;  1BR1 A;  3E9V A;  3KPH A;  4PR9 A;  4MBS A;  3AYM A;  5A6J A;  4JTA B;  2WVO A;  3X3B A;  2CGE A;  2D5R B;  4Z9J A;  2XL4 A;  1A7V A;  2P7V A;  5H2I A;  1QSP A;  3K66 A;  4BEJ A;  3C62 A;  3HNI A;  5B3S C;  2YVK A;  4D4N A;  3OEO A;  3EH3 B;  4PFO A;  4JW1 A;  2XXA A;  3TJ6 A;  4GYC A;  3AGT A;  5G28 A;  4EWC A;  1AP9 A;  4UHR A;  1M57 C;  2W4B A;  4NTB A;  4J7Y A;  1GM5 A;  3QBK A;  3S90 A;  2IXP A;  4C3D A;  3QBG A;  2A6H F;  4TL3 A;  1O87 A;  1OXK A;  3SXY A;  1LIH A;  4O7G A;  3S27 A;  3M1C B;  4OIQ F;  3VW7 A;  4L35 A;  2J7P A;  1YA7 O;  4CS7 A;  2CCY A;  3ZTM A;  4JTD B;  1WGW A;  3V5X A;  3G4X A;  4MD2 A;  2YL3 A;  3JYH A;  5BQG A;  3FOP A;  2C03 A;  2HSB A;  4DKL A;  1EHK B;  2XM4 A;  1BR2 A;  5J7A A;  4H54 A;  3LEO A;  1BRD A;  3U2M A;  1N1C A;  2LIG A;  4WJ0 A;  2OG2 A;  1TWH A;  4JJF A;  3UMI A;  4EIY A;  3A9C A;  5CIV A;  5G54 A;  2A6E F;  1E83 A;  3LAY A;  4E18 A;  1E84 A;  1R84 A;  5AX1 A;  4FAA B;  1UG7 A;  3MLG A;  2WZG A;  1HE1 A;  4X1H A;  1D0X A;  3ZG1 A;  2RH1 A;  5A6K A;  3RKO F;  5DLJ A;  5DQZ A;  2R4S A;  5AX0 A;  2LQG A;  1FNT c;  3RVY A;  4GQH A;  4O6Y A;  4BJ5 C;  1NU7 D;  2OU6 A;  5A6B D;  3NRH A;  5DS6 A;  2YKZ A;  4BV0 A;  4J30 B;  4JR8 A;  3HNK A;  3E70 C;  5F8U A;  3CEX A;  2L6X A;  5F5H A;  2KS9 A;  1D0Z A;  1WOL A;  1QKR A;  2Y02 A;  2HMQ A;  2VT4 A;  4BJ5 A;  4IAR A;  3UON A;  2YL0 A;  1OR3 A;  1FBB A;  1OKK A;  4YT2 A;  3UTV A;  3FAP B;  5E3C A;  3HNL A;  4MVO A;  5B6Y A;  4CSA C;  2AP3 A;  2WVN A;  3ZTZ A;  3LLK A;  2Z55 A;  1LN6 A;  4PXK A;  3M79 A;  3QMK A;  3NSB A;  3RF3 A;  1OR2 A;  2JX0 A;  5JUA A;  4DAJ A;  4OIO F;  5AGF A;  4MD1 A;  3C7J A;  2Q9A A;  2R7W A;  4I1O B;  5G2C A;  1BRX A;  3I5Q A;  4NY3 A;  1IW6 A;  1FMW A;  3K33 A;  4AL0 A;  4F4B A;  3UMK A;  4CSA A;  3S9O A;  4J32 B;  4XEV A;  3SEO A;  1TN5 A;  4I1M A;  1M2O A;  4BEY A;  4DRH B;  4ONS A;  1IW7 F;  1YDI A;  3IEE A;  4LLC A;  3EG9 B;  4PFP A;  4Y9H A;  4OIN F;  1JAF A;  3H2V A;  1RKC A;  3HAP A;  1TKN A;  2XLH A;  4G7S B;  3R7C A;  1PD1 A;  3V5Y A;  5ITC A;  4A4A A;  3LNR A;  3W8I A;  1QKP A;  1VLT A;  1HY5 A;  2GDC A;  4LDR A;  3AM6 A;  3ZPQ A;  2HJM A;  5G2A A;  4X0R A;  4YL1 A;  2EPK X;  2LCH A;  3S84 A;  4E0I A;  1E86 A;  5LWE A;  1VJM A;  4WGZ A;  5BQH A;  3M15 A;  5B6V A;  4GPO A;  3AG4 C;  3KL4 A;  3QVZ A;  3SXK A;  2YCZ A;  4JC7 A;  3MBG A;  3JTL O;  3IQC A;  1WAS A;  3LS0 A;  4EBJ A;  2DB4 A;  2XL6 A;  3LES A;  2YCW A;  1U89 A;  1KTM A;  2YCX A;  3M4C A;  3BEH A;  4C3B A;  3QVY A;  3EG9 A;  1G4W R;  4O6M A;  1MND A;  5TJ5 E;  2GA0 A;  4MQT A;  3WQJ A;  5H2J A;  3C18 A;  4DVY P;  2MWQ A;  1O0A A;  4J7T A;  4XTO A;  3QDC A;  2Q9C A;  3T9O A;  1PD0 A;  3C63 A;  3DZA A;  3EH5 B;  1QKO A;  5KKH A;  2DYR C;  1WWP A;  2KK1 A;  5KYW B;  1S54 A;  5A6A A;  4M63 A;  4MS2 A;  2R02 A;  2QE9 A;  5T3T A;  4G70 B;  3N24 A;  1C03 A;  3SP1 A;  1CPR A;  3GEE A;  3TK0 A;  3SXZ A;  2VCB A;  3OE6 A;  3A11 A;  4Q4Z F;  2NTU A;  1W2W A;  5ITE A;  3IPM O;  1IZM A;  5TGZ A;  1Y6D A;  2CNW A;  2KQ9 A;  1C02 A;  1U6H A;  3BVD B;  1AT9 A;  3EHM A;  4JEB A;  1O5H A;  3HLZ A;  2Q00 A;  1DZE A;  2IXO A;  1CWQ A;  3DD7 A;  4UG2 A;  5L0G A;  4DRJ B;  2R25 A;  3VM6 A;  3B29 A;  3DJN B;  2QLA A;  1TFO B;  3COD A;  4J4Q A;  4KNF A;  4JCZ A;  2OKU A;  3DAG A;  1RKE B;  5T3W A;  1HZX A;  2I1X A;  4PJN A;  5L0C A;  2Q3T A;  4CDV A;  5DS5 A;  1GU8 A;  4ULV A;  2OCC C;  3C9M A;  5E2Q A;  4EJ4 A;  4PXF A;  5A8E A;  4QID A;  5KYW A;  5B6Z A;  4U5F E;  5B34 A;  4BEM J;  2HV6 A;  3EPV A;  4FBZ A;  4EUK B;  4LDO A;  1HMD A;  2R03 A;  3EGX B;  4GP4 B;  2O9X A;  4FX5 A;  3U9J A;  5L3V A;  3X3C A;  3GEH A;  2YLI A;  5H2P A;  4U9E A;  2AU5 A;  5G53 A;  4N4W A;  1G4U S;  1ZW2 A;  3L8I A;  5EHH A;  4MVZ A;  5H2L A;  3DJU B;  2BC5 A;  4AK9 A;  4XXJ A;  3QJQ B;  2Y01 A;  1VOM A;  5BR5 A;  1HE9 A;  1BDJ B;  1GUE A;  2HV7 A;  2WL8 A;  2Z73 A;  1RKE A;  2W9Y A;  4E7Z A;  3S28 A;  4I44 A;  4WW3 A;  1FTS A;  1H6G A;  2BE5 F;  5B35 A;  3TQO A;  1EI7 A;  4DJH A;  4K0D A;  3COC A;  2PX0 A;  5AC4 A;  1YAU O;  4KLY A;  3Q6N A;  3OAX A;  1FR0 A;  5KYX B;  2Y3B A;  3VGA A;  2HSQ A;  3DAF A;  5DHH A;  1XME B;  3K1I C;  4JZA A;  2WVQ A;  4RBN A;  4FA7 B;  3QBL A;  1MGY A;  4MND A;  2R7U A;  2NUP B;  5B0W A;  5HV9 A;  3EGX A;  2Y00 A;  4U5E E;  4XPY A;  4A4M A;  3RZE A;  2ETS A;  2YEV A;  3EH2 A;  5K0I A;  3JT1 A;  1FBK A;  2XLO A;  5COM A;  3K1I A;  1KG8 A;  1T6Q A;  3AQB A;  3T4R A;  1A7E A;  2X51 A;  1QQ3 A;  4B6I A;  3AOU A;  4D4X A;  3V2W A;  4CS8 C;  3CAX A;  2RSE B;  2R7Q A;  1NLX A;  4PJJ A;  1EQ1 A;  4MQS A;  2XL8 A;  1SR2 A;  2L6H A;  4YN0 B;  3ASO C;  3U0C A;  4JUR I;  4BUO A;  2PFD A;  3RH3 A;  1K04 A;  1Q5J A;  4MQ9 F;  4CS9 C;  3NY8 A;  1GQA A;  1TWA A;  5KYX A;  2HMZ A;  3LJB A;  3L0I A;  4YK5 A;  3S29 A;  5AWZ A;  1ZYR F;  2YL7 A;  4Q5S F;  2P1A A;  3GOD A;  4YL0 A;  4DRI B;  3AG2 C;  5COF A;  3TD7 A;  1CPQ A;  3S8G B;  3MYI A;  1VYI A;  1JPJ A;  3ZPR A;  3T45 A;  5H2M A;  3ZC4 A;  2R7O A;  2J8W A;  1OXB A;  4BJT A;  1S51 A;  1P8H A;  4CS9 A;  4BJ6 C;  1Z3I X;  3EGD A;  3ZWI A;  5L0D A;  3QZC A;  1NBB A;  2J0X A;  3NS0 A;  2R4R A;  3V2Y A;  1Q0D A;  5H2O A;  1Q0G A;  4P9F A;  2H8A A;  1DOV A;  3C8G D;  4G7H F;  3Q7G A;  3W2W A;  3HJC A;  2CYD A;  4LER A;  1A7D A;  4CX9 A;  5EK0 A;  3F47 A;  2R7T A;  4BJ6 A;  1WTY A;  2Y3G A;  3O6X A;  4JKV A;  5B1B C;  3CAP A;  3S3B B;  2RD9 A;  2JD3 A;  3KKB A;  1ZW3 A;  1Y4C A;  3JYY A;  1KG9 A;  3LNM B;  1ORJ A;  4BEZ A;  4CIH A;  5B1A C;  4LDK A;  3C8Z A;  2ZFE A;  3T6B A;  2LD6 A;  1V74 B;  5JRA A;  4IJJ A;  1KNY A;  4U5D E;  4WAB A;  2Q7R A;  3FXH A;  1E85 A;  5HSW A;  3AG3 C;  2R9R B;  4U5C E;  5H2H A;  1OCO C;  4OD4 A;  1YLM A;  1QVX A;  4IB4 A;  3UZC A;  1S52 A;  3ATP A;  3F46 A;  2ASR A;  2QPE B;  1TFK B;  1GGQ A;  1Z23 A;  3NYM A;  2F93 A;  2YL1 A;  3IQ6 A;  4EBK A;  2F22 A;  1S8L A;  1XWJ A;  2J7P D;  1CGN A;  4XPW A;  1ZHY A;  4EBB A;  3U9M A;  3ZVR A;  1APC A;  3UZA A;  2IXM A;  3EH1 A;  2ZD9 A;  4P6I C;  1FFH A;  4JEA A;  1NFN A;  1I5N A;  4JVS A;  2W45 A;  2I35 A;  5BQI A;  3KYI A;  4BPM A;  4IRU A;  1QHJ A;  2HJ3 A;  3PCV A;  1ZHT A;  4CDA A;  3US6 A;  4X32 A;  1T01 A;  2UUH A;  3EJN A;  3TUL A;  1XZP A;  2EIM C;  3IQ5 A;  4G7Z F;  5COG A;  1A0B A;  1YVI A;  5H2K A;  4DVZ A;  3HAN A;  5JJN A;  2QPD B;  5DVW A;  2ZPA A;  4AE4 B;  1HW2 A;  4GP5 B;  1Q0M A;  1UCQ A;  4GBR A;  1VB5 A;  4H4K C;  3DMD A;  2YWA A;  2J9W A;  4NC3 A;  1BRR A;  1NFO A;  3VRC A;  3ABM C;  4MVQ A;  4XPX A;  2KSA A;  3ZDL A;  3KJ6 A;  3N2Z B;  4IAQ A;  4PJM A;  2DI3 A;  1OQC A;  1D1C A;  4MVS A;  1S7Z A;  2CW0 F;  3L34 A;  4DOZ A;  1PXR A;  2XLD A;  3HAR A;  3DDL A;  4W8K A;  1P8I A;  4DBQ A;  3C9L A;  2JPU A;  4LDL A;  2J46 A;  1VYK A;  3U8P A;  1T6U A;  2TMV P;  4AMI A;  4HFF B;  1L7C A;  2XLW A;  5T1D B;  3CZ6 A;  3GM2 A;  2J9U A;  1NU9 C;  5E3A A;  5G2D A;  4OD5 A;  4AL1 A;  3VI0 A;  4N6C A;  3GEI A;  1OKK D;  3WG7 C;  4DJ9 A;  1JGJ A;  1BZ4 A;  4QDL A;  2FAP B;  1MNE A;  3H65 A;  4AE4 A;  4MW3 A;  3X2Q C;  3EH4 B;  1C8S A;  3EML A;  3B0P A;  1MMN A;  3GWN A;  1WAT A;  2HFI A;  4ZLD A;  1I4Z A;  1AEP A;  3ZQV A;  2XLE A;  4UDV A;  4IWB A;  2QUP A;  3W2V A;  1PV3 A;  3JSZ A;  3QJS B;  1LE2 A;  4IGG A;  1E0P A;  5JS5 A;  4EA3 A;  3MX3 A;  1JMW A;  2WB7 A;  3K7D A;  2EI4 A;  4JCH A;  1Z63 A;  2LFD A;  2YRF A;  4PJL A;  1D1B A;  2G3K A;  4L6R A;  1SZI A;  4GEH A;  1GS9 A;  4O79 A;  2B0H A;  2EPO A;  3EZH A;  2UUI A;  3HAO A;  4YT8 A;  2M4E A;  1E12 A;  3DWW A;  2OJE D;  2A69 F;  3DE9 A;  4MTO A;  1C8R A;  2FGY A;  3UG9 A;  1TQG A;  1QM8 A;  1L9H A;  1M2V B;  2LNL A;  1X0I 1;  1J8M F; 
#chains in the Genus database with same CATH homology
 1F50 A;  5G54 A;  2XLV A;  1E83 A;  1E84 A;  3UTW A;  1R84 A;  1FBK A;  2XLO A;  3TOL A;  5AHZ A;  1JV6 A;  1M0M A;  5JVE A;  1KG8 A;  5AX1 A;  4FAA B;  4X1H A;  1EKY A;  2XLM A;  1QQ3 A;  5A45 A;  5DYS A;  2RH1 A;  4D4X A;  3V2W A;  2R4S A;  3QBI A;  4MQS A;  1YZA A;  3FOO A;  5JJJ A;  5AX0 A;  1BBH A;  1LM3 B;  4HYX A;  2XL8 A;  5G36 A;  2YDO A;  4BUO A;  5JT4 A;  256B A;  1S05 A;  2YKZ A;  4BV0 A;  3NY9 A;  4JR8 A;  1Q5J A;  4XT1 A;  4CJG A;  3HNK A;  5F8U A;  2L6X A;  1GQA A;  3NY8 A;  1JV7 A;  5AWZ A;  2YL7 A;  2KS9 A;  1CPQ A;  4GRV A;  4XT3 A;  3S8G B;  3ZPR A;  2Y02 A;  2G87 A;  5B6X A;  3T45 A;  2VT4 A;  4IAR A;  5H2M A;  3UON A;  2YL0 A;  1FBB A;  3D4S A;  1PY6 A;  2J8W A;  3UTV A;  4U9D A;  1S51 A;  4DS7 E;  1P8H A;  3HNL A;  5B6Y A;  1KME A;  3ZWI A;  3ZTZ A;  2J4Y A;  2Z55 A;  1NBB A;  3NMK A;  1LN6 A;  3NS0 A;  2R4R A;  3V2Y A;  5H2O A;  4PXK A;  3M79 A;  4GP8 B;  3NSB A;  4XTL A;  5H2N A;  4HYJ A;  5JUA A;  4DAJ A;  5AGF A;  4MD1 A;  3PXO A;  2YCY A;  5G2C A;  2NTW A;  1BRX A;  4CX9 A;  3QJT B;  4CDY A;  1IW6 A;  2JAF A;  3PBL A;  4X31 A;  1H68 A;  1TN5 A;  5AZD A;  4BEY A;  5EN0 A;  1GZM A;  4JKV A;  1XJI A;  1JFP A;  4G72 B;  1F4Z A;  1UAZ A;  1P8U A;  3CAP A;  3S3B B;  4ER9 A;  4G7Q B;  4Y9H A;  1KG9 A;  1JAF A;  3HAP A;  3QJV B;  2XLH A;  4BEZ A;  4JQ6 A;  4OV0 A;  1RCP A;  4G7S B;  2KSB A;  2ZFE A;  3S3C B;  1YZC A;  5B3I A;  5A44 A;  1PXS A;  3VG9 A;  5JRA A;  2J9B A;  3SN6 R;  3P0G A;  5ITC A;  5FJG A;  3HNJ A;  3QAP A;  1QKP A;  1E85 A;  2ZZL A;  3AM6 A;  3ZPQ A;  3A7K A;  5JSL A;  1H2S A;  5H2H A;  5G2A A;  4BWB A;  3QJU B;  5JLI A;  3ZEV A;  4IB4 A;  3UZC A;  1E86 A;  5LWE A;  1S52 A;  1VJM A;  4WGZ A;  3MBV A;  2QPE B;  2I20 A;  2I21 A;  3TOM A;  4QI1 A;  5B6V A;  3M15 A;  2BRD A;  4GPO A;  2F93 A;  2YL1 A;  3IQ6 A;  3QVZ A;  1CGO A;  2YCZ A;  2YLG A;  1S8L A;  1R2N A;  1CGN A;  2Y04 A;  2XL6 A;  2YCW A;  1APC A;  2YCX A;  3M4C A;  4BVN A;  3PDS A;  3UZA A;  2JAG A;  3ABW A;  4CJO A;  3QVY A;  2M3G A;  4QRY A;  3L1M A;  4G7R B;  4MQT A;  1TN0 A;  3REY A;  3WQJ A;  5H2J A;  4JEA A;  1YYJ A;  4WAV A;  5ETZ A;  4CIP A;  2I35 A;  1O0A A;  2ZIY A;  1QHJ A;  3QW1 A;  2WJL A;  3PQR A;  3UTX A;  3QAK A;  4XTO A;  3QDC A;  1M6T A;  1S53 A;  3C63 A;  4XTN A;  2KSY A;  5KKH A;  3EH5 B;  1QKO A;  4JE9 A;  1M0L A;  4CDA A;  4N4Y B;  1S54 A;  2YLD A;  1QPU A;  4X32 A;  3HAQ A;  3VHZ A;  1F88 A;  4G70 B;  2X72 A;  1CPR A;  4N6H A;  3IQ5 A;  3NMJ A;  3RFM A;  3OE6 A;  5H2K A;  2NTU A;  2WJK A;  3HAN A;  5ITE A;  5JJN A;  5TGZ A;  2QPD B;  1Q5I A;  3ZQY A;  3BVD B;  1AT9 A;  4JEB A;  1X0K 1;  3DE8 A;  1DZE A;  4GP5 B;  1CWQ A;  1UCQ A;  2Y03 A;  3PWH A;  3QW0 A;  4GBR A;  4UG2 A;  1S8J A;  3OE0 A;  5AHY A;  3S3D B;  4NC3 A;  1BRR A;  2QLA A;  3VRC A;  2AT9 A;  3COD A;  2KSA A;  3KJ6 A;  2YDV A;  1IXF A;  4IAQ A;  4G71 B;  3M4B A;  4J4Q A;  4KNF A;  1U19 A;  2PED A;  3HAS A;  1PXR A;  2XLD A;  1VGO A;  1HZX A;  3HAR A;  3OE9 A;  3DDL A;  1P8I A;  2I1X A;  4MBS A;  3AYM A;  3C9L A;  5DHG A;  4CDV A;  1GU8 A;  4LDL A;  4ULV A;  4LDE A;  3C9M A;  3NYA A;  3U8P A;  3X3B A;  4AMI A;  2XLW A;  1A7V A;  5H2I A;  3ODU A;  4EJ4 A;  4PXF A;  3C62 A;  3HNI A;  1C3W A;  5A8E A;  4QID A;  5G2D A;  4D4N A;  3EH3 B;  1YYX A;  5B6Z A;  5B34 A;  3DQB A;  3VI0 A;  4FBZ A;  4GYC A;  4LDO A;  5G28 A;  1X0S A;  2HPY A;  1AP9 A;  4UHR A;  5B2N A;  4GP4 B;  3QBK A;  1JGJ A;  3X3C A;  2F95 A;  3QBG A;  3VVK A;  4TL3 A;  2YLI A;  5H2P A;  4U9E A;  5G53 A;  1L0M A;  4N4W A;  3NMI A;  1KGB A;  3EH4 B;  5H2L A;  4WGY A;  1C8S A;  3EML A;  3VW7 A;  2BC5 A;  4L35 A;  4HWL A;  4XXJ A;  5BR2 A;  3QJQ B;  2Y01 A;  2CCY A;  1M0K A;  5BR5 A;  3ZTM A;  5B6W A;  3ZQV A;  2XLE A;  1GUE A;  1XIO A;  3QJS B;  4MD2 A;  2YL3 A;  1E0P A;  2Z73 A;  5JS5 A;  4EA3 A;  1BM1 A;  2EI4 A;  1IW9 A;  5JP7 A;  4WW3 A;  3FOP A;  5B35 A;  3OE8 A;  4FPD A;  4DKL A;  4L6R A;  1MQV A;  1EHK B;  2XM4 A;  4K5Y A;  4DJH A;  3COC A;  5C1M A;  3S8F B;  2XM0 A;  5J7A A;  4KLY A;  1BRD A;  3OAX A;  5JJE A;  3VGA A;  3HAO A;  5DHH A;  1XME B;  1E12 A;  4FA7 B;  3QBL A;  1MGY A;  3DE9 A;  1C8R A;  3AYN A;  5B0W A;  3UG9 A;  1QM8 A;  1L9H A;  2Y00 A;  3UTY A;  3QJR B;  4EIY A;  4A4M A;  2LNL A;  4AMJ A;  1X0I 1;  3RZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...