4EIYA

Crystal structure of the chimeric protein of a2aar-bril in complex with zm241385 at 1.8a resolution
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
405
structure length
390
Chain Sequence
b'GAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine receptor A2a/Soluble cytochrome b562 chimera
molecule tags Membrane protein
source organism Homo sapiens
publication title Structural basis for allosteric regulation of GPCRs by sodium ions.
pubmed doi rcsb
total genus 173
structure length 390
sequence length 405
ec nomenclature
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4eiyA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4eiyA01
3AM6A 4GRVA 5JP7A 1EHKB 1P8HA 3HAOA 4KLYA 5G2DA 5DHGA 1S05A 3AYNA 2R4RA 1BRXA 2Y04A 5AHZA 3S3CB 1FBBA 1M0KA 4LDOA 3VGAA 1S8LA 1HZXA 4DJHA 3OE8A 4WGZA 4X32A 3OE6A 4G7SB 3S3BB 4CDVA 3HNIA 2J8WA 3SN6R 1VGOA 1P8UA 3NS0A 2J9BA 2YDOA 1JFPA 1M0MA 3VI0A 3QBKA 4G7RB 1QHJA 2KSYA 4IARA 1S53A 4FAAB 3QW0A 5JUAA 3UG9A 4ER9A 3DDLA 3NYAA 4FBZA 1QQ3A 2YL0A 4JEAA 2EI4A 3M4CA 3UZAA 3QBIA 2Y03A 1IW6A 2VT4A 5H2MA 5B6VA 4LDLA 5AX0A 4G7QB 256BA 5ITEA 1GZMA 4BV0A 1CGOA 2BC5A 4GP8B 1BRRA 2G87A 3WQJA 4XXJA 3QW1A 3C9MA 1LM3B 3REYA 5A45A 2YL7A 4JKVA 3HAPA 5JJEA 4EA3A 1TN5A 2YL3A 3PQRA 4EIYA 5EN0A 2XLHA 3L1MA 2WJLA 4BEYA 1XIOA 4GPOA 3X3BA 2I20A 4X1HA 1CPRA 3QAKA 1C8RA 3EMLA 4A4MA 4EJ4A 1IW9A 3OE9A 2L6XA 4LDEA 4MBSA 1CWQA 2NTUA 5H2PA 1YZAA 4N6HA 4GBRA 1QM8A 1JV7A 4JQ6A 1GU8A 4BVNA 3V2YA 1IXFA 5ITCA 5G2CA 4G71B 2X72A 3EH4B 4ULVA 3ABWA 5JRAA 2Y01A 1E0PA 1S52A 4U9EA 1BM1A 5H2OA 1DZEA 3PWHA 1TN0A 2Z55A 2QPDB 2M3GA 3HNLA 3QJRB 1E84A 3IQ5A 5A8EA 5JS5A 3OE0A 5AWZA 3QJTB 3NMIA 4NC3A 1M0LA 2YLDA 3NY8A 3ZQYA 2XM0A 1VJMA 5JJJA 1E85A 4GP4B 3ZQVA 5B3IA 5G54A 2F93A 4X31A 3VG9A 2KSBA 3QBGA 3QJSB 3ZTMA 5DHHA 4FA7B 5B2NA 3P0GA 5DYSA 2QPEB 3HNJA 2XM4A 4HWLA 3VHZA 1F88A 4MQTA 3X3CA 1QKPA 3DE8A 1L9HA 2YCZA 3OAXA 2YDVA 3KJ6A 2NTWA 4DKLA 4HYXA 3QBLA 3DE9A 4FPDA 3QJVB 1JV6A 1Q5JA 2I35A 2Z73A 4CJOA 5H2JA 1H2SA 4G72B 3QAPA 4MD2A 1P8IA 3NSBA 3QDCA 3EH3B 4WGYA 4Y9HA 2KSAA 2ZZLA 4AMJA 1PXRA 2BRDA 1BRDA 3HASA 2PEDA 4MD1A 1CGNA 2J4YA 5G28A 1C8SA 2QLAA 2JAFA 5B34A 2JAGA 3U8PA 1L0MA 1KMEA 1C3WA 1KG9A 3PBLA 5B35A 1XJIA 1E12A 3RZEA 4JE9A 3HARA 5B6YA 5H2KA 4JR8A 1X0I1 2XLDA 3MBVA 4N4WA 3CODA 5AX1A 1QKOA 2XLOA 3COCA 3EH5B 1E86A 4CIPA 4BUOA 2CCYA 1BBHA 1H68A 4GYCA 3HNKA 4XTOA 4CX9A 4K5YA 3C62A 2ZFEA 4HYJA 4J4QA 5BR5A 3TOLA 4U9DA 3UTWA 3QJUB 3V2WA 2XLMA 4AMIA 4PXKA 3NY9A 1MGYA 4L35A 1S54A 5BR2A 3A7KA 4UHRA 2YLIA 4D4XA 1E83A 3UTYA 2XL8A 4DAJA 3M79A 1GUEA 3M4BA 3ZPRA 1F4ZA 1JGJA 2LNLA 4CDAA 2RH1A 5TGZA 5B6WA 3ZTZA 1A7VA 2YLGA 2YL1A 4WW3A 1S51A 5FJGA 1NBBA 5KKHA 1X0K1 2XLEA 5JVEA 1F50A 5AGFA 5JSLA 4JEBA 1GQAA 1JAFA 1KG8A 1XMEB 5B6XA 1CPQA 3FOPA 3UTXA 4XT1A 5B6ZA 2I1XA 1R2NA 3T45A 4WAVA 1M6TA 3VVKA 3VRCA 1Q5IA 1QPUA 5A44A 3ZWIA 3ODUA 2XLWA 2R4SA 4GP5B 3QJQB 4N4YB 2KS9A 3PDSA 4QI1A 4IAQA 5AHYA 2YCWA 3UONA 1LN6A 1FBKA 3C9LA 4XT3A 4QIDA 1U19A 3DQBA 2HPYA 3S8FB 1YYJA 3D4SA 5H2IA 5LWEA 3NMKA 3QVYA 1PXSA 1PY6A 5F8UA 5JLIA 1YYXA 1S8JA 3UZCA 2WJKA 5AZDA 5ETZA 1X0SA 4TL3A 4OV0A 4IB4A 1KGBA 1APCA 2XLVA 5G2AA 4CJGA 4BWBA 1UCQA 1UAZA 3VW7A 5JT4A 1MQVA 3HAQA 4G70B 5H2LA 2Y00A 3PXOA 2ZIYA 5G36A 2Y02A 4CDYA 5JJNA 2I21A 3ZEVA 3RFMA 3FOOA 3S3DB 4PXFA 4XTLA 2YCYA 2AT9A 3NMJA 2YKZA 3HANA 3QVZA 3TOMA 3UTVA 1O0AA 2XL6A 5J7AA 5B0WA 4MQSA 1RCPA 3IQ6A 5G53A 4QRYA 3BVDB 1AT9A 1AP9A 2YCXA 5H2HA 2F95A 4XTNA 1YZCA 4KNFA 5H2NA 4L6RA 4UG2A 1EKYA 3AYMA 3ZPQA 3M15A 4D4NA 3C63A 4BEZA 1R84A 3CAPA 5C1MA 3S8GB
chains in the Genus database with same CATH superfamily
1FMVA 5JP7A 3UNGC 3R7CA 3N2ZB 5DHGA 3V5YA 5FZTA 1OR2A 4Z9HA 4RBNA 1FBBA 3U2MA 3IEEA 2M64A 1F1MA 1V4AA 4I44A 1C02A 4LLEA 4O6NA 3HNIA 3C8GD 3K1IC 2ASRA 1P8UA 2YDOA 1JFPA 3I4UA 1MNDA 4IARA 1S53A 5JUAA 3DMDA 5BUOA 5DS5A 4FBZA 1RXQA 2YL0A 1J8MF 4CS9C 1O3UA 3MYIA 4BJ5C 1YDIA 4NQFA 3ZIBA 1NFNA 3AG3C 2R7UA 1BR4A 3KH2A 3NYJA 1GZMA 1JMWA 1OCOC 4CS8A 3AQCA 3JSZA 3B9QA 2G87A 3QW1A 3C9MA 1D1CA 4PJLA 2MWQA 5A45A 5JJEA 4EA3A 1TN5A 4YJWA 1YARO 2EIJC 4XWJA 1DOWA 4GPOA 3AGTA 2KK1A 2GDCA 1IW7F 3T9OA 1CPRA 4I1OB 5KYXA 2AWCA 1IW9A 2L9JA 1OKKA 1FFHA 5H2PA 2KNHA 2FFHA 3EHMA 1NU7D 2WVOA 1QM8A 1GU8A 1UG7A 1WASA 3GEEA 1IXFA 3K1IA 3JRMO 4U5CE 5JRAA 4GYTA 1T6UA 1BM1A 3C7JA 1RJ9A 1LE4A 3S9OA 2R05A 5D91A 2AU5A 1SYQA 1KNYA 3G50A 3QJRB 3ZSUA 5JS5A 3QJTB 1U89A 4MVZA 1M0LA 3A9CA 3L8IA 2YLDA 4YL0A 2Q4FA 2QNLA 2W45A 5T3WA 3TQOA 4P6IC 3KMIA 5G54A 2J45A 4Z9JA 5A6KA 3VG9A 5GPGB 2L7AA 2B0HA 2HSBA 1OW8A 2EIKC 3K66A 3PCVA 5KYWA 1TFOB 2MYSA 4MW3A 3X3CA 2ZD9A 3DE8A 4JCHA 3OAXA 3KJ6A 3U8VA 3SXMA 2QUPA 4JJFA 3TJ5A 4MD2A 4E0IA 3SEOA 1QKRA 2E87A 3QDCA 4WGYA 2KSAA 2ZZLA 4G7ZF 2DYSC 1A0BA 2QLAA 5B34A 1L0MA 2KYHA 4OD4A 5CI8A 3C8ZA 4Z9IA 3Q7LA 4JR8A 4J30B 4N4WA 4QI0A 1G5ZA 4CIPA 4BUOA 4DRHB 2CCYA 1H68A 4GYCA 3SXKA 3UMHA 5A6AA 1O87A 4CX9A 4K5YA 5BR5A 4IRUA 4U9DA 3U5SA 3LNRA 2XLMA 4AMIA 4P9TA 1WATA 4K0DA 4JZAA 4HFFB 4EBJA 1S54A 3GEIA 5F28E 3CAXA 1OQCA 4YT5A 3SZRA 3B71A 2XL8A 3POVA 4U5EE 3G4ZA 2VH3A 5L3VA 3M79A 2Q00A 4GQHA 3JTLO 1NLXA 5TGZA 2J46A 4J7TA 1A7VA 2YL1A 2JPUA 4Q4ZF 4JIOA 4CSAA 4CIHA 2XLEA 3UMKA 2R7VA 5L0GA 5JSLA 1JPJA 2OKUA 2NSGA 1JAFA 1KG8A 3W2WA 3Q7GA 1Q0DA 4U5HA 2X0CA 1Z63A 3VVKA 3IPMO 1NU9C 3VRCA 5A44A 1SR2A 2OOCA 2KS9A 4QI1A 3LEOA 3GODA 3GM1A 1LIHA 2UUIA 2XSEA 2HUJA 2J7PD 2Q9BA 1QVXA 1ZU4A 3ATPA 1FBKA 2FAPB 1U19A 2PNOA 5L0JA 4R32A 4CS9A 4C3DA 3NMKA 1WWPA 3QVYA 1PD1A 4A4AA 4DRJB 5A69A 1LI7A 3NRHA 1X0SA 2WVNA 2W4BA 3DKAA 4ULWA 5AC5A 4E7ZA 5B1BC 3EGDA 3V5XA 1KGBA 2XLVA 5B3SC 2R7OA 4MVQA 1LS1A 2Q9CA 3V7OA 2I21A 3FOOA 4NY3A 3NMJA 2YKZA 2R7XA 3TOMA 3RF3A 2KSFA 2VCBA 4MQSA 1XWJA 3IQ6A 3BVDB 4AL1A 1ZW3A 2PFDA 2HZ8A 2VCAA 3CZ6A 2HJ3A 4JTAB 3CQZA 3C8GA 2V26A 3ASNC 4E18A 5H2NA 3W8IA 4L6RA 4UG2A 3AYMA 2GFHA 3RYLA 3AM6A 3HAOA 5G2DA 2J9UA 1S05A 3AYNA 2R4RA 1T01A 2QTVA 1W2WA 3HKKA 2G62A 5COFA 3AGUA 5KYYB 3DWWA 3VGAA 3AG2C 2WZLA 1S8LA 1NZEA 4IJJA 1TWGA 1VYKA 5DQTA 4WJ0A 3EZIA 4MQ9F 2CGEA 2I15A 3OE6A 2J9VA 1AUEA 3RQFA 4OIRF 4N06A 2Z15A 4QDLA 3TD7A 1VGOA 2ZXRA 2IBFA 3N24A 1BR2A 5EGYA 5BQHA 3JYHA 1MMGA 2NUTA 2OEXA 4HE8D 4DOZA 4FAAB 3QW0A 4PR9A 3UG9A 4ER9A 4FESA 3NYAA 2NSFA 4DXWA 4JEAA 3SYNA 3QBIA 4BJTA 1IW6A 2VT4A 3UGOA 3JZ0A 1VLTA 5AX0A 3L0IA 1M2VA 4B6IA 5ITEA 3LLKA 2B0JA 1CGOA 2R7SA 1BRRA 3T6GB 1Z6AA 5EK0A 3RVZA 3DM9B 2D4UA 1LM3B 3MLGA 3GWNA 3NKDA 3REYA 4OIQF 2Y3GA 4I1MA 3LS1A 3A11A 5E3CA 4YN0B 3PQRA 5EN0A 2XLHA 2WJLA 2QE9A 3X3BA 1CGME 3LJBA 4X1HA 3RVYA 1CWQA 2NTUA 1YZAA 4U5GA 1OCCC 3HTKC 4G71B 3EH4B 1G8XA 5FCLA 4BPMA 1S52A 3QZCA 4U9EA 5H2OA 2WZGA 3SXYA 2M3GA 1L3PA 4CBEA 4EBKA 2GA0A 2R25A 1B68A 3B29A 2Q7RA 2H7VC 3PMRA 3B0VC 3OE0A 5AWZA 4NC3A 4O79A 4A2NB 3NY8A 5TJ5E 3FHDA 1VJMA 1E85A 3LAYA 5KYXB 4PFPA 3ZQVA 3DXJF 4NTFA 4G7HF 3VF0A 5EHHA 1V54C 3QJSB 5DHHA 4FA7B 4PK4A 3H65A 2R7RA 1PCXA 2A1DD 5F5FA 5COGA 4MQTA 1Q0KA 2ZPAA 2NUPB 3T6BA 1UFBA 2XXAB 4JURI 1L9HA 4E17A 3NDBB 4DKLA 1AVOB 3QBLA 4PACA 4XEVA 2LSEA 4DS7E 3B0UX 3U3BA 4OIPF 4CJOA 2UUHA 5H2JA 1H2SA 1P8IA 4ZLDA 3KYJA 2A68F 3EH3B 2KQ9A 4AMJA 3U9MA 1O5HA 1PXRA 2BRDA 3HASA 1GS9A 2PEDA 1BDJB 2CW0F 5G28A 1C8SA 4DJ9A 2PX3A 1Z7Qc 2KW3C 1KMEA 1JOGA 1C3WA 4LACB 3PBLA 2KC3A 1XJIA 4BJ1A 1E12A 2DGJA 1R5ID 3IQCA 4JE9A 2LCHA 3HARA 5B6YA 4MVMA 3PHF2 1H9GA 1MMAA 4YK5A 3EH5B 1E86A 3V5ZA 3FAPB 3LNMB 1T6QA 1BBHA 4HFKB 3RQEA 1LS4A 5KYNA 2ZFEA 4HYJA 3TOLA 2EPOA 4PJJA 2YEVA 4PXKA 1SMYF 5BR2A 1VK5A 3A7KA 2HJMA 1M56C 3RFYA 2YLIA 4D4XA 4H54A 1E83A 2R7TA 4M63A 1PD0A 2P1AA 2WL8A 3M4BA 3IQTA 3KKBA 2JX0A 3KL4A 1D0XA 5B6WA 3S90A 2R7WA 2HS5A 4WW3A 1TWAA 5FJGA 1I5NA 4OD5A 4JC7A 1NFOA 4NCQA 1V74B 2ZXPA 2PX0A 3LS0A 2TMVP 3EH1A 5B6XA 2JD3A 2HSQA 1Q0FA 1R2NA 4WAVA 4LDRA 1I4YA 2YVKA 1LE2A 4YT2A 4GP5B 2C03A 3QJQB 3PDSA 4IAQA 3K33A 1MMNA 1EQ1A 4ONSA 3C9LA 4XT3A 1ZVZA 4E0HA 1BR1A 3DAGA 2A0UA 2NPUA 1PXSA 2EPKX 1PY6A 5F8UA 5JLIA 1S8JA 5KYWB 2WJKA 1LKXA 4IB4A 3DJNB 5G2AA 1LPEA 2PF4E 1D1BA 1Z3IX 1E2XA 1ZHXA 1UAZA 1ZU5A 2Y00A 1XZQA 3MFNA 2ZIYA 1TR2A 4JTCB 2Y02A 1U0BB 2EIMC 3S3DB 5AC4A 2H7BA 2I8BA 3LLIA 4IAOA 3QVZA 4AK9A 1O0AA 5J7AA 5B0WA 4FX5A 1RCPA 1VYIA 5G53A 1Q0GA 4Q7CA 1AT9A 1EI7A 4QI2A 3L8JA 3ZPQA 3W2VA 1JRAA 1Y4CA 1T9KA 3M15A 1R84A 2AP3A 5KYUB 4GRVA 4BJ6A 1P8HA 3RH3A 4KLYA 3JRTA 4YWQA 4CS8C 2F22A 2Y04A 2YQYA 3DAFA 5DVWA 3GM2A 3S3CB 2R9RB 4H4KC 3U2LA 4ANJA 1M0KA 3EGXB 2LK4A 4DJHA 2C04A 2EPNA 2ZXOA 1FAPB 2M4EA 4G7SB 3S3BB 1OR3A 1QLEC 2BE5F 2J8WA 2P7VA 4LDKA 1Z5ZA 2HV7A 2J9BA 4U5DE 1D0ZA 3QBKA 1D1AA 5COMA 3UR3C 2KSYA 2V3CC 2DYRC 4W8PA 4E7SA 2EI4A 1H6GA 5H2MA 3RIPA 4LDLA 256BA 2D5RB 4X0RA 4BV0A 2H7OA 3EFOB 3WODF 4GP8B 2OU6A 2FGYA 3WQJA 2ETSA 1K40A 1VMAA 1G4US 3AQBA 3HAPA 2PP4A 4KBLA 2J7PA 1QZXA 2YL3A 5BQIA 3H2UA 3EGDB 4BEYA 1VTMP 1U6HA 3OWTA 4MTOA 2EPLX 2I20A 3WAQA 1VLSA 3QAKA 1C8RA 3EMLA 4A4MA 2XXAA 1A41A 4LDEA 2L6GA 2IXMA 1YJGA 2Y39A 4GBRA 1RMVA 1JV7A 4JQ6A 4C7OA 4BVNA 2OG2A 3ECSA 3V2YA 4AE4A 5ITCA 2MHRA 5L0FA 3EG9A 2X72A 2VC9A 3GM3A 3DD7A 2Y01A 1BZ4A 1E0PA 4JW1A 5KYUA 3SP1A 3ABMC 1DZEA 3PWHA 1TN0A 2QPDB 5A6BD 4PJMA 4LLCA 4IGGA 5DS4A 4C7OB 4MTGA 1I4ZA 3ZQYA 3KYIA 1TKNA 2A69F 4J32B 1EA8A 1LVKA 2KSBA 1ORJA 1ZW2A 1OCZC 1ORSC 3ZTMA 4BEJA 1GGQA 5B2NA 3F46A 2HKVA 3U0CA 5DYSA 4F4BA 3EJNA 1TQGA 2XM4A 4HWLA 2HFIA 2IXOA 4XQ1A 4XPWA 3S0XA 1F88A 3R2PA 1JPNA 5A6BA 1OW7A 2NTWA 3DE9A 2EINC 4FPDA 3QJVB 3GWLA 1Q5JA 2I35A 2Z73A 3ZDLA 4UDVA 2WVQA 3RKOF 1YAUO 4EKWA 4G72B 4PFOA 3QAPA 1Q0MA 3W8HA 1HE1A 4Q5SF 1A7DA 5F5HA 2GAQA 1CGNA 2JAFA 5K0IA 3ASOC 2P61A 2IXPA 1KG9A 5B35A 3U9JA 2IYLD 3RZEA 3M1CB 2Y69C 5H2KA 3VAYA 3FAJA 4KI2A 2XLDA 4U5FE 3MBVA 2HMZA 3CODA 2OCCC 1QKOA 1M2OA 2XL4A 1ZHZA 3S27A 3COCA 5D92A 3L34A 3X2QC 1ZHTA 2J0XA 3HNKA 3VYWA 4XTOA 3C62A 3T6JA 2KGOA 3H2VA 3QJUB 3V2WA 4BJ5A 4O6YA 3KPHA 3NY9A 1MGYA 4L35A 3NYLA 4EBBA 3S28A 4C3BA 2WB7A 1K04A 5DS6A 4N6CA 2PBEA 4EUKB 3E70C 3WG7C 5HSWA 3B0PA 2R03A 4KNWA 3PDMP 4DAJA 4XLPF 1SF8A 2A6HF 1JGJA 2LNLA 3LESA 4JTDB 1OKKD 3O6XA 4CS7A 4EWCA 3ZTZA 2CDQA 1HW1A 3G4XA 1X0K1 5JVEA 3FMSA 1F50A 5AGFA 3EG9B 4JEBA 4O7GA 4FWVA 3MX3A 1XMEB 2DI3A 4I3MA 4XT1A 4MNDA 5HV9A 4RDAA 5B6ZA 2I1XA 4XLNF 3T45A 1M6TA 3EPVA 1A7EA 1WGWA 2HMQA 1OCRC 1T6IA 3ZWIA 3BRJA 1NG1A 3AOUA 2XLWA 2R4SA 4N4YB 1TWHA 1TWCA 3T4RA 3FVYA 5BQGA 5L0DA 1LN6A 4QIDA 3W4YA 3DQBA 2HPYA 5DLJA 3S8FB 4G0HA 2VCCA 5H2IA 5LWEA 4GEHA 1FTSA 2CNWA 3JT1A 3I5PA 5AZDA 1HMOA 2YHSA 1HMDA 2A6EF 4OV0A 3TULA 2YRFA 4MS2A 3JYYA 5CIVA 3LUTB 3DM5A 1OXBA 4BWBA 1UCQA 3TK0A 2RSEB 3VW7A 5JT4A 3HAQA 5H2LA 3EZHA 1T5OA 5B1AC 4XEKA 4NTAA 5G36A 4CDYA 3ZEVA 4XTLA 2YCYA 3HANA 2AVKA 3S84A 2OJED 2LFFA 3NG1A 4PJNA 4QRYA 3CEXA 1D0YA 2EILC 2RD9A 3O55A 1AP9A 2AWYA 4BG0A 1C03A 2CNWD 4BJ6C 4AE4B 5L0IA 1AEPA 2F95A 3EQLF 1JR8A 1YZCA 2VASA 4XTNA 4KNFA 4YT8A 1FMWA 3RQGA 2A0BA 4D4NA 3I5QA 4BEZA 1FR0A 1Y6DA 3S8GB 1YLMA 1ZZPA 1L7CA 1EHKB 3SNHA 2QY9A 1KU2A 2ZXWC 4KC9A 1BRXA 3UGPA 5AHZA 2KJGA 3BEHA 2DB4A 1NSGB 1MNEA 3DI5A 4LDOA 2X51A 1HZXA 2H8AA 3OE8A 1RKCA 3FDQA 4WGZA 4P9FA 4X32A 3TJ6A 4CDVA 1H9TA 3SN6R 5T1DB 3DZAA 1J8YF 3OA1A 3NS0A 1M0MA 3VI0A 3GORA 5A6JA 4G7RB 1QHJA 3UMIA 1ZYRF 1WN0A 3F47A 4K1OA 3C8GB 2LQGA 3DDLA 3VM6A 4JJGA 4XPYA 1QQ3A 2XS1A 3EFOA 3M4CA 3S29A 3UZAA 2YWAA 2Y03A 5B6VA 4G7QB 4ZLCA 5L0HA 2HV6A 2BC5A 3EHNA 2Y3DA 4XXJA 1G4WR 1ZHYA 2NUPA 2LP4A 5E33A 2G3KA 1FNTc 4O6MA 2YL7A 4JKVA 1R4TA 3AG1C 3AJMA 4KNVA 4EIYA 3L1MA 2OQMA 1XIOA 3NKEA 1YA9A 4XPXA 1LI5A 4EJ4A 3OE9A 2L6XA 4MBSA 4W8KA 4AX2A 3MYFA 3CSKA 3EGXA 4N6HA 4WABA 1ZHWA 5G2CA 2BL2A 4ULVA 3ABWA 2XS8A 2IM8A 2Z55A 3HJCA 1C17M 3US6A 3HNLA 1E84A 3IQ5A 5A8EA 1YVIA 2LIGA 3NMIA 4NTBA 2XM0A 1XZPA 2L6FA 1S7ZA 4OINF 5JJJA 1HE9A 1SZIA 4GP4B 5B3IA 4DBRA 2F93A 3OEOA 4X31A 3ZC4A 3QBGA 3K7DA 2LD6A 3MBGA 2J0WA 3P0GA 3WHNA 4MVSA 2QPEB 2P6VA 3HNJA 3VHZA 4LERA 3X1OA 3FXHA 1QKPA 1ORYA 2YCZA 1FFTC 3JSEO 3N0TA 2Y3HA 2YDVA 4HYXA 2CYDA 2Q9AA 2Y3BA 1JV6A 4JRZA 4YL1A 1VOMA 3NSBA 3Q6MA 1V55C 3K1HA 4Y9HA 1BRDA 4MD1A 3RW0A 3C18A 2J4YA 3J06A 2OEVA 1HW2A 1RKEA 2JAGA 3U8PA 4FAPB 2EPMX 1K05A 3QMKA 1N1CA 1X0I1 3AG4C 5AX1A 1OXKA 2XLOA 3NYMA 1WOLA 3Q6NA 4LDQA 4RD9A 2R7QA 1VB5A 2Q3TA 4DBQA 4J4QA 1OW6A 4CSAC 3UTWA 2OJQA 4OIOF 4YL3A 4EHPA 2G3VA 1IZMA 1M57C 4UHRA 5E3AA 4MTFA 3UTYA 1H7IA 5DQZA 5KYYA 1GUEA 2O9XA 3ZPRA 1F4ZA 3ZVRA 5E2QA 4CDAA 3DJUB 2RH1A 3QTHA 1TFKB 4MVOA 5T3TA 2YLGA 4DVYP 4JCZA 1KTMA 1S51A 3GEHA 1NBBA 5KKHA 1YA7O 4DVZA 1GQAA 5L0CA 4C3EA 1MMDA 2P0NA 1CPQA 3FOPA 3UTXA 2GWWA 3GANA 2LFDA 2IOQA 1Q5IA 1QPUA 1Z23A 1RJ9B 1QSPA 3ODUA 2XRHA 3K6BA 3HLZA 3ABLC 3IHUA 2NG1A 5AHYA 2YCWA 3UONA 2J9WA 3U3FA 1YYJA 3SXZA 3EH2A 4BEMJ 3D4SA 3JCUQ 3ABKC 1YYXA 3UZCA 5ETZA 4AL0A 5IY5C 4IWBA 4J7YA 3O39A 3ZG1A 4TL3A 4HEAJ 2IXNA 4U5BE 1M2VB 3LEVA 1APCA 3O10A 4XTKA 2W9YA 4CJGA 2WZFA 3ITFA 4MVUA 1MQVA 4G70B 4G78A 3PXOA 1WTYA 2R02A 5JJNA 1PV3A 3RFMA 2ICWG 4PXFA 1ST6A 4XEFA 4DRIB 2AT9A 2NUTB 4MVRA 2L81A 4YT4A 3UTVA 4G7OF 2XL6A 5CI9A 1DOVA 4JVSA 3E9VA 1HY5A 2YCXA 2YZSA 5H2HA 1RKEB 4K7BA 1EKYA 4MW8A 5L3QA 1GM5A 2W4MA 2VB6A 3C63A 3CAPA 5C1MA 2L6HA
chains in the Genus database with same CATH topology
3AM6A 4GRVA 5JP7A 1EHKB 1P8HA 3HAOA 4KLYA 5G2DA 5DHGA 1S05A 3AYNA 2R4RA 1BRXA 2Y04A 5AHZA 3S3CB 1FBBA 1M0KA 4LDOA 3VGAA 1S8LA 1HZXA 4DJHA 3OE8A 4WGZA 4X32A 3OE6A 4G7SB 3S3BB 4CDVA 3HNIA 2J8WA 3SN6R 1VGOA 1P8UA 3NS0A 2J9BA 2YDOA 1JFPA 1M0MA 3VI0A 3QBKA 4G7RB 1QHJA 2KSYA 4IARA 1S53A 4FAAB 3QW0A 5JUAA 3UG9A 4ER9A 3DDLA 3NYAA 4FBZA 1QQ3A 2YL0A 4JEAA 2EI4A 3M4CA 3UZAA 3QBIA 2Y03A 1IW6A 2VT4A 5H2MA 5B6VA 4LDLA 5AX0A 4G7QB 256BA 5ITEA 1GZMA 4BV0A 1CGOA 2BC5A 4GP8B 1BRRA 2G87A 3WQJA 4XXJA 3QW1A 3C9MA 1LM3B 3REYA 5A45A 2YL7A 4JKVA 3HAPA 5JJEA 4EA3A 1TN5A 2YL3A 3PQRA 4EIYA 5EN0A 2XLHA 3L1MA 2WJLA 4BEYA 1XIOA 4GPOA 3X3BA 2I20A 4X1HA 1CPRA 3QAKA 1C8RA 3EMLA 4A4MA 4EJ4A 1IW9A 3OE9A 2L6XA 4LDEA 4MBSA 1CWQA 2NTUA 5H2PA 1YZAA 4N6HA 4GBRA 1QM8A 1JV7A 4JQ6A 1GU8A 4BVNA 3V2YA 1IXFA 5ITCA 5G2CA 4G71B 2X72A 3EH4B 4ULVA 3ABWA 5JRAA 2Y01A 1E0PA 1S52A 4U9EA 1BM1A 5H2OA 1DZEA 3PWHA 1TN0A 2Z55A 2QPDB 2M3GA 3HNLA 3QJRB 1E84A 3IQ5A 5A8EA 5JS5A 3OE0A 5AWZA 3QJTB 3NMIA 4NC3A 1M0LA 2YLDA 3NY8A 3ZQYA 2XM0A 1VJMA 5JJJA 1E85A 4GP4B 3ZQVA 5B3IA 5G54A 2F93A 4X31A 3VG9A 2KSBA 3QBGA 3QJSB 3ZTMA 5DHHA 4FA7B 5B2NA 3P0GA 5DYSA 2QPEB 3HNJA 2XM4A 4HWLA 3VHZA 1F88A 4MQTA 3X3CA 1QKPA 3DE8A 1L9HA 2YCZA 3OAXA 2YDVA 3KJ6A 2NTWA 4DKLA 4HYXA 3QBLA 3DE9A 4FPDA 4DS7E 3QJVB 1JV6A 1Q5JA 2I35A 2Z73A 4CJOA 5H2JA 1H2SA 4G72B 3QAPA 4MD2A 1P8IA 3NSBA 3QDCA 3EH3B 4WGYA 4Y9HA 2KSAA 2ZZLA 4AMJA 1PXRA 2BRDA 1BRDA 3HASA 2PEDA 4MD1A 1CGNA 2J4YA 5G28A 1C8SA 2QLAA 2JAFA 5B34A 2JAGA 3U8PA 1L0MA 1KMEA 1C3WA 1KG9A 3PBLA 5B35A 1XJIA 1E12A 3RZEA 4JE9A 3HARA 5B6YA 5H2KA 4JR8A 1X0I1 2XLDA 3MBVA 4N4WA 3CODA 5AX1A 1QKOA 2XLOA 3COCA 3EH5B 1E86A 4CIPA 4BUOA 2CCYA 1BBHA 1H68A 4GYCA 3HNKA 4XTOA 4CX9A 4K5YA 3C62A 2ZFEA 4HYJA 4J4QA 5BR5A 3TOLA 4U9DA 3UTWA 3QJUB 3V2WA 2XLMA 4AMIA 4PXKA 3NY9A 1MGYA 4L35A 1S54A 5BR2A 3A7KA 4UHRA 2YLIA 4D4XA 1E83A 3UTYA 2XL8A 4DAJA 3M79A 1GUEA 3M4BA 3ZPRA 1F4ZA 1JGJA 2LNLA 4CDAA 2RH1A 5TGZA 5B6WA 3ZTZA 1A7VA 2YLGA 2YL1A 4WW3A 1S51A 5FJGA 1NBBA 5KKHA 1X0K1 2XLEA 5JVEA 1F50A 5AGFA 5JSLA 4JEBA 1GQAA 1JAFA 1KG8A 1XMEB 5B6XA 1CPQA 3FOPA 3UTXA 4XT1A 5B6ZA 2I1XA 1R2NA 3T45A 4WAVA 1M6TA 3VVKA 3VRCA 1Q5IA 1QPUA 5A44A 3ZWIA 3ODUA 2XLWA 2R4SA 4GP5B 3QJQB 4N4YB 2KS9A 3PDSA 4QI1A 4IAQA 5AHYA 2YCWA 3UONA 1LN6A 1FBKA 3C9LA 4XT3A 4QIDA 1U19A 3DQBA 2HPYA 3S8FB 1YYJA 3D4SA 5H2IA 5LWEA 3NMKA 3QVYA 1PXSA 1PY6A 5F8UA 5JLIA 1YYXA 1S8JA 3UZCA 2WJKA 5AZDA 5ETZA 1X0SA 4TL3A 4OV0A 4IB4A 1KGBA 1APCA 2XLVA 5G2AA 4CJGA 4BWBA 1UCQA 1UAZA 3VW7A 5JT4A 1MQVA 3HAQA 4G70B 5H2LA 2Y00A 3PXOA 2ZIYA 5G36A 2Y02A 4CDYA 5JJNA 2I21A 3ZEVA 3RFMA 3FOOA 3S3DB 4PXFA 4XTLA 2YCYA 2AT9A 3NMJA 2YKZA 3HANA 3QVZA 3TOMA 3UTVA 1O0AA 2XL6A 5J7AA 5B0WA 4MQSA 1RCPA 3IQ6A 5G53A 4QRYA 3BVDB 1AT9A 1AP9A 2YCXA 5H2HA 2F95A 4XTNA 1YZCA 4KNFA 5H2NA 4L6RA 4UG2A 1EKYA 3AYMA 3ZPQA 3M15A 4D4NA 3C63A 4BEZA 1R84A 3CAPA 5C1MA 3S8GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AM6 A;  4GRV A;  5JP7 A;  1EHK B;  1P8H A;  3HAO A;  4KLY A;  5G2D A;  5DHG A;  1S05 A;  3AYN A;  2R4R A;  1BRX A;  2Y04 A;  5AHZ A;  3S3C B;  1FBB A;  1M0K A;  4LDO A;  3VGA A;  1S8L A;  1HZX A;  4DJH A;  3OE8 A;  4WGZ A;  4X32 A;  3OE6 A;  4G7S B;  3S3B B;  4CDV A;  3HNI A;  2J8W A;  3SN6 R;  1VGO A;  1P8U A;  3NS0 A;  2J9B A;  2YDO A;  1JFP A;  1M0M A;  3VI0 A;  3QBK A;  4G7R B;  1QHJ A;  2KSY A;  4IAR A;  1S53 A;  4FAA B;  3QW0 A;  5JUA A;  3UG9 A;  4ER9 A;  3DDL A;  3NYA A;  4FBZ A;  1QQ3 A;  2YL0 A;  4JEA A;  2EI4 A;  3M4C A;  3UZA A;  3QBI A;  2Y03 A;  1IW6 A;  2VT4 A;  5H2M A;  5B6V A;  4LDL A;  5AX0 A;  4G7Q B;  256B A;  5ITE A;  1GZM A;  4BV0 A;  1CGO A;  2BC5 A;  4GP8 B;  1BRR A;  2G87 A;  3WQJ A;  4XXJ A;  3QW1 A;  3C9M A;  1LM3 B;  3REY A;  5A45 A;  2YL7 A;  4JKV A;  3HAP A;  5JJE A;  4EA3 A;  1TN5 A;  2YL3 A;  3PQR A;  4EIY A;  5EN0 A;  2XLH A;  3L1M A;  2WJL A;  4BEY A;  1XIO A;  4GPO A;  3X3B A;  2I20 A;  4X1H A;  1CPR A;  3QAK A;  1C8R A;  3EML A;  4A4M A;  4EJ4 A;  1IW9 A;  3OE9 A;  2L6X A;  4LDE A;  4MBS A;  1CWQ A;  2NTU A;  5H2P A;  1YZA A;  4N6H A;  4GBR A;  1QM8 A;  1JV7 A;  4JQ6 A;  1GU8 A;  4BVN A;  3V2Y A;  1IXF A;  5ITC A;  5G2C A;  4G71 B;  2X72 A;  3EH4 B;  4ULV A;  3ABW A;  5JRA A;  2Y01 A;  1E0P A;  1S52 A;  4U9E A;  1BM1 A;  5H2O A;  1DZE A;  3PWH A;  1TN0 A;  2Z55 A;  2QPD B;  2M3G A;  3HNL A;  3QJR B;  1E84 A;  3IQ5 A;  5A8E A;  5JS5 A;  3OE0 A;  5AWZ A;  3QJT B;  3NMI A;  4NC3 A;  1M0L A;  2YLD A;  3NY8 A;  3ZQY A;  2XM0 A;  1VJM A;  5JJJ A;  1E85 A;  4GP4 B;  3ZQV A;  5B3I A;  5G54 A;  2F93 A;  4X31 A;  3VG9 A;  2KSB A;  3QBG A;  3QJS B;  3ZTM A;  5DHH A;  4FA7 B;  5B2N A;  3P0G A;  5DYS A;  2QPE B;  3HNJ A;  2XM4 A;  4HWL A;  3VHZ A;  1F88 A;  4MQT A;  3X3C A;  1QKP A;  3DE8 A;  1L9H A;  2YCZ A;  3OAX A;  2YDV A;  3KJ6 A;  2NTW A;  4DKL A;  4HYX A;  3QBL A;  3DE9 A;  4FPD A;  3QJV B;  1JV6 A;  1Q5J A;  2I35 A;  2Z73 A;  4CJO A;  5H2J A;  1H2S A;  4G72 B;  3QAP A;  4MD2 A;  1P8I A;  3NSB A;  3QDC A;  3EH3 B;  4WGY A;  4Y9H A;  2KSA A;  2ZZL A;  4AMJ A;  1PXR A;  2BRD A;  1BRD A;  3HAS A;  2PED A;  4MD1 A;  1CGN A;  2J4Y A;  5G28 A;  1C8S A;  2QLA A;  2JAF A;  5B34 A;  2JAG A;  3U8P A;  1L0M A;  1KME A;  1C3W A;  1KG9 A;  3PBL A;  5B35 A;  1XJI A;  1E12 A;  3RZE A;  4JE9 A;  3HAR A;  5B6Y A;  5H2K A;  4JR8 A;  1X0I 1;  2XLD A;  3MBV A;  4N4W A;  3COD A;  5AX1 A;  1QKO A;  2XLO A;  3COC A;  3EH5 B;  1E86 A;  4CIP A;  4BUO A;  2CCY A;  1BBH A;  1H68 A;  4GYC A;  3HNK A;  4XTO A;  4CX9 A;  4K5Y A;  3C62 A;  2ZFE A;  4HYJ A;  4J4Q A;  5BR5 A;  3TOL A;  4U9D A;  3UTW A;  3QJU B;  3V2W A;  2XLM A;  4AMI A;  4PXK A;  3NY9 A;  1MGY A;  4L35 A;  1S54 A;  5BR2 A;  3A7K A;  4UHR A;  2YLI A;  4D4X A;  1E83 A;  3UTY A;  2XL8 A;  4DAJ A;  3M79 A;  1GUE A;  3M4B A;  3ZPR A;  1F4Z A;  1JGJ A;  2LNL A;  4CDA A;  2RH1 A;  5TGZ A;  5B6W A;  3ZTZ A;  1A7V A;  2YLG A;  2YL1 A;  4WW3 A;  1S51 A;  5FJG A;  1NBB A;  5KKH A;  1X0K 1;  2XLE A;  5JVE A;  1F50 A;  5AGF A;  5JSL A;  4JEB A;  1GQA A;  1JAF A;  1KG8 A;  1XME B;  5B6X A;  1CPQ A;  3FOP A;  3UTX A;  4XT1 A;  5B6Z A;  2I1X A;  1R2N A;  3T45 A;  4WAV A;  1M6T A;  3VVK A;  3VRC A;  1Q5I A;  1QPU A;  5A44 A;  3ZWI A;  3ODU A;  2XLW A;  2R4S A;  4GP5 B;  3QJQ B;  4N4Y B;  2KS9 A;  3PDS A;  4QI1 A;  4IAQ A;  5AHY A;  2YCW A;  3UON A;  1LN6 A;  1FBK A;  3C9L A;  4XT3 A;  4QID A;  1U19 A;  3DQB A;  2HPY A;  3S8F B;  1YYJ A;  3D4S A;  5H2I A;  5LWE A;  3NMK A;  3QVY A;  1PXS A;  1PY6 A;  5F8U A;  5JLI A;  1YYX A;  1S8J A;  3UZC A;  2WJK A;  5AZD A;  5ETZ A;  1X0S A;  4TL3 A;  4OV0 A;  4IB4 A;  1KGB A;  1APC A;  2XLV A;  5G2A A;  4CJG A;  4BWB A;  1UCQ A;  1UAZ A;  3VW7 A;  5JT4 A;  1MQV A;  3HAQ A;  4G70 B;  5H2L A;  2Y00 A;  3PXO A;  2ZIY A;  5G36 A;  2Y02 A;  4CDY A;  5JJN A;  2I21 A;  3ZEV A;  3RFM A;  3FOO A;  3S3D B;  4PXF A;  4XTL A;  2YCY A;  2AT9 A;  3NMJ A;  2YKZ A;  3HAN A;  3QVZ A;  3TOM A;  3UTV A;  1O0A A;  2XL6 A;  5J7A A;  5B0W A;  4MQS A;  1RCP A;  3IQ6 A;  5G53 A;  4QRY A;  3BVD B;  1AT9 A;  1AP9 A;  2YCX A;  5H2H A;  2F95 A;  4XTN A;  1YZC A;  4KNF A;  5H2N A;  4L6R A;  4UG2 A;  1EKY A;  3AYM A;  3ZPQ A;  3M15 A;  4D4N A;  3C63 A;  4BEZ A;  1R84 A;  3CAP A;  5C1M A;  3S8G B; 
#chains in the Genus database with same CATH topology
 1FMV A;  5JP7 A;  3UNG C;  3R7C A;  3N2Z B;  5DHG A;  3V5Y A;  5FZT A;  1OR2 A;  4Z9H A;  4RBN A;  1FBB A;  3U2M A;  3IEE A;  2M64 A;  1F1M A;  1V4A A;  4I44 A;  1C02 A;  4LLE A;  4O6N A;  3HNI A;  3C8G D;  3K1I C;  2ASR A;  1P8U A;  2YDO A;  1JFP A;  3I4U A;  1MND A;  4IAR A;  1S53 A;  5JUA A;  3DMD A;  5BUO A;  5DS5 A;  4FBZ A;  1RXQ A;  2YL0 A;  1J8M F;  4CS9 C;  1O3U A;  3MYI A;  4BJ5 C;  1YDI A;  4NQF A;  3ZIB A;  1NFN A;  3AG3 C;  2R7U A;  1BR4 A;  3KH2 A;  3NYJ A;  1GZM A;  1JMW A;  1OCO C;  4CS8 A;  3AQC A;  3JSZ A;  3B9Q A;  2G87 A;  3QW1 A;  3C9M A;  1D1C A;  4PJL A;  2MWQ A;  5A45 A;  5JJE A;  4EA3 A;  1TN5 A;  4YJW A;  1YAR O;  2EIJ C;  4XWJ A;  1DOW A;  4GPO A;  3AGT A;  2KK1 A;  2GDC A;  1IW7 F;  3T9O A;  1CPR A;  4I1O B;  5KYX A;  2AWC A;  1IW9 A;  2L9J A;  1OKK A;  1FFH A;  5H2P A;  2KNH A;  2FFH A;  3EHM A;  1NU7 D;  2WVO A;  1QM8 A;  1GU8 A;  1UG7 A;  1WAS A;  3GEE A;  1IXF A;  3K1I A;  3JRM O;  4U5C E;  5JRA A;  4GYT A;  1T6U A;  1BM1 A;  3C7J A;  1RJ9 A;  1LE4 A;  3S9O A;  2R05 A;  5D91 A;  2AU5 A;  1SYQ A;  1KNY A;  3G50 A;  3QJR B;  3ZSU A;  5JS5 A;  3QJT B;  1U89 A;  4MVZ A;  1M0L A;  3A9C A;  3L8I A;  2YLD A;  4YL0 A;  2Q4F A;  2QNL A;  2W45 A;  5T3W A;  3TQO A;  4P6I C;  3KMI A;  5G54 A;  2J45 A;  4Z9J A;  5A6K A;  3VG9 A;  5GPG B;  2L7A A;  2B0H A;  2HSB A;  1OW8 A;  2EIK C;  3K66 A;  3PCV A;  5KYW A;  1TFO B;  2MYS A;  4MW3 A;  3X3C A;  2ZD9 A;  3DE8 A;  4JCH A;  3OAX A;  3KJ6 A;  3U8V A;  3SXM A;  2QUP A;  4JJF A;  3TJ5 A;  4MD2 A;  4E0I A;  3SEO A;  1QKR A;  2E87 A;  3QDC A;  4WGY A;  2KSA A;  2ZZL A;  4G7Z F;  2DYS C;  1A0B A;  2QLA A;  5B34 A;  1L0M A;  2KYH A;  4OD4 A;  5CI8 A;  3C8Z A;  4Z9I A;  3Q7L A;  4JR8 A;  4J30 B;  4N4W A;  4QI0 A;  1G5Z A;  4CIP A;  4BUO A;  4DRH B;  2CCY A;  1H68 A;  4GYC A;  3SXK A;  3UMH A;  5A6A A;  1O87 A;  4CX9 A;  4K5Y A;  5BR5 A;  4IRU A;  4U9D A;  3U5S A;  3LNR A;  2XLM A;  4AMI A;  4P9T A;  1WAT A;  4K0D A;  4JZA A;  4HFF B;  4EBJ A;  1S54 A;  3GEI A;  5F28 E;  3CAX A;  1OQC A;  4YT5 A;  3SZR A;  3B71 A;  2XL8 A;  3POV A;  4U5E E;  3G4Z A;  2VH3 A;  5L3V A;  3M79 A;  2Q00 A;  4GQH A;  3JTL O;  1NLX A;  5TGZ A;  2J46 A;  4J7T A;  1A7V A;  2YL1 A;  2JPU A;  4Q4Z F;  4JIO A;  4CSA A;  4CIH A;  2XLE A;  3UMK A;  2R7V A;  5L0G A;  5JSL A;  1JPJ A;  2OKU A;  2NSG A;  1JAF A;  1KG8 A;  3W2W A;  3Q7G A;  1Q0D A;  4U5H A;  2X0C A;  1Z63 A;  3VVK A;  3IPM O;  1NU9 C;  3VRC A;  5A44 A;  1SR2 A;  2OOC A;  2KS9 A;  4QI1 A;  3LEO A;  3GOD A;  3GM1 A;  1LIH A;  2UUI A;  2XSE A;  2HUJ A;  2J7P D;  2Q9B A;  1QVX A;  1ZU4 A;  3ATP A;  1FBK A;  2FAP B;  1U19 A;  2PNO A;  5L0J A;  4R32 A;  4CS9 A;  4C3D A;  3NMK A;  1WWP A;  3QVY A;  1PD1 A;  4A4A A;  4DRJ B;  5A69 A;  1LI7 A;  3NRH A;  1X0S A;  2WVN A;  2W4B A;  3DKA A;  4ULW A;  5AC5 A;  4E7Z A;  5B1B C;  3EGD A;  3V5X A;  1KGB A;  2XLV A;  5B3S C;  2R7O A;  4MVQ A;  1LS1 A;  2Q9C A;  3V7O A;  2I21 A;  3FOO A;  4NY3 A;  3NMJ A;  2YKZ A;  2R7X A;  3TOM A;  3RF3 A;  2KSF A;  2VCB A;  4MQS A;  1XWJ A;  3IQ6 A;  3BVD B;  4AL1 A;  1ZW3 A;  2PFD A;  2HZ8 A;  2VCA A;  3CZ6 A;  2HJ3 A;  4JTA B;  3CQZ A;  3C8G A;  2V26 A;  3ASN C;  4E18 A;  5H2N A;  3W8I A;  4L6R A;  4UG2 A;  3AYM A;  2GFH A;  3RYL A;  3AM6 A;  3HAO A;  5G2D A;  2J9U A;  1S05 A;  3AYN A;  2R4R A;  1T01 A;  2QTV A;  1W2W A;  3HKK A;  2G62 A;  5COF A;  3AGU A;  5KYY B;  3DWW A;  3VGA A;  3AG2 C;  2WZL A;  1S8L A;  1NZE A;  4IJJ A;  1TWG A;  1VYK A;  5DQT A;  4WJ0 A;  3EZI A;  4MQ9 F;  2CGE A;  2I15 A;  3OE6 A;  2J9V A;  1AUE A;  3RQF A;  4OIR F;  4N06 A;  2Z15 A;  4QDL A;  3TD7 A;  1VGO A;  2ZXR A;  2IBF A;  3N24 A;  1BR2 A;  5EGY A;  5BQH A;  3JYH A;  1MMG A;  2NUT A;  2OEX A;  4HE8 D;  4DOZ A;  4FAA B;  3QW0 A;  4PR9 A;  3UG9 A;  4ER9 A;  4FES A;  3NYA A;  2NSF A;  4DXW A;  4JEA A;  3SYN A;  3QBI A;  4BJT A;  1IW6 A;  2VT4 A;  3UGO A;  3JZ0 A;  1VLT A;  5AX0 A;  3L0I A;  1M2V A;  4B6I A;  5ITE A;  3LLK A;  2B0J A;  1CGO A;  2R7S A;  1BRR A;  3T6G B;  1Z6A A;  5EK0 A;  3RVZ A;  3DM9 B;  2D4U A;  1LM3 B;  3MLG A;  3GWN A;  3NKD A;  3REY A;  4OIQ F;  2Y3G A;  4I1M A;  3LS1 A;  3A11 A;  5E3C A;  4YN0 B;  3PQR A;  5EN0 A;  2XLH A;  2WJL A;  2QE9 A;  3X3B A;  1CGM E;  3LJB A;  4X1H A;  3RVY A;  1CWQ A;  2NTU A;  1YZA A;  4U5G A;  1OCC C;  3HTK C;  4G71 B;  3EH4 B;  1G8X A;  5FCL A;  4BPM A;  1S52 A;  3QZC A;  4U9E A;  5H2O A;  2WZG A;  3SXY A;  2M3G A;  1L3P A;  4CBE A;  4EBK A;  2GA0 A;  2R25 A;  1B68 A;  3B29 A;  2Q7R A;  2H7V C;  3PMR A;  3B0V C;  3OE0 A;  5AWZ A;  4NC3 A;  4O79 A;  4A2N B;  3NY8 A;  5TJ5 E;  3FHD A;  1VJM A;  1E85 A;  3LAY A;  5KYX B;  4PFP A;  3ZQV A;  3DXJ F;  4NTF A;  4G7H F;  3VF0 A;  5EHH A;  1V54 C;  3QJS B;  5DHH A;  4FA7 B;  4PK4 A;  3H65 A;  2R7R A;  1PCX A;  2A1D D;  5F5F A;  5COG A;  4MQT A;  1Q0K A;  2ZPA A;  2NUP B;  3T6B A;  1UFB A;  2XXA B;  4JUR I;  1L9H A;  4E17 A;  3NDB B;  4DKL A;  1AVO B;  3QBL A;  4PAC A;  4XEV A;  2LSE A;  4DS7 E;  3B0U X;  3U3B A;  4OIP F;  4CJO A;  2UUH A;  5H2J A;  1H2S A;  1P8I A;  4ZLD A;  3KYJ A;  2A68 F;  3EH3 B;  2KQ9 A;  4AMJ A;  3U9M A;  1O5H A;  1PXR A;  2BRD A;  3HAS A;  1GS9 A;  2PED A;  1BDJ B;  2CW0 F;  5G28 A;  1C8S A;  4DJ9 A;  2PX3 A;  1Z7Q c;  2KW3 C;  1KME A;  1JOG A;  1C3W A;  4LAC B;  3PBL A;  2KC3 A;  1XJI A;  4BJ1 A;  1E12 A;  2DGJ A;  1R5I D;  3IQC A;  4JE9 A;  2LCH A;  3HAR A;  5B6Y A;  4MVM A;  3PHF 2;  1H9G A;  1MMA A;  4YK5 A;  3EH5 B;  1E86 A;  3V5Z A;  3FAP B;  3LNM B;  1T6Q A;  1BBH A;  4HFK B;  3RQE A;  1LS4 A;  5KYN A;  2ZFE A;  4HYJ A;  3TOL A;  2EPO A;  4PJJ A;  2YEV A;  4PXK A;  1SMY F;  5BR2 A;  1VK5 A;  3A7K A;  2HJM A;  1M56 C;  3RFY A;  2YLI A;  4D4X A;  4H54 A;  1E83 A;  2R7T A;  4M63 A;  1PD0 A;  2P1A A;  2WL8 A;  3M4B A;  3IQT A;  3KKB A;  2JX0 A;  3KL4 A;  1D0X A;  5B6W A;  3S90 A;  2R7W A;  2HS5 A;  4WW3 A;  1TWA A;  5FJG A;  1I5N A;  4OD5 A;  4JC7 A;  1NFO A;  4NCQ A;  1V74 B;  2ZXP A;  2PX0 A;  3LS0 A;  2TMV P;  3EH1 A;  5B6X A;  2JD3 A;  2HSQ A;  1Q0F A;  1R2N A;  4WAV A;  4LDR A;  1I4Y A;  2YVK A;  1LE2 A;  4YT2 A;  4GP5 B;  2C03 A;  3QJQ B;  3PDS A;  4IAQ A;  3K33 A;  1MMN A;  1EQ1 A;  4ONS A;  3C9L A;  4XT3 A;  1ZVZ A;  4E0H A;  1BR1 A;  3DAG A;  2A0U A;  2NPU A;  1PXS A;  2EPK X;  1PY6 A;  5F8U A;  5JLI A;  1S8J A;  5KYW B;  2WJK A;  1LKX A;  4IB4 A;  3DJN B;  5G2A A;  1LPE A;  2PF4 E;  1D1B A;  1Z3I X;  1E2X A;  1ZHX A;  1UAZ A;  1ZU5 A;  2Y00 A;  1XZQ A;  3MFN A;  2ZIY A;  1TR2 A;  4JTC B;  2Y02 A;  1U0B B;  2EIM C;  3S3D B;  5AC4 A;  2H7B A;  2I8B A;  3LLI A;  4IAO A;  3QVZ A;  4AK9 A;  1O0A A;  5J7A A;  5B0W A;  4FX5 A;  1RCP A;  1VYI A;  5G53 A;  1Q0G A;  4Q7C A;  1AT9 A;  1EI7 A;  4QI2 A;  3L8J A;  3ZPQ A;  3W2V A;  1JRA A;  1Y4C A;  1T9K A;  3M15 A;  1R84 A;  2AP3 A;  5KYU B;  4GRV A;  4BJ6 A;  1P8H A;  3RH3 A;  4KLY A;  3JRT A;  4YWQ A;  4CS8 C;  2F22 A;  2Y04 A;  2YQY A;  3DAF A;  5DVW A;  3GM2 A;  3S3C B;  2R9R B;  4H4K C;  3U2L A;  4ANJ A;  1M0K A;  3EGX B;  2LK4 A;  4DJH A;  2C04 A;  2EPN A;  2ZXO A;  1FAP B;  2M4E A;  4G7S B;  3S3B B;  1OR3 A;  1QLE C;  2BE5 F;  2J8W A;  2P7V A;  4LDK A;  1Z5Z A;  2HV7 A;  2J9B A;  4U5D E;  1D0Z A;  3QBK A;  1D1A A;  5COM A;  3UR3 C;  2KSY A;  2V3C C;  2DYR C;  4W8P A;  4E7S A;  2EI4 A;  1H6G A;  5H2M A;  3RIP A;  4LDL A;  256B A;  2D5R B;  4X0R A;  4BV0 A;  2H7O A;  3EFO B;  3WOD F;  4GP8 B;  2OU6 A;  2FGY A;  3WQJ A;  2ETS A;  1K40 A;  1VMA A;  1G4U S;  3AQB A;  3HAP A;  2PP4 A;  4KBL A;  2J7P A;  1QZX A;  2YL3 A;  5BQI A;  3H2U A;  3EGD B;  4BEY A;  1VTM P;  1U6H A;  3OWT A;  4MTO A;  2EPL X;  2I20 A;  3WAQ A;  1VLS A;  3QAK A;  1C8R A;  3EML A;  4A4M A;  2XXA A;  1A41 A;  4LDE A;  2L6G A;  2IXM A;  1YJG A;  2Y39 A;  4GBR A;  1RMV A;  1JV7 A;  4JQ6 A;  4C7O A;  4BVN A;  2OG2 A;  3ECS A;  3V2Y A;  4AE4 A;  5ITC A;  2MHR A;  5L0F A;  3EG9 A;  2X72 A;  2VC9 A;  3GM3 A;  3DD7 A;  2Y01 A;  1BZ4 A;  1E0P A;  4JW1 A;  5KYU A;  3SP1 A;  3ABM C;  1DZE A;  3PWH A;  1TN0 A;  2QPD B;  5A6B D;  4PJM A;  4LLC A;  4IGG A;  5DS4 A;  4C7O B;  4MTG A;  1I4Z A;  3ZQY A;  3KYI A;  1TKN A;  2A69 F;  4J32 B;  1EA8 A;  1LVK A;  2KSB A;  1ORJ A;  1ZW2 A;  1OCZ C;  1ORS C;  3ZTM A;  4BEJ A;  1GGQ A;  5B2N A;  3F46 A;  2HKV A;  3U0C A;  5DYS A;  4F4B A;  3EJN A;  1TQG A;  2XM4 A;  4HWL A;  2HFI A;  2IXO A;  4XQ1 A;  4XPW A;  3S0X A;  1F88 A;  3R2P A;  1JPN A;  5A6B A;  1OW7 A;  2NTW A;  3DE9 A;  2EIN C;  4FPD A;  3QJV B;  3GWL A;  1Q5J A;  2I35 A;  2Z73 A;  3ZDL A;  4UDV A;  2WVQ A;  3RKO F;  1YAU O;  4EKW A;  4G72 B;  4PFO A;  3QAP A;  1Q0M A;  3W8H A;  1HE1 A;  4Q5S F;  1A7D A;  5F5H A;  2GAQ A;  1CGN A;  2JAF A;  5K0I A;  3ASO C;  2P61 A;  2IXP A;  1KG9 A;  5B35 A;  3U9J A;  2IYL D;  3RZE A;  3M1C B;  2Y69 C;  5H2K A;  3VAY A;  3FAJ A;  4KI2 A;  2XLD A;  4U5F E;  3MBV A;  2HMZ A;  3COD A;  2OCC C;  1QKO A;  1M2O A;  2XL4 A;  1ZHZ A;  3S27 A;  3COC A;  5D92 A;  3L34 A;  3X2Q C;  1ZHT A;  2J0X A;  3HNK A;  3VYW A;  4XTO A;  3C62 A;  3T6J A;  2KGO A;  3H2V A;  3QJU B;  3V2W A;  4BJ5 A;  4O6Y A;  3KPH A;  3NY9 A;  1MGY A;  4L35 A;  3NYL A;  4EBB A;  3S28 A;  4C3B A;  2WB7 A;  1K04 A;  5DS6 A;  4N6C A;  2PBE A;  4EUK B;  3E70 C;  3WG7 C;  5HSW A;  3B0P A;  2R03 A;  4KNW A;  3PDM P;  4DAJ A;  4XLP F;  1SF8 A;  2A6H F;  1JGJ A;  2LNL A;  3LES A;  4JTD B;  1OKK D;  3O6X A;  4CS7 A;  4EWC A;  3ZTZ A;  2CDQ A;  1HW1 A;  3G4X A;  1X0K 1;  5JVE A;  3FMS A;  1F50 A;  5AGF A;  3EG9 B;  4JEB A;  4O7G A;  4FWV A;  3MX3 A;  1XME B;  2DI3 A;  4I3M A;  4XT1 A;  4MND A;  5HV9 A;  4RDA A;  5B6Z A;  2I1X A;  4XLN F;  3T45 A;  1M6T A;  3EPV A;  1A7E A;  1WGW A;  2HMQ A;  1OCR C;  1T6I A;  3ZWI A;  3BRJ A;  1NG1 A;  3AOU A;  2XLW A;  2R4S A;  4N4Y B;  1TWH A;  1TWC A;  3T4R A;  3FVY A;  5BQG A;  5L0D A;  1LN6 A;  4QID A;  3W4Y A;  3DQB A;  2HPY A;  5DLJ A;  3S8F B;  4G0H A;  2VCC A;  5H2I A;  5LWE A;  4GEH A;  1FTS A;  2CNW A;  3JT1 A;  3I5P A;  5AZD A;  1HMO A;  2YHS A;  1HMD A;  2A6E F;  4OV0 A;  3TUL A;  2YRF A;  4MS2 A;  3JYY A;  5CIV A;  3LUT B;  3DM5 A;  1OXB A;  4BWB A;  1UCQ A;  3TK0 A;  2RSE B;  3VW7 A;  5JT4 A;  3HAQ A;  5H2L A;  3EZH A;  1T5O A;  5B1A C;  4XEK A;  4NTA A;  5G36 A;  4CDY A;  3ZEV A;  4XTL A;  2YCY A;  3HAN A;  2AVK A;  3S84 A;  2OJE D;  2LFF A;  3NG1 A;  4PJN A;  4QRY A;  3CEX A;  1D0Y A;  2EIL C;  2RD9 A;  3O55 A;  1AP9 A;  2AWY A;  4BG0 A;  1C03 A;  2CNW D;  4BJ6 C;  4AE4 B;  5L0I A;  1AEP A;  2F95 A;  3EQL F;  1JR8 A;  1YZC A;  2VAS A;  4XTN A;  4KNF A;  4YT8 A;  1FMW A;  3RQG A;  2A0B A;  4D4N A;  3I5Q A;  4BEZ A;  1FR0 A;  1Y6D A;  3S8G B;  1YLM A;  1ZZP A;  1L7C A;  1EHK B;  3SNH A;  2QY9 A;  1KU2 A;  2ZXW C;  4KC9 A;  1BRX A;  3UGP A;  5AHZ A;  2KJG A;  3BEH A;  2DB4 A;  1NSG B;  1MNE A;  3DI5 A;  4LDO A;  2X51 A;  1HZX A;  2H8A A;  3OE8 A;  1RKC A;  3FDQ A;  4WGZ A;  4P9F A;  4X32 A;  3TJ6 A;  4CDV A;  1H9T A;  3SN6 R;  5T1D B;  3DZA A;  1J8Y F;  3OA1 A;  3NS0 A;  1M0M A;  3VI0 A;  3GOR A;  5A6J A;  4G7R B;  1QHJ A;  3UMI A;  1ZYR F;  1WN0 A;  3F47 A;  4K1O A;  3C8G B;  2LQG A;  3DDL A;  3VM6 A;  4JJG A;  4XPY A;  1QQ3 A;  2XS1 A;  3EFO A;  3M4C A;  3S29 A;  3UZA A;  2YWA A;  2Y03 A;  5B6V A;  4G7Q B;  4ZLC A;  5L0H A;  2HV6 A;  2BC5 A;  3EHN A;  2Y3D A;  4XXJ A;  1G4W R;  1ZHY A;  2NUP A;  2LP4 A;  5E33 A;  2G3K A;  1FNT c;  4O6M A;  2YL7 A;  4JKV A;  1R4T A;  3AG1 C;  3AJM A;  4KNV A;  4EIY A;  3L1M A;  2OQM A;  1XIO A;  3NKE A;  1YA9 A;  4XPX A;  1LI5 A;  4EJ4 A;  3OE9 A;  2L6X A;  4MBS A;  4W8K A;  4AX2 A;  3MYF A;  3CSK A;  3EGX A;  4N6H A;  4WAB A;  1ZHW A;  5G2C A;  2BL2 A;  4ULV A;  3ABW A;  2XS8 A;  2IM8 A;  2Z55 A;  3HJC A;  1C17 M;  3US6 A;  3HNL A;  1E84 A;  3IQ5 A;  5A8E A;  1YVI A;  2LIG A;  3NMI A;  4NTB A;  2XM0 A;  1XZP A;  2L6F A;  1S7Z A;  4OIN F;  5JJJ A;  1HE9 A;  1SZI A;  4GP4 B;  5B3I A;  4DBR A;  2F93 A;  3OEO A;  4X31 A;  3ZC4 A;  3QBG A;  3K7D A;  2LD6 A;  3MBG A;  2J0W A;  3P0G A;  3WHN A;  4MVS A;  2QPE B;  2P6V A;  3HNJ A;  3VHZ A;  4LER A;  3X1O A;  3FXH A;  1QKP A;  1ORY A;  2YCZ A;  1FFT C;  3JSE O;  3N0T A;  2Y3H A;  2YDV A;  4HYX A;  2CYD A;  2Q9A A;  2Y3B A;  1JV6 A;  4JRZ A;  4YL1 A;  1VOM A;  3NSB A;  3Q6M A;  1V55 C;  3K1H A;  4Y9H A;  1BRD A;  4MD1 A;  3RW0 A;  3C18 A;  2J4Y A;  3J06 A;  2OEV A;  1HW2 A;  1RKE A;  2JAG A;  3U8P A;  4FAP B;  2EPM X;  1K05 A;  3QMK A;  1N1C A;  1X0I 1;  3AG4 C;  5AX1 A;  1OXK A;  2XLO A;  3NYM A;  1WOL A;  3Q6N A;  4LDQ A;  4RD9 A;  2R7Q A;  1VB5 A;  2Q3T A;  4DBQ A;  4J4Q A;  1OW6 A;  4CSA C;  3UTW A;  2OJQ A;  4OIO F;  4YL3 A;  4EHP A;  2G3V A;  1IZM A;  1M57 C;  4UHR A;  5E3A A;  4MTF A;  3UTY A;  1H7I A;  5DQZ A;  5KYY A;  1GUE A;  2O9X A;  3ZPR A;  1F4Z A;  3ZVR A;  5E2Q A;  4CDA A;  3DJU B;  2RH1 A;  3QTH A;  1TFK B;  4MVO A;  5T3T A;  2YLG A;  4DVY P;  4JCZ A;  1KTM A;  1S51 A;  3GEH A;  1NBB A;  5KKH A;  1YA7 O;  4DVZ A;  1GQA A;  5L0C A;  4C3E A;  1MMD A;  2P0N A;  1CPQ A;  3FOP A;  3UTX A;  2GWW A;  3GAN A;  2LFD A;  2IOQ A;  1Q5I A;  1QPU A;  1Z23 A;  1RJ9 B;  1QSP A;  3ODU A;  2XRH A;  3K6B A;  3HLZ A;  3ABL C;  3IHU A;  2NG1 A;  5AHY A;  2YCW A;  3UON A;  2J9W A;  3U3F A;  1YYJ A;  3SXZ A;  3EH2 A;  4BEM J;  3D4S A;  3JCU Q;  3ABK C;  1YYX A;  3UZC A;  5ETZ A;  4AL0 A;  5IY5 C;  4IWB A;  4J7Y A;  3O39 A;  3ZG1 A;  4TL3 A;  4HEA J;  2IXN A;  4U5B E;  1M2V B;  3LEV A;  1APC A;  3O10 A;  4XTK A;  2W9Y A;  4CJG A;  2WZF A;  3ITF A;  4MVU A;  1MQV A;  4G70 B;  4G78 A;  3PXO A;  1WTY A;  2R02 A;  5JJN A;  1PV3 A;  3RFM A;  2ICW G;  4PXF A;  1ST6 A;  4XEF A;  4DRI B;  2AT9 A;  2NUT B;  4MVR A;  2L81 A;  4YT4 A;  3UTV A;  4G7O F;  2XL6 A;  5CI9 A;  1DOV A;  4JVS A;  3E9V A;  1HY5 A;  2YCX A;  2YZS A;  5H2H A;  1RKE B;  4K7B A;  1EKY A;  4MW8 A;  5L3Q A;  1GM5 A;  2W4M A;  2VB6 A;  3C63 A;  3CAP A;  5C1M A;  2L6H A; 
#chains in the Genus database with same CATH homology
 3AM6 A;  4GRV A;  5JP7 A;  1EHK B;  1P8H A;  3HAO A;  4KLY A;  5G2D A;  5DHG A;  1S05 A;  3AYN A;  2R4R A;  1BRX A;  2Y04 A;  5AHZ A;  3S3C B;  1FBB A;  1M0K A;  4LDO A;  3VGA A;  1S8L A;  1HZX A;  4DJH A;  3OE8 A;  4WGZ A;  4X32 A;  3OE6 A;  4G7S B;  3S3B B;  4CDV A;  3HNI A;  2J8W A;  3SN6 R;  1VGO A;  1P8U A;  3NS0 A;  2J9B A;  2YDO A;  1JFP A;  1M0M A;  3VI0 A;  3QBK A;  4G7R B;  1QHJ A;  2KSY A;  4IAR A;  1S53 A;  4FAA B;  3QW0 A;  5JUA A;  3UG9 A;  4ER9 A;  3DDL A;  3NYA A;  4FBZ A;  1QQ3 A;  2YL0 A;  4JEA A;  2EI4 A;  3M4C A;  3UZA A;  3QBI A;  2Y03 A;  1IW6 A;  2VT4 A;  5H2M A;  5B6V A;  4LDL A;  5AX0 A;  4G7Q B;  256B A;  5ITE A;  1GZM A;  4BV0 A;  1CGO A;  2BC5 A;  4GP8 B;  1BRR A;  2G87 A;  3WQJ A;  4XXJ A;  3QW1 A;  3C9M A;  1LM3 B;  3REY A;  5A45 A;  2YL7 A;  4JKV A;  3HAP A;  5JJE A;  4EA3 A;  1TN5 A;  2YL3 A;  3PQR A;  4EIY A;  5EN0 A;  2XLH A;  3L1M A;  2WJL A;  4BEY A;  1XIO A;  4GPO A;  3X3B A;  2I20 A;  4X1H A;  1CPR A;  3QAK A;  1C8R A;  3EML A;  4A4M A;  4EJ4 A;  1IW9 A;  3OE9 A;  2L6X A;  4LDE A;  4MBS A;  1CWQ A;  2NTU A;  5H2P A;  1YZA A;  4N6H A;  4GBR A;  1QM8 A;  1JV7 A;  4JQ6 A;  1GU8 A;  4BVN A;  3V2Y A;  1IXF A;  5ITC A;  5G2C A;  4G71 B;  2X72 A;  3EH4 B;  4ULV A;  3ABW A;  5JRA A;  2Y01 A;  1E0P A;  1S52 A;  4U9E A;  1BM1 A;  5H2O A;  1DZE A;  3PWH A;  1TN0 A;  2Z55 A;  2QPD B;  2M3G A;  3HNL A;  3QJR B;  1E84 A;  3IQ5 A;  5A8E A;  5JS5 A;  3OE0 A;  5AWZ A;  3QJT B;  3NMI A;  4NC3 A;  1M0L A;  2YLD A;  3NY8 A;  3ZQY A;  2XM0 A;  1VJM A;  5JJJ A;  1E85 A;  4GP4 B;  3ZQV A;  5B3I A;  5G54 A;  2F93 A;  4X31 A;  3VG9 A;  2KSB A;  3QBG A;  3QJS B;  3ZTM A;  5DHH A;  4FA7 B;  5B2N A;  3P0G A;  5DYS A;  2QPE B;  3HNJ A;  2XM4 A;  4HWL A;  3VHZ A;  1F88 A;  4MQT A;  3X3C A;  1QKP A;  3DE8 A;  1L9H A;  2YCZ A;  3OAX A;  2YDV A;  3KJ6 A;  2NTW A;  4DKL A;  4HYX A;  3QBL A;  3DE9 A;  4FPD A;  4DS7 E;  3QJV B;  1JV6 A;  1Q5J A;  2I35 A;  2Z73 A;  4CJO A;  5H2J A;  1H2S A;  4G72 B;  3QAP A;  4MD2 A;  1P8I A;  3NSB A;  3QDC A;  3EH3 B;  4WGY A;  4Y9H A;  2KSA A;  2ZZL A;  4AMJ A;  1PXR A;  2BRD A;  1BRD A;  3HAS A;  2PED A;  4MD1 A;  1CGN A;  2J4Y A;  5G28 A;  1C8S A;  2QLA A;  2JAF A;  5B34 A;  2JAG A;  3U8P A;  1L0M A;  1KME A;  1C3W A;  1KG9 A;  3PBL A;  5B35 A;  1XJI A;  1E12 A;  3RZE A;  4JE9 A;  3HAR A;  5B6Y A;  5H2K A;  4JR8 A;  1X0I 1;  2XLD A;  3MBV A;  4N4W A;  3COD A;  5AX1 A;  1QKO A;  2XLO A;  3COC A;  3EH5 B;  1E86 A;  4CIP A;  4BUO A;  2CCY A;  1BBH A;  1H68 A;  4GYC A;  3HNK A;  4XTO A;  4CX9 A;  4K5Y A;  3C62 A;  2ZFE A;  4HYJ A;  4J4Q A;  5BR5 A;  3TOL A;  4U9D A;  3UTW A;  3QJU B;  3V2W A;  2XLM A;  4AMI A;  4PXK A;  3NY9 A;  1MGY A;  4L35 A;  1S54 A;  5BR2 A;  3A7K A;  4UHR A;  2YLI A;  4D4X A;  1E83 A;  3UTY A;  2XL8 A;  4DAJ A;  3M79 A;  1GUE A;  3M4B A;  3ZPR A;  1F4Z A;  1JGJ A;  2LNL A;  4CDA A;  2RH1 A;  5TGZ A;  5B6W A;  3ZTZ A;  1A7V A;  2YLG A;  2YL1 A;  4WW3 A;  1S51 A;  5FJG A;  1NBB A;  5KKH A;  1X0K 1;  2XLE A;  5JVE A;  1F50 A;  5AGF A;  5JSL A;  4JEB A;  1GQA A;  1JAF A;  1KG8 A;  1XME B;  5B6X A;  1CPQ A;  3FOP A;  3UTX A;  4XT1 A;  5B6Z A;  2I1X A;  1R2N A;  3T45 A;  4WAV A;  1M6T A;  3VVK A;  3VRC A;  1Q5I A;  1QPU A;  5A44 A;  3ZWI A;  3ODU A;  2XLW A;  2R4S A;  4GP5 B;  3QJQ B;  4N4Y B;  2KS9 A;  3PDS A;  4QI1 A;  4IAQ A;  5AHY A;  2YCW A;  3UON A;  1LN6 A;  1FBK A;  3C9L A;  4XT3 A;  4QID A;  1U19 A;  3DQB A;  2HPY A;  3S8F B;  1YYJ A;  3D4S A;  5H2I A;  5LWE A;  3NMK A;  3QVY A;  1PXS A;  1PY6 A;  5F8U A;  5JLI A;  1YYX A;  1S8J A;  3UZC A;  2WJK A;  5AZD A;  5ETZ A;  1X0S A;  4TL3 A;  4OV0 A;  4IB4 A;  1KGB A;  1APC A;  2XLV A;  5G2A A;  4CJG A;  4BWB A;  1UCQ A;  1UAZ A;  3VW7 A;  5JT4 A;  1MQV A;  3HAQ A;  4G70 B;  5H2L A;  2Y00 A;  3PXO A;  2ZIY A;  5G36 A;  2Y02 A;  4CDY A;  5JJN A;  2I21 A;  3ZEV A;  3RFM A;  3FOO A;  3S3D B;  4PXF A;  4XTL A;  2YCY A;  2AT9 A;  3NMJ A;  2YKZ A;  3HAN A;  3QVZ A;  3TOM A;  3UTV A;  1O0A A;  2XL6 A;  5J7A A;  5B0W A;  4MQS A;  1RCP A;  3IQ6 A;  5G53 A;  4QRY A;  3BVD B;  1AT9 A;  1AP9 A;  2YCX A;  5H2H A;  2F95 A;  4XTN A;  1YZC A;  4KNF A;  5H2N A;  4L6R A;  4UG2 A;  1EKY A;  3AYM A;  3ZPQ A;  3M15 A;  4D4N A;  3C63 A;  4BEZ A;  1R84 A;  3CAP A;  5C1M A;  3S8G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...