4EIYA

Crystal structure of the chimeric protein of a2aar-bril in complex with zm241385 at 1.8a resolution
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
405
structure length
390
Chain Sequence
GAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for allosteric regulation of GPCRs by sodium ions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Adenosine receptor A2a/Soluble cytochrome b562 chimera
total genus 173
structure length 390
sequence length 405
ec nomenclature
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4eiyA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4eiyA01
4MBSA 5H2MA 5AX0A 1JV7A 4G7SB 3D4SA 3MBVA 4JE9A 2XL8A 3M15A 1UAZA 4EIYA 3PXOA 1E85A 3ZQVA 5JJEA 5B6VA 5ITCA 2I20A 4XT3A 4ER9A 4K5YA 1JFPA 3HAPA 3OE8A 3IQ6A 3AYMA 3UTXA 2HPYA 1YYXA 3QJRB 5C1MA 5FJGA 3S8FB 1FBKA 3ABWA 5G53A 5G36A 1NBBA 1QKPA 5G2DA 4BV0A 1BRDA 4G7RB 2WJLA 5AWZA 1F50A 2I35A 1MQVA 4QRYA 3CODA 5JJJA 3QJUB 5H2JA 3C9LA 4G7QB 2BC5A 5JP7A 1X0SA 1O0AA 3HANA 3T45A 4N6HA 4QI1A 3VGAA 2F93A 1M0KA 4XTLA 2XLMA 4CDVA 1FBBA 3QAPA 3C62A 4DKLA 3QJQB 5AHYA 1E12A 4AMJA 3QW0A 3UTVA 4CIPA 3HAQA 1LN6A 4BEZA 4HWLA 4CDAA 2KSAA 3PQRA 2X72A 2YCZA 5B3IA 3DE8A 4DAJA 3FOOA 1IW6A 4N4YB 4QIDA 1LM3B 4WGYA 2J4YA 4G71B 1S05A 2Y00A 3EMLA 1XJIA 3S8GB 3QBIA 4GP5B 3AM6A 5H2NA 2RH1A 1KG8A 2Y04A 3DE9A 4BUOA 5B34A 1CWQA 3DDLA 4CJOA 5TGZA 2XLVA 4PXFA 5JJNA 1X0K1 1P8HA 4IB4A 3COCA 4J4QA 1X0I1 2ZFEA 3ZTMA 1IXFA 1BRRA 4TL3A 3QVZA 4X1HA 1P8UA 1CGNA 2VT4A 3V2YA 1GQAA 1M0MA 1QKOA 2JAFA 2F95A 1M0LA 3HAOA 4LDLA 1XMEB 1QM8A 4NC3A 2YL7A 3QJSB 4XTOA 1PXRA 5DYSA 2J9BA 5G54A 5A45A 4PXKA 4EA3A 4WAVA 2J8WA 2XLHA 3NSBA 4LDOA 4U9DA 2EI4A 2YLGA 3PBLA 3NYAA 1E83A 4GBRA 1TN5A 2Z55A 1AP9A 1GU8A 2QLAA 3UONA 1Q5IA 5JS5A 5LWEA 1CGOA 2YDVA 2KS9A 5ITEA 1KGBA 3S3BB 4L35A 1U19A 1E0PA 2KSBA 3RZEA 1GZMA 5B35A 4FA7B 4L6RA 3EH4B 4GPOA 1CPQA 256BA 5G2CA 2XLOA 1AT9A 5AGFA 1PY6A 5G28A 2M3GA 3A7KA 3NS0A 1R84A 2YKZA 3ZWIA 1C8SA 4WGZA 4IAQA 2NTWA 2CCYA 3DQBA 4MQSA 1EKYA 3CAPA 1Q5JA 2XL6A 1P8IA 2LNLA 4D4NA 3BVDB 4FBZA 2YL0A 4KNFA 4Y9HA 3UTWA 4X31A 4UHRA 4JKVA 2Y03A 3HNIA 3UTYA 3ZPQA 3QBKA 4WW3A 1R2NA 2YCYA 3NMJA 2ZIYA 2YCWA 2AT9A 4IARA 1MGYA 3VVKA 3NMKA 1M6TA 4BVNA 1JV6A 3NMIA 1S52A 2Y01A 1CPRA 5A8EA 3OE0A 1GUEA 1YYJA 3FOPA 1EHKB 1QQ3A 1A7VA 3VI0A 5J7AA 2YLIA 4DJHA 2YL3A 3QBLA 5DHHA 3NY8A 3UG9A 5BR5A 3TOLA 3IQ5A 4U9EA 1H68A 2ZZLA 1S54A 4GYCA 2JAGA 4X32A 2R4RA 4ULVA 3V2WA 5B6WA 1UCQA 2G87A 4G72B 1KMEA 3P0GA 1TN0A 1L9HA 1S8LA 3EH5B 1S53A 3X3CA 2XM0A 3C63A 5F8UA 4JEAA 1YZAA 5B6XA 4BWBA 5JT4A 3M4BA 4UG2A 3UZCA 5JSLA 4KLYA 3ZPRA 1APCA 4LDEA 3VG9A 1BRXA 2I1XA 3QVYA 3HNJA 4MD2A 2KSYA 1VGOA 3HARA 5JRAA 3KJ6A 4JQ6A 5JUAA 1PXSA 4CDYA 2Y02A 1VJMA 3QJVB 4AMIA 2PEDA 3PWHA 2NTUA 5A44A 3L1MA 2BRDA 1IW9A 4G70B 4JR8A 3UZAA 2XLEA 2QPEB 3OE6A 1RCPA 4BEYA 4MQTA 4XTNA 2L6XA 1JGJA 3VW7A 3TOMA 1YZCA 5H2LA 3QDCA 4OV0A 1KG9A 4A4MA 4HYXA 4CJGA 5ETZA 1E84A 5H2HA 3WQJA 5B6ZA 3VRCA 3VHZA 4CX9A 4HYJA 3HNKA 3AYNA 3C9MA 3ZEVA 3X3BA 2R4SA 4FAAB 5G2AA 2YLDA 3ZTZA 4D4XA 5EN0A 1JAFA 3QBGA 1E86A 1HZXA 3HASA 5AHZA 4MD1A 5B0WA 3ODUA 1QPUA 3U8PA 5JLIA 3QJTB 2YL1A 3M4CA 5DHGA 3OE9A 3RFMA 1F88A 5JVEA 1C3WA 1C8RA 3OAXA 1S51A 5H2KA 3ZQYA 2XLDA 1XIOA 3EH3B 5B2NA 1L0MA 3S3DB 3M79A 2XM4A 3SN6R 3HNLA 2YDOA 4GRVA 3QAKA 1DZEA 3NY9A 5B6YA 4FPDA 5KKHA 4XT1A 4GP8B 5AZDA 1BBHA 1BM1A 1S8JA 4XXJA 2XLWA 2QPDB 2I21A 3QW1A 3REYA 2YCXA 2WJKA 4GP4B 1QHJA 5AX1A 3PDSA 5H2OA 5BR2A 4EJ4A 5H2IA 5H2PA 1H2SA 2Z73A 3S3CB 4JEBA 1F4ZA 4N4WA
chains in the Genus database with same CATH superfamily
4MBSA 5H2MA 4OIPF 1H6GA 1JPNA 3GEHA 3MFNA 3BRJA 3IQCA 2D5RB 4IAOA 4X0RA 2QY9A 5KYWB 3JYHA 5L0HA 1H9TA 3M15A 1UAZA 4BG0A 3PXOA 1OXBA 5JJEA 2UUIA 5B6VA 5ITCA 4R32A 4ER9A 1MMDA 3KPHA 1JFPA 3AYMA 1ORSC 3LEVA 1WTYA 3QJRB 3C8GA 5C1MA 5FJGA 2A6EF 3IHUA 4FAPB 4XEVA 4MVOA 2G3KA 4MTGA 5G2DA 3NKEA 4BV0A 2OKUA 4G7RB 1NU9C 4IWBA 1MQVA 3CODA 5JJJA 2KC3A 4JTCB 3TD7A 5JP7A 3FVYA 1O0AA 3HANA 4NQFA 3B9QA 1TR2A 2NUTA 4DRJB 2F93A 1LVKA 1PV3A 5DLJA 3C62A 4DKLA 2KJGA 3R2PA 1LPEA 3QW0A 1ZHWA 5KYXA 3HAQA 2W9YA 4BEZA 4HWLA 2KSAA 4MW3A 3F46A 3PQRA 2X72A 2JX0A 4AE4A 1HE1A 1Z63A 4DAJA 2E87A 4QIDA 2IXNA 4WGYA 3C8GD 3EG9B 2EIMC 3EZHA 3GODA 3R7CA 2KQ9A 4I1OB 2PNOA 1XJIA 3HTKC 3JT1A 4YN0B 4XLPF 4MVMA 2RH1A 3E9VA 4NCQA 3RVZA 3DE9A 3NYJA 4EWCA 2YQYA 5B34A 4EBBA 3ZSUA 1CWQA 4CJOA 3LUTB 5COMA 2TMVP 1BR2A 1X0K1 2XRHA 3COCA 3DM9B 1DOWA 1VB5A 3KYIA 5A6JA 1TWCA 1P8UA 2NSGA 4NY3A 1QKOA 1GS9A 2LFDA 2P7VA 2NPUA 1XMEB 1B68A 2AWCA 3B0UX 5DYSA 4PXKA 3NSBA 2A69F 2EI4A 4MTOA 5A6BA 4KI2A 4GBRA 5KYNA 3OWTA 3RVYA 1AP9A 1IW7F 2QLAA 2IXPA 1Q5IA 2YDVA 5ITEA 2ZXWC 1JRAA 2JPUA 1WN0A 4YL3A 1E0PA 1NU7D 1GZMA 4L6RA 3EH4B 4GPOA 2XS8A 3X1OA 1VMAA 3Q7GA 3AQBA 2M3GA 1VK5A 3NS0A 5D91A 2P1AA 1C8SA 5CI8A 3A11A 1G4US 1G4WR 3NYMA 1Q5JA 4G78A 3TJ5A 3EGDB 2LNLA 3AOUA 4D4NA 3BVDB 2H7OA 5F28E 4JKVA 1T01A 2HSBA 2Q4FA 4LDQA 3S0XA 2J7PA 4K1OA 3NMJA 3SEOA 1PCXA 2AT9A 2KSFA 1ZYRF 4W8PA 2V26A 1LE4A 1FMWA 1MGYA 2R02A 3VVKA 2QE9A 2KYHA 1Z3IX 1TFOB 1S52A 4C3EA 3JRTA 4DVZA 4BJTA 2H7VC 4PJNA 1LIHA 3UMKA 4OIRF 1R5ID 3UR3C 3SXYA 4BEMJ 3KH2A 5BR5A 1ZHTA 4U9EA 4M63A 5FCLA 2WZFA 5A6BD 2HZ8A 1S54A 4PJMA 2HKVA 4HFFB 4N06A 4G72B 3DM5A 2ETSA 3S28A 2W4MA 4CBEA 5L3QA 2KNHA 2Q00A 1EA8A 2LP4A 3N24A 3UZCA 5JSLA 3EJNA 1LI7A 3GM2A 3WG7C 4LDEA 4MD2A 1H9GA 3RYLA 1PXSA 4CDYA 3ABLC 5HSWA 1Z5ZA 4DXWA 1A0BA 3CQZA 4JR8A 1IW9A 1XZQA 2XLEA 2H8AA 2QNLA 4HFKB 1JGJA 1OR2A 1OKKD 4XQ1A 3ECSA 3QDCA 2GAQA 4E17A 4G0HA 4CJGA 2IM8A 1QSPA 4HYJA 2L7AA 1QKRA 4FAAB 1HMOA 2RD9A 2PP4A 3ZTZA 1NG1A 4D4XA 3U5SA 1RKEB 3QTHA 4OIOF 1JAFA 3QBGA 3OEOA 4EHPA 4MD1A 2YL1A 2HV6A 1G8XA 3HKKA 5DHGA 1F88A 2WVQA 1YDIA 5JVEA 2R05A 1WASA 2VC9A 5H2KA 1JPJA 4JRZA 3MBGA 2F22A 1HW1A 3EH3B 3B0PA 3HNLA 2YHSA 3W2WA 3NY9A 4KNWA 1YVIA 1HE9A 3RW0A 3RH3A 2RSEB 4J30B 1OR3A 1SYQA 5B1AC 2XLWA 4NTBA 2DGJA 3TK0A 1D0ZA 3AG2C 4YK5A 3WHNA 1TWAA 3I4UA 1PD1A 3PDSA 3LJBA 5BQIA 1ZW2A 2Q3TA 3AG3C 1F1MA 3FAJA 4U5BE 1J8MF 1JV7A 4U5HA 3MBVA 4JE9A 1EI7A 4IRUA 1Z7Qc 3AGUA 3IPMO 2R7UA 1Q0GA 4XT3A 1V4AA 1BR4A 4CS9A 3IQ6A 4XWJA 4CIHA 1M56C 2HPYA 1ZHZA 5G53A 3SNHA 4GEHA 1QKPA 4G7HF 3H65A 1O5HA 5B1BC 2LD6A 1BRDA 2WJLA 5AWZA 2X0CA 1J8YF 1F50A 4YL0A 4JJFA 3C8ZA 2G3VA 3C9LA 4G7QB 2M4EA 3ABKC 3T6JA 3KKBA 1U6HA 3MLGA 4AL1A 2A6HF 2ASRA 2AU5A 1HMDA 2A68F 3EGXA 3F47A 3EGDA 1FBBA 2R7OA 3G4XA 2OEXA 2I15A 2VCBA 5HV9A 4CIPA 3UGOA 4MVRA 4C3BA 1V74B 1LN6A 2I8BA 4JC7A 2YCZA 1QLEC 1IW6A 1OCOC 1ZZPA 5L0GA 2KGOA 1UFBA 3EMLA 3RKOF 4GP5B 1FNTc 2DI3A 3UMHA 1KG8A 2Y04A 1D1CA 3DDLA 5TGZA 2XLVA 2EIJC 2BE5F 2B0JA 3LLIA 1X0I1 5B3SC 1IXFA 1OW6A 1CGNA 3AG1C 3U3BA 3HAOA 3CAXA 3OA1A 3ZIBA 3QJSB 3DZAA 1W2WA 1LS4A 1ZHXA 2R7XA 5A45A 4DRIB 4EA3A 2WL8A 3QMKA 4MTFA 2R03A 3PBLA 3U2LA 4IJJA 2C04A 1TN5A 4U5FE 1GU8A 2PX0A 3GORA 4YT5A 3UONA 5JS5A 5TJ5E 5LWEA 3E70C 1RJ9B 2J0WA 3GM1A 4CS7A 3S3BB 4LERA 2GDCA 1C02A 3CZ6A 1AT9A 5G28A 1TKNA 1R84A 2HJMA 2P6VA 4WGZA 1K40A 4K0DA 1NSGB 3DQBA 4BJ5C 1XZPA 3CAPA 1FAPB 5KYUA 1OCCC 3UTWA 5A6KA 2L6GA 3ZPQA 2DYSC 3QBKA 5DS5A 1N1CA 3JYYA 2HV7A 2YCYA 2WB7A 3BEHA 4IARA 3JZ0A 4H4KC 4P9TA 2Q7RA 4Q5SF 2UUHA 4I1MA 4ULWA 3L0IA 3TQOA 1CPRA 3V5XA 3S90A 5T1DB 1M2OA 2ZXOA 5COFA 2VCCA 1GUEA 3GWNA 1YYJA 4LDRA 2MWQA 2Q9AA 5J7AA 3JTLO 5DS4A 2IXOA 4DJHA 3QBLA 5DHHA 3DJUB 4AK9A 3B71A 1H68A 4HE8D 4GYCA 4BJ6C 3U9MA 4X32A 2R4RA 1FTSA 4ULVA 5B6WA 3DD7A 2Z15A 4W8KA 3RF3A 3P0GA 1VYIA 2A0BA 1TN0A 1S53A 2EPKX 2R7QA 1KTMA 4JEAA 2J46A 1YZAA 3M4BA 1H7IA 3UNGC 1M2VA 3LNMB 4Q4ZF 1JR8A 3HNJA 2KSYA 2KK1A 4Q7CA 3SXZA 1ORJA 2HMQA 2Y02A 4P6IC 4AMIA 2CNWD 3L1MA 2IYLD 4KC9A 2BRDA 2MHRA 4MQTA 5AC5A 4UDVA 3N2ZB 1YARO 5K0IA 3VW7A 4MVUA 1YZCA 1BZ4A 5H2LA 3T9OA 2J7PD 4HYXA 5A6AA 2EIKC 3VRCA 3VHZA 2Y3BA 2VCAA 1VLSA 2J9VA 3AYNA 4DOZA 4CS8A 2EPOA 4PFOA 3VAYA 3K66A 4WJ0A 5F5FA 1E86A 1HZXA 3NYLA 3HASA 2XXAB 2EPNA 3T4RA 3GANA 5B0WA 3ODUA 1UG7A 3Q6NA 1WGWA 1U89A 3RFMA 1C8RA 3OAXA 1RJ9A 3C7JA 1ZU4A 4C7OA 3S3DB 1LS1A 3U8VA 4XTKA 5GPGB 4GRVA 3QAKA 3KL4A 2DYRC 4JJGA 3MX3A 1ZU5A 1R4TA 4JW1A 2NG1A 4ZLDA 1BBHA 4E0IA 3HJCA 3DMDA 4U5DE 1V55C 2WJKA 5AX1A 5BR2A 1A7EA 5CI9A 1H2SA 4JEBA 1F4ZA 1Q0KA 1JOGA 4N4WA 4YT2A 2LIGA 5L0JA 1O87A 5AX0A 4G7SB 1KNYA 2ZPAA 4EBKA 4PJLA 2R25A 3U3FA 3VYWA 4K5YA 3HAPA 3UTXA 4YT8A 3POVA 1I5NA 3MYIA 3S8FB 1FBKA 5G36A 1D1BA 1YA7O 3LAYA 1NBBA 3EHMA 2EPMX 2LSEA 1Q0FA 4NTAA 3LS0A 3L8IA 2HJ3A 4QRYA 3QJUB 5H2JA 3PCVA 3SP1A 3U2MA 3G50A 2BC5A 4MQ9F 4FESA 4CSAA 1X0SA 2QUPA 3K1IC 1SR2A 1MMGA 4KBLA 4NTFA 3T45A 2NUPA 3VGAA 4QI0A 2OEVA 2XLMA 2AVKA 3QAPA 2G62A 4JCHA 3I5QA 5D92A 2HS5A 3UTVA 1RKEA 4JTAB 4QI2A 4CDAA 2IXMA 3DE8A 5L0IA 1OKKA 3FOOA 2EILC 3PHF2 4N4YB 5COGA 1LM3B 2J4YA 2ZD9A 4G71B 4O79A 1S05A 2Y00A 1ZW3A 2J9UA 2XS1A 4LLCA 3KMIA 5H2NA 2XL4A 3AGTA 1Q0DA 2V3CC 1PD0A 4BUOA 2PFDA 2IOQA 3SZRA 5DS6A 4U5GA 4PXFA 2Q9BA 2CDQA 4IB4A 2J0XA 2H7BA 3H2VA 4GQHA 1VLTA 1CGME 4TL3A 4N6CA 4OD4A 5E33A 2VT4A 3V2YA 1GQAA 2JAFA 2R9RB 1EQ1A 2F95A 1M0LA 4LDLA 3MYFA 3EHNA 4NC3A 2YL7A 1RXQA 4XTOA 1PXRA 1T6UA 3K7DA 5G54A 1ST6A 1ORYA 1OW7A 4WAVA 2J8WA 2XLHA 3GWLA 3DKAA 3G4ZA 4LDOA 4J7TA 2YLGA 4C7OB 3NYAA 3WAQA 1E83A 2Z55A 1CGOA 2O9XA 1KGBA 4MW8A 4YT4A 1U19A 2PBEA 2KSBA 1WWPA 5B35A 4FA7B 3AJMA 2W45A 4QDLA 2LFFA 4EKWA 2R7WA 5DVWA 3RQEA 2YKZA 3RFYA 3QZCA 4IAQA 3S27A 2CCYA 1AVOB 4MQSA 2Y3GA 5E2QA 4ANJA 3EGXB 3J06A 2R7VA 3TJ6A 1FFHA 1HW2A 1Z23A 4C3DA 5DQZA 4KNFA 4Y9HA 4X31A 2Y03A 3HNIA 4BEJA 1K04A 2WVOA 2BL2A 4WW3A 1T5OA 1VOMA 2HUJA 1R2NA 3ASOC 1DOVA 2YCWA 4XPWA 2XXAA 3KYJA 3JCUQ 3FHDA 4HEAJ 1BR1A 1M6TA 2KW3C 4E0HA 4BVNA 4PK4A 2B0HA 3ABMC 1JV6A 1TFKB 1Z6AA 1SF8A 1OCZC 2LCHA 2Y01A 5A8EA 3IQTA 3OE0A 2EINC 1SZIA 4MVZA 3FOPA 2VB6A 3O6XA 4XPYA 2J9WA 2Y69C 3VI0A 5E3CA 4LLEA 2YL3A 1YAUO 3UG9A 1Q0MA 3IQ5A 1QVXA 2YEVA 4OD5A 3X2QC 1ZVZA 3V2WA 4YWQA 1UCQA 2L81A 3JSZA 2G87A 4P9FA 4RD9A 2YWAA 2FGYA 1S8LA 2X51A 1HY5A 1MNEA 5F8UA 3JRMO 4O6MA 4OINF 3DI5A 5B6XA 4XEKA 5JT4A 4UG2A 4KLYA 4ONSA 4Z9IA 5CIVA 2AP3A 3VG9A 5EGYA 1BRXA 2I1XA 1L3PA 1WOLA 2L6FA 2ZXRA 4B6IA 3EFOA 3US6A 3LNRA 5L0CA 1OW8A 3JSEO 1WATA 1A41A 3W4YA 2HMZA 4BJ5A 4KNVA 4A4AA 3C8GB 2VASA 2PEDA 5BUOA 2HFIA 3DXJF 4E7ZA 4U5EE 2YRFA 3UZAA 1O3UA 2W4BA 2QPEB 4MVQA 1RCPA 4LACB 4BEYA 4FX5A 1SMYF 5AC4A 3FMSA 3FXHA 4OV0A 1NLXA 1KG9A 4A4MA 4H54A 5ETZA 1E84A 1T9KA 3WQJA 2NUPB 2NUTB 3X3BA 2R4SA 3FDQA 4G7ZF 3T6BA 5G2AA 2YLDA 3VM6A 1YA9A 1MMAA 4I44A 5EN0A 2M64A 5KYXB 3L34A 5AHZA 2P61A 1QPUA 3U8PA 5JLIA 3QJTB 3M1CB 2R7RA 4XEFA 3ZQYA 4I3MA 4PFPA 1XIOA 4JCZA 5B2NA 3M79A 2XM4A 1RMVA 4JTDB 3DAGA 1DZEA 5L0DA 4FPDA 5KKHA 2GFHA 3B29A 2A0UA 4DS7E 4XT1A 4DBQA 4WABA 5AZDA 4YL1A 3QW1A 3REYA 2YCXA 4ZLCA 4CSAC 5BQGA 4EJ4A 5H2IA 2Z73A 3S3CB 3T6GB 5KYUB 2CW0F 3GEEA 3D4SA 2YZSA 2XL8A 1M2VB 2OCCC 1AEPA 2Y3HA 4EIYA 1C03A 4XLNF 1E85A 3ZQVA 3NDBB 1T6QA 3SXKA 1IZMA 2I20A 1T6IA 5E3AA 3FAPB 3OE8A 3S29A 2J45A 1NZEA 1YYXA 2XSEA 3O39A 3ABWA 3DJNB 1D0XA 3LEOA 4PJJA 1Y4CA 2QTVA 3U0CA 2I35A 3EZIA 4FWVA 3A9CA 1C17M 4N6HA 4QI1A 3U9JA 1V54C 1VYKA 1M0KA 1M57C 4XTLA 1U0BB 4BPMA 4CDVA 3L8JA 3QJQB 5AHYA 3LESA 4PACA 3H2UA 1E12A 4AMJA 4F4BA 5T3TA 1BDJB 2IBFA 3PDMP 2ZXPA 5B3IA 3LLKA 3RIPA 4CS8C 1FR0A 1I4YA 2JD3A 2C03A 3S8GB 3DWWA 4J32B 1OCRC 4DRHB 3QBIA 3AM6A 2Y3DA 3Q7LA 3Q6MA 2WZGA 3EQLF 2FAPB 1QZXA 2YVKA 3EH1A 2CNWA 3UMIA 2PX3A 1KU2A 4BJ6A 5JJNA 4IGGA 1P8HA 4J4QA 2LQGA 4K7BA 3N0TA 2ZFEA 3ZTMA 1BRRA 3W2VA 1AUEA 3QVZA 4X1HA 4MS2A 3V5ZA 3K33A 2MYSA 3ZVRA 5KYYA 1K05A 1M0MA 5L3VA 3NKDA 1L7CA 2R7SA 1QM8A 2OOCA 4OIQF 2J9BA 2WVNA 2EPLX 3AG4C 3VF0A 4AL0A 3EFOB 2NSFA 4EBJA 4U9DA 4A2NB 4DBRA 2R7TA 2OJED 3SYNA 4RBNA 3O10A 2KS9A 1RKCA 1NFNA 4L35A 3RQFA 3HLZA 3RZEA 1FFTC 4LDKA 1CPQA 256BA 5G2CA 2XLOA 5AGFA 1PY6A 4EUKB 3A7KA 1A7DA 2VH3A 3ATPA 3ZWIA 4JIOA 2NTWA 3ITFA 4MVSA 1EKYA 3W8HA 2D4UA 2XL6A 1I4ZA 2L9JA 1P8IA 1TWGA 3EH2A 3K6BA 4FBZA 2YL0A 4UHRA 1S7ZA 4DJ9A 3K1HA 3UTYA 4PR9A 3ZC4A 1VTMP 3C18A 4U5CE 3NG1A 2Q9CA 5KYWA 2ZIYA 5EK0A 3K1IA 4AE4B 1E2XA 4GYTA 1LE2A 5EHHA 3NMKA 4O6YA 3UGPA 3NMIA 2CYDA 1EHKB 1QQ3A 4O7GA 1A7VA 5FZTA 4MNDA 1MNDA 1MMNA 4J7YA 2YLIA 5BQHA 1YJGA 3NY8A 3TOLA 2ZZLA 1OQCA 2JAGA 3ASNC 1KMEA 1L9HA 3EH5B 1TQGA 3X3CA 2XM0A 3C63A 4Z9HA 2HSQA 4BWBA 1GM5A 3ZPRA 1OXKA 1G5ZA 3W8IA 1APCA 2LK4A 3WODF 2Y39A 3QVYA 3ZDLA 1VGOA 3HARA 5JRAA 2GA0A 1D1AA 3EPVA 3LS1A 3KJ6A 4JQ6A 4AX2A 4JURI 5JUAA 3RQGA 1Y6DA 1VJMA 3QJVB 2GWWA 3V5YA 2A1DD 3PWHA 3EG9A 2NTUA 5A44A 4G7OF 3SXMA 4G70B 3NRHA 4RDAA 3OE6A 5F5HA 3TULA 4E18A 2OG2A 3S9OA 4XTNA 2L6XA 5T3WA 4JVSA 3TOMA 3IEEA 4O6NA 3V7OA 4XPXA 1LKXA 3CEXA 5H2HA 2ICWG 5KYYB 5B6ZA 4CX9A 3I5PA 3HNKA 3PMRA 3C9MA 2CGEA 3ZEVA 1D0YA 2OQMA 5L0FA 1FMVA 3ZG1A 3S84A 2AWYA 1ZHYA 4YJWA 1GGQA 2WZLA 3CSKA 5IY5C 3M4CA 3OE9A 1C3WA 1YLMA 3AQCA 1S51A 2XLDA 3DAFA 1L0MA 3SN6R 2OJQA 5DQTA 2YDOA 2FFHA 4JZAA 5B6YA 4Z9JA 2DB4A 1XWJA 4DVYP 4GP8B 1NFOA 3GM3A 1BM1A 1JMWA 1S8JA 4CS9C 4XXJA 2QPDB 3O55A 2I21A 4E7SA 2P0NA 4GP4B 1QHJA 3GEIA 5H2OA 5A69A 1LI5A 4BJ1A 3B0VC 1TWHA 2OU6A 5H2PA 2L6HA 2PF4E
chains in the Genus database with same CATH topology
4MBSA 5H2MA 5AX0A 1JV7A 4G7SB 3D4SA 3MBVA 4JE9A 2XL8A 3M15A 1UAZA 4EIYA 3PXOA 1E85A 3ZQVA 5JJEA 5B6VA 5ITCA 2I20A 4XT3A 4ER9A 4K5YA 1JFPA 3HAPA 3OE8A 3IQ6A 3AYMA 3UTXA 2HPYA 1YYXA 3QJRB 5C1MA 5FJGA 3S8FB 1FBKA 3ABWA 5G53A 5G36A 1NBBA 1QKPA 5G2DA 4BV0A 1BRDA 4G7RB 2WJLA 5AWZA 1F50A 2I35A 1MQVA 4QRYA 3CODA 5JJJA 3QJUB 5H2JA 3C9LA 4G7QB 2BC5A 5JP7A 1X0SA 1O0AA 3HANA 3T45A 4N6HA 4QI1A 3VGAA 2F93A 1M0KA 4XTLA 2XLMA 4CDVA 1FBBA 3QAPA 3C62A 4DKLA 3QJQB 5AHYA 1E12A 4AMJA 3QW0A 3UTVA 4CIPA 3HAQA 1LN6A 4BEZA 4HWLA 4CDAA 2KSAA 3PQRA 2X72A 2YCZA 5B3IA 3DE8A 4DAJA 3FOOA 1IW6A 4N4YB 4QIDA 1LM3B 4WGYA 2J4YA 4G71B 1S05A 2Y00A 3EMLA 1XJIA 3S8GB 3QBIA 4GP5B 3AM6A 5H2NA 2RH1A 1KG8A 2Y04A 3DE9A 4BUOA 5B34A 1CWQA 3DDLA 4CJOA 5TGZA 2XLVA 4PXFA 5JJNA 1X0K1 1P8HA 4IB4A 3COCA 4J4QA 1X0I1 2ZFEA 3ZTMA 1IXFA 1BRRA 4TL3A 3QVZA 4X1HA 1P8UA 1CGNA 2VT4A 3V2YA 1GQAA 1M0MA 1QKOA 2JAFA 2F95A 1M0LA 3HAOA 4LDLA 1XMEB 1QM8A 4NC3A 2YL7A 3QJSB 4XTOA 1PXRA 5DYSA 2J9BA 5G54A 5A45A 4PXKA 4EA3A 4WAVA 2J8WA 2XLHA 3NSBA 4LDOA 4U9DA 2EI4A 2YLGA 3PBLA 3NYAA 1E83A 4GBRA 1TN5A 2Z55A 1AP9A 1GU8A 2QLAA 3UONA 1Q5IA 5JS5A 5LWEA 1CGOA 2YDVA 2KS9A 5ITEA 1KGBA 3S3BB 4L35A 1U19A 1E0PA 2KSBA 3RZEA 1GZMA 5B35A 4FA7B 4L6RA 3EH4B 4GPOA 1CPQA 256BA 5G2CA 2XLOA 1AT9A 5AGFA 1PY6A 5G28A 2M3GA 3A7KA 3NS0A 1R84A 2YKZA 3ZWIA 1C8SA 4WGZA 4IAQA 2NTWA 2CCYA 3DQBA 4MQSA 1EKYA 3CAPA 1Q5JA 2XL6A 1P8IA 2LNLA 4D4NA 3BVDB 4FBZA 2YL0A 4KNFA 4Y9HA 3UTWA 4X31A 4UHRA 4JKVA 2Y03A 3HNIA 3UTYA 3ZPQA 3QBKA 4WW3A 1R2NA 2YCYA 3NMJA 2ZIYA 2YCWA 2AT9A 4IARA 1MGYA 3VVKA 3NMKA 1M6TA 4BVNA 1JV6A 3NMIA 1S52A 2Y01A 1CPRA 5A8EA 3OE0A 1GUEA 1YYJA 3FOPA 1EHKB 1QQ3A 1A7VA 3VI0A 5J7AA 2YLIA 4DJHA 2YL3A 3QBLA 5DHHA 3NY8A 3UG9A 5BR5A 3TOLA 3IQ5A 4U9EA 1H68A 2ZZLA 1S54A 4GYCA 2JAGA 4X32A 2R4RA 4ULVA 3V2WA 5B6WA 1UCQA 2G87A 4G72B 1KMEA 3P0GA 1TN0A 1L9HA 1S8LA 3EH5B 1S53A 3X3CA 2XM0A 3C63A 5F8UA 4JEAA 1YZAA 5B6XA 4BWBA 5JT4A 3M4BA 4UG2A 3UZCA 5JSLA 4KLYA 3ZPRA 1APCA 4LDEA 3VG9A 1BRXA 2I1XA 3QVYA 3HNJA 4MD2A 2KSYA 1VGOA 3HARA 5JRAA 3KJ6A 4JQ6A 5JUAA 1PXSA 4CDYA 2Y02A 1VJMA 3QJVB 4AMIA 2PEDA 3PWHA 2NTUA 5A44A 3L1MA 2BRDA 1IW9A 4G70B 4JR8A 3UZAA 2XLEA 2QPEB 3OE6A 1RCPA 4BEYA 4MQTA 4XTNA 2L6XA 1JGJA 3VW7A 3TOMA 1YZCA 5H2LA 3QDCA 4OV0A 1KG9A 4A4MA 4HYXA 4CJGA 5ETZA 1E84A 5H2HA 3WQJA 5B6ZA 3VRCA 3VHZA 4CX9A 4HYJA 3HNKA 3AYNA 3C9MA 3ZEVA 3X3BA 2R4SA 4FAAB 5G2AA 2YLDA 3ZTZA 4D4XA 5EN0A 1JAFA 3QBGA 1E86A 1HZXA 3HASA 5AHZA 4MD1A 5B0WA 3ODUA 1QPUA 3U8PA 5JLIA 3QJTB 2YL1A 3M4CA 5DHGA 3OE9A 3RFMA 1F88A 5JVEA 1C3WA 1C8RA 3OAXA 1S51A 5H2KA 3ZQYA 2XLDA 1XIOA 3EH3B 5B2NA 1L0MA 3S3DB 3M79A 2XM4A 3SN6R 3HNLA 2YDOA 4GRVA 3QAKA 1DZEA 3NY9A 5B6YA 4FPDA 5KKHA 4DS7E 4XT1A 4GP8B 5AZDA 1BBHA 1BM1A 1S8JA 4XXJA 2XLWA 2QPDB 2I21A 3QW1A 3REYA 2YCXA 2WJKA 4GP4B 1QHJA 5AX1A 3PDSA 5H2OA 5BR2A 4EJ4A 5H2IA 5H2PA 1H2SA 2Z73A 3S3CB 4JEBA 1F4ZA 4N4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBS A;  5H2M A;  5AX0 A;  1JV7 A;  4G7S B;  3D4S A;  3MBV A;  4JE9 A;  2XL8 A;  3M15 A;  1UAZ A;  4EIY A;  3PXO A;  1E85 A;  3ZQV A;  5JJE A;  5B6V A;  5ITC A;  2I20 A;  4XT3 A;  4ER9 A;  4K5Y A;  1JFP A;  3HAP A;  3OE8 A;  3IQ6 A;  3AYM A;  3UTX A;  2HPY A;  1YYX A;  3QJR B;  5C1M A;  5FJG A;  3S8F B;  1FBK A;  3ABW A;  5G53 A;  5G36 A;  1NBB A;  1QKP A;  5G2D A;  4BV0 A;  1BRD A;  4G7R B;  2WJL A;  5AWZ A;  1F50 A;  2I35 A;  1MQV A;  4QRY A;  3COD A;  5JJJ A;  3QJU B;  5H2J A;  3C9L A;  4G7Q B;  2BC5 A;  5JP7 A;  1X0S A;  1O0A A;  3HAN A;  3T45 A;  4N6H A;  4QI1 A;  3VGA A;  2F93 A;  1M0K A;  4XTL A;  2XLM A;  4CDV A;  1FBB A;  3QAP A;  3C62 A;  4DKL A;  3QJQ B;  5AHY A;  1E12 A;  4AMJ A;  3QW0 A;  3UTV A;  4CIP A;  3HAQ A;  1LN6 A;  4BEZ A;  4HWL A;  4CDA A;  2KSA A;  3PQR A;  2X72 A;  2YCZ A;  5B3I A;  3DE8 A;  4DAJ A;  3FOO A;  1IW6 A;  4N4Y B;  4QID A;  1LM3 B;  4WGY A;  2J4Y A;  4G71 B;  1S05 A;  2Y00 A;  3EML A;  1XJI A;  3S8G B;  3QBI A;  4GP5 B;  3AM6 A;  5H2N A;  2RH1 A;  1KG8 A;  2Y04 A;  3DE9 A;  4BUO A;  5B34 A;  1CWQ A;  3DDL A;  4CJO A;  5TGZ A;  2XLV A;  4PXF A;  5JJN A;  1X0K 1;  1P8H A;  4IB4 A;  3COC A;  4J4Q A;  1X0I 1;  2ZFE A;  3ZTM A;  1IXF A;  1BRR A;  4TL3 A;  3QVZ A;  4X1H A;  1P8U A;  1CGN A;  2VT4 A;  3V2Y A;  1GQA A;  1M0M A;  1QKO A;  2JAF A;  2F95 A;  1M0L A;  3HAO A;  4LDL A;  1XME B;  1QM8 A;  4NC3 A;  2YL7 A;  3QJS B;  4XTO A;  1PXR A;  5DYS A;  2J9B A;  5G54 A;  5A45 A;  4PXK A;  4EA3 A;  4WAV A;  2J8W A;  2XLH A;  3NSB A;  4LDO A;  4U9D A;  2EI4 A;  2YLG A;  3PBL A;  3NYA A;  1E83 A;  4GBR A;  1TN5 A;  2Z55 A;  1AP9 A;  1GU8 A;  2QLA A;  3UON A;  1Q5I A;  5JS5 A;  5LWE A;  1CGO A;  2YDV A;  2KS9 A;  5ITE A;  1KGB A;  3S3B B;  4L35 A;  1U19 A;  1E0P A;  2KSB A;  3RZE A;  1GZM A;  5B35 A;  4FA7 B;  4L6R A;  3EH4 B;  4GPO A;  1CPQ A;  256B A;  5G2C A;  2XLO A;  1AT9 A;  5AGF A;  1PY6 A;  5G28 A;  2M3G A;  3A7K A;  3NS0 A;  1R84 A;  2YKZ A;  3ZWI A;  1C8S A;  4WGZ A;  4IAQ A;  2NTW A;  2CCY A;  3DQB A;  4MQS A;  1EKY A;  3CAP A;  1Q5J A;  2XL6 A;  1P8I A;  2LNL A;  4D4N A;  3BVD B;  4FBZ A;  2YL0 A;  4KNF A;  4Y9H A;  3UTW A;  4X31 A;  4UHR A;  4JKV A;  2Y03 A;  3HNI A;  3UTY A;  3ZPQ A;  3QBK A;  4WW3 A;  1R2N A;  2YCY A;  3NMJ A;  2ZIY A;  2YCW A;  2AT9 A;  4IAR A;  1MGY A;  3VVK A;  3NMK A;  1M6T A;  4BVN A;  1JV6 A;  3NMI A;  1S52 A;  2Y01 A;  1CPR A;  5A8E A;  3OE0 A;  1GUE A;  1YYJ A;  3FOP A;  1EHK B;  1QQ3 A;  1A7V A;  3VI0 A;  5J7A A;  2YLI A;  4DJH A;  2YL3 A;  3QBL A;  5DHH A;  3NY8 A;  3UG9 A;  5BR5 A;  3TOL A;  3IQ5 A;  4U9E A;  1H68 A;  2ZZL A;  1S54 A;  4GYC A;  2JAG A;  4X32 A;  2R4R A;  4ULV A;  3V2W A;  5B6W A;  1UCQ A;  2G87 A;  4G72 B;  1KME A;  3P0G A;  1TN0 A;  1L9H A;  1S8L A;  3EH5 B;  1S53 A;  3X3C A;  2XM0 A;  3C63 A;  5F8U A;  4JEA A;  1YZA A;  5B6X A;  4BWB A;  5JT4 A;  3M4B A;  4UG2 A;  3UZC A;  5JSL A;  4KLY A;  3ZPR A;  1APC A;  4LDE A;  3VG9 A;  1BRX A;  2I1X A;  3QVY A;  3HNJ A;  4MD2 A;  2KSY A;  1VGO A;  3HAR A;  5JRA A;  3KJ6 A;  4JQ6 A;  5JUA A;  1PXS A;  4CDY A;  2Y02 A;  1VJM A;  3QJV B;  4AMI A;  2PED A;  3PWH A;  2NTU A;  5A44 A;  3L1M A;  2BRD A;  1IW9 A;  4G70 B;  4JR8 A;  3UZA A;  2XLE A;  2QPE B;  3OE6 A;  1RCP A;  4BEY A;  4MQT A;  4XTN A;  2L6X A;  1JGJ A;  3VW7 A;  3TOM A;  1YZC A;  5H2L A;  3QDC A;  4OV0 A;  1KG9 A;  4A4M A;  4HYX A;  4CJG A;  5ETZ A;  1E84 A;  5H2H A;  3WQJ A;  5B6Z A;  3VRC A;  3VHZ A;  4CX9 A;  4HYJ A;  3HNK A;  3AYN A;  3C9M A;  3ZEV A;  3X3B A;  2R4S A;  4FAA B;  5G2A A;  2YLD A;  3ZTZ A;  4D4X A;  5EN0 A;  1JAF A;  3QBG A;  1E86 A;  1HZX A;  3HAS A;  5AHZ A;  4MD1 A;  5B0W A;  3ODU A;  1QPU A;  3U8P A;  5JLI A;  3QJT B;  2YL1 A;  3M4C A;  5DHG A;  3OE9 A;  3RFM A;  1F88 A;  5JVE A;  1C3W A;  1C8R A;  3OAX A;  1S51 A;  5H2K A;  3ZQY A;  2XLD A;  1XIO A;  3EH3 B;  5B2N A;  1L0M A;  3S3D B;  3M79 A;  2XM4 A;  3SN6 R;  3HNL A;  2YDO A;  4GRV A;  3QAK A;  1DZE A;  3NY9 A;  5B6Y A;  4FPD A;  5KKH A;  4XT1 A;  4GP8 B;  5AZD A;  1BBH A;  1BM1 A;  1S8J A;  4XXJ A;  2XLW A;  2QPD B;  2I21 A;  3QW1 A;  3REY A;  2YCX A;  2WJK A;  4GP4 B;  1QHJ A;  5AX1 A;  3PDS A;  5H2O A;  5BR2 A;  4EJ4 A;  5H2I A;  5H2P A;  1H2S A;  2Z73 A;  3S3C B;  4JEB A;  1F4Z A;  4N4W A; 
#chains in the Genus database with same CATH topology
 4MBS A;  5H2M A;  4OIP F;  1H6G A;  1JPN A;  3GEH A;  3MFN A;  3BRJ A;  3IQC A;  2D5R B;  4IAO A;  4X0R A;  2QY9 A;  5KYW B;  3JYH A;  5L0H A;  1H9T A;  3M15 A;  1UAZ A;  4BG0 A;  3PXO A;  1OXB A;  5JJE A;  2UUI A;  5B6V A;  5ITC A;  4R32 A;  4ER9 A;  1MMD A;  3KPH A;  1JFP A;  3AYM A;  1ORS C;  3LEV A;  1WTY A;  3QJR B;  3C8G A;  5C1M A;  5FJG A;  2A6E F;  3IHU A;  4FAP B;  4XEV A;  4MVO A;  2G3K A;  4MTG A;  5G2D A;  3NKE A;  4BV0 A;  2OKU A;  4G7R B;  1NU9 C;  4IWB A;  1MQV A;  3COD A;  5JJJ A;  2KC3 A;  4JTC B;  3TD7 A;  5JP7 A;  3FVY A;  1O0A A;  3HAN A;  4NQF A;  3B9Q A;  1TR2 A;  2NUT A;  4DRJ B;  2F93 A;  1LVK A;  1PV3 A;  5DLJ A;  3C62 A;  4DKL A;  2KJG A;  3R2P A;  1LPE A;  3QW0 A;  1ZHW A;  5KYX A;  3HAQ A;  2W9Y A;  4BEZ A;  4HWL A;  2KSA A;  4MW3 A;  3F46 A;  3PQR A;  2X72 A;  2JX0 A;  4AE4 A;  1HE1 A;  1Z63 A;  4DAJ A;  2E87 A;  4QID A;  2IXN A;  4WGY A;  3C8G D;  3EG9 B;  2EIM C;  3EZH A;  3GOD A;  3R7C A;  2KQ9 A;  4I1O B;  2PNO A;  1XJI A;  3HTK C;  3JT1 A;  4YN0 B;  4XLP F;  4MVM A;  2RH1 A;  3E9V A;  4NCQ A;  3RVZ A;  3DE9 A;  3NYJ A;  4EWC A;  2YQY A;  5B34 A;  4EBB A;  3ZSU A;  1CWQ A;  4CJO A;  3LUT B;  5COM A;  2TMV P;  1BR2 A;  1X0K 1;  2XRH A;  3COC A;  3DM9 B;  1DOW A;  1VB5 A;  3KYI A;  5A6J A;  1TWC A;  1P8U A;  2NSG A;  4NY3 A;  1QKO A;  1GS9 A;  2LFD A;  2P7V A;  2NPU A;  1XME B;  1B68 A;  2AWC A;  3B0U X;  5DYS A;  4PXK A;  3NSB A;  2A69 F;  2EI4 A;  4MTO A;  5A6B A;  4KI2 A;  4GBR A;  5KYN A;  3OWT A;  3RVY A;  1AP9 A;  1IW7 F;  2QLA A;  2IXP A;  1Q5I A;  2YDV A;  5ITE A;  2ZXW C;  1JRA A;  2JPU A;  1WN0 A;  4YL3 A;  1E0P A;  1NU7 D;  1GZM A;  4L6R A;  3EH4 B;  4GPO A;  2XS8 A;  3X1O A;  1VMA A;  3Q7G A;  3AQB A;  2M3G A;  1VK5 A;  3NS0 A;  5D91 A;  2P1A A;  1C8S A;  5CI8 A;  3A11 A;  1G4U S;  1G4W R;  3NYM A;  1Q5J A;  4G78 A;  3TJ5 A;  3EGD B;  2LNL A;  3AOU A;  4D4N A;  3BVD B;  2H7O A;  5F28 E;  4JKV A;  1T01 A;  2HSB A;  2Q4F A;  4LDQ A;  3S0X A;  2J7P A;  4K1O A;  3NMJ A;  3SEO A;  1PCX A;  2AT9 A;  2KSF A;  1ZYR F;  4W8P A;  2V26 A;  1LE4 A;  1FMW A;  1MGY A;  2R02 A;  3VVK A;  2QE9 A;  2KYH A;  1Z3I X;  1TFO B;  1S52 A;  4C3E A;  3JRT A;  4DVZ A;  4BJT A;  2H7V C;  4PJN A;  1LIH A;  3UMK A;  4OIR F;  1R5I D;  3UR3 C;  3SXY A;  4BEM J;  3KH2 A;  5BR5 A;  1ZHT A;  4U9E A;  4M63 A;  5FCL A;  2WZF A;  5A6B D;  2HZ8 A;  1S54 A;  4PJM A;  2HKV A;  4HFF B;  4N06 A;  4G72 B;  3DM5 A;  2ETS A;  3S28 A;  2W4M A;  4CBE A;  5L3Q A;  2KNH A;  2Q00 A;  1EA8 A;  2LP4 A;  3N24 A;  3UZC A;  5JSL A;  3EJN A;  1LI7 A;  3GM2 A;  3WG7 C;  4LDE A;  4MD2 A;  1H9G A;  3RYL A;  1PXS A;  4CDY A;  3ABL C;  5HSW A;  1Z5Z A;  4DXW A;  1A0B A;  3CQZ A;  4JR8 A;  1IW9 A;  1XZQ A;  2XLE A;  2H8A A;  2QNL A;  4HFK B;  1JGJ A;  1OR2 A;  1OKK D;  4XQ1 A;  3ECS A;  3QDC A;  2GAQ A;  4E17 A;  4G0H A;  4CJG A;  2IM8 A;  1QSP A;  4HYJ A;  2L7A A;  1QKR A;  4FAA B;  1HMO A;  2RD9 A;  2PP4 A;  3ZTZ A;  1NG1 A;  4D4X A;  3U5S A;  1RKE B;  3QTH A;  4OIO F;  1JAF A;  3QBG A;  3OEO A;  4EHP A;  4MD1 A;  2YL1 A;  2HV6 A;  1G8X A;  3HKK A;  5DHG A;  1F88 A;  2WVQ A;  1YDI A;  5JVE A;  2R05 A;  1WAS A;  2VC9 A;  5H2K A;  1JPJ A;  4JRZ A;  3MBG A;  2F22 A;  1HW1 A;  3EH3 B;  3B0P A;  3HNL A;  2YHS A;  3W2W A;  3NY9 A;  4KNW A;  1YVI A;  1HE9 A;  3RW0 A;  3RH3 A;  2RSE B;  4J30 B;  1OR3 A;  1SYQ A;  5B1A C;  2XLW A;  4NTB A;  2DGJ A;  3TK0 A;  1D0Z A;  3AG2 C;  4YK5 A;  3WHN A;  1TWA A;  3I4U A;  1PD1 A;  3PDS A;  3LJB A;  5BQI A;  1ZW2 A;  2Q3T A;  3AG3 C;  1F1M A;  3FAJ A;  4U5B E;  1J8M F;  1JV7 A;  4U5H A;  3MBV A;  4JE9 A;  1EI7 A;  4IRU A;  1Z7Q c;  3AGU A;  3IPM O;  2R7U A;  1Q0G A;  4XT3 A;  1V4A A;  1BR4 A;  4CS9 A;  3IQ6 A;  4XWJ A;  4CIH A;  1M56 C;  2HPY A;  1ZHZ A;  5G53 A;  3SNH A;  4GEH A;  1QKP A;  4G7H F;  3H65 A;  1O5H A;  5B1B C;  2LD6 A;  1BRD A;  2WJL A;  5AWZ A;  2X0C A;  1J8Y F;  1F50 A;  4YL0 A;  4JJF A;  3C8Z A;  2G3V A;  3C9L A;  4G7Q B;  2M4E A;  3ABK C;  3T6J A;  3KKB A;  1U6H A;  3MLG A;  4AL1 A;  2A6H F;  2ASR A;  2AU5 A;  1HMD A;  2A68 F;  3EGX A;  3F47 A;  3EGD A;  1FBB A;  2R7O A;  3G4X A;  2OEX A;  2I15 A;  2VCB A;  5HV9 A;  4CIP A;  3UGO A;  4MVR A;  4C3B A;  1V74 B;  1LN6 A;  2I8B A;  4JC7 A;  2YCZ A;  1QLE C;  1IW6 A;  1OCO C;  1ZZP A;  5L0G A;  2KGO A;  1UFB A;  3EML A;  3RKO F;  4GP5 B;  1FNT c;  2DI3 A;  3UMH A;  1KG8 A;  2Y04 A;  1D1C A;  3DDL A;  5TGZ A;  2XLV A;  2EIJ C;  2BE5 F;  2B0J A;  3LLI A;  1X0I 1;  5B3S C;  1IXF A;  1OW6 A;  1CGN A;  3AG1 C;  3U3B A;  3HAO A;  3CAX A;  3OA1 A;  3ZIB A;  3QJS B;  3DZA A;  1W2W A;  1LS4 A;  1ZHX A;  2R7X A;  5A45 A;  4DRI B;  4EA3 A;  2WL8 A;  3QMK A;  4MTF A;  2R03 A;  3PBL A;  3U2L A;  4IJJ A;  2C04 A;  1TN5 A;  4U5F E;  1GU8 A;  2PX0 A;  3GOR A;  4YT5 A;  3UON A;  5JS5 A;  5TJ5 E;  5LWE A;  3E70 C;  1RJ9 B;  2J0W A;  3GM1 A;  4CS7 A;  3S3B B;  4LER A;  2GDC A;  1C02 A;  3CZ6 A;  1AT9 A;  5G28 A;  1TKN A;  1R84 A;  2HJM A;  2P6V A;  4WGZ A;  1K40 A;  4K0D A;  1NSG B;  3DQB A;  4BJ5 C;  1XZP A;  3CAP A;  1FAP B;  5KYU A;  1OCC C;  3UTW A;  5A6K A;  2L6G A;  3ZPQ A;  2DYS C;  3QBK A;  5DS5 A;  1N1C A;  3JYY A;  2HV7 A;  2YCY A;  2WB7 A;  3BEH A;  4IAR A;  3JZ0 A;  4H4K C;  4P9T A;  2Q7R A;  4Q5S F;  2UUH A;  4I1M A;  4ULW A;  3L0I A;  3TQO A;  1CPR A;  3V5X A;  3S90 A;  5T1D B;  1M2O A;  2ZXO A;  5COF A;  2VCC A;  1GUE A;  3GWN A;  1YYJ A;  4LDR A;  2MWQ A;  2Q9A A;  5J7A A;  3JTL O;  5DS4 A;  2IXO A;  4DJH A;  3QBL A;  5DHH A;  3DJU B;  4AK9 A;  3B71 A;  1H68 A;  4HE8 D;  4GYC A;  4BJ6 C;  3U9M A;  4X32 A;  2R4R A;  1FTS A;  4ULV A;  5B6W A;  3DD7 A;  2Z15 A;  4W8K A;  3RF3 A;  3P0G A;  1VYI A;  2A0B A;  1TN0 A;  1S53 A;  2EPK X;  2R7Q A;  1KTM A;  4JEA A;  2J46 A;  1YZA A;  3M4B A;  1H7I A;  3UNG C;  1M2V A;  3LNM B;  4Q4Z F;  1JR8 A;  3HNJ A;  2KSY A;  2KK1 A;  4Q7C A;  3SXZ A;  1ORJ A;  2HMQ A;  2Y02 A;  4P6I C;  4AMI A;  2CNW D;  3L1M A;  2IYL D;  4KC9 A;  2BRD A;  2MHR A;  4MQT A;  5AC5 A;  4UDV A;  3N2Z B;  1YAR O;  5K0I A;  3VW7 A;  4MVU A;  1YZC A;  1BZ4 A;  5H2L A;  3T9O A;  2J7P D;  4HYX A;  5A6A A;  2EIK C;  3VRC A;  3VHZ A;  2Y3B A;  2VCA A;  1VLS A;  2J9V A;  3AYN A;  4DOZ A;  4CS8 A;  2EPO A;  4PFO A;  3VAY A;  3K66 A;  4WJ0 A;  5F5F A;  1E86 A;  1HZX A;  3NYL A;  3HAS A;  2XXA B;  2EPN A;  3T4R A;  3GAN A;  5B0W A;  3ODU A;  1UG7 A;  3Q6N A;  1WGW A;  1U89 A;  3RFM A;  1C8R A;  3OAX A;  1RJ9 A;  3C7J A;  1ZU4 A;  4C7O A;  3S3D B;  1LS1 A;  3U8V A;  4XTK A;  5GPG B;  4GRV A;  3QAK A;  3KL4 A;  2DYR C;  4JJG A;  3MX3 A;  1ZU5 A;  1R4T A;  4JW1 A;  2NG1 A;  4ZLD A;  1BBH A;  4E0I A;  3HJC A;  3DMD A;  4U5D E;  1V55 C;  2WJK A;  5AX1 A;  5BR2 A;  1A7E A;  5CI9 A;  1H2S A;  4JEB A;  1F4Z A;  1Q0K A;  1JOG A;  4N4W A;  4YT2 A;  2LIG A;  5L0J A;  1O87 A;  5AX0 A;  4G7S B;  1KNY A;  2ZPA A;  4EBK A;  4PJL A;  2R25 A;  3U3F A;  3VYW A;  4K5Y A;  3HAP A;  3UTX A;  4YT8 A;  3POV A;  1I5N A;  3MYI A;  3S8F B;  1FBK A;  5G36 A;  1D1B A;  1YA7 O;  3LAY A;  1NBB A;  3EHM A;  2EPM X;  2LSE A;  1Q0F A;  4NTA A;  3LS0 A;  3L8I A;  2HJ3 A;  4QRY A;  3QJU B;  5H2J A;  3PCV A;  3SP1 A;  3U2M A;  3G50 A;  2BC5 A;  4MQ9 F;  4FES A;  4CSA A;  1X0S A;  2QUP A;  3K1I C;  1SR2 A;  1MMG A;  4KBL A;  4NTF A;  3T45 A;  2NUP A;  3VGA A;  4QI0 A;  2OEV A;  2XLM A;  2AVK A;  3QAP A;  2G62 A;  4JCH A;  3I5Q A;  5D92 A;  2HS5 A;  3UTV A;  1RKE A;  4JTA B;  4QI2 A;  4CDA A;  2IXM A;  3DE8 A;  5L0I A;  1OKK A;  3FOO A;  2EIL C;  3PHF 2;  4N4Y B;  5COG A;  1LM3 B;  2J4Y A;  2ZD9 A;  4G71 B;  4O79 A;  1S05 A;  2Y00 A;  1ZW3 A;  2J9U A;  2XS1 A;  4LLC A;  3KMI A;  5H2N A;  2XL4 A;  3AGT A;  1Q0D A;  2V3C C;  1PD0 A;  4BUO A;  2PFD A;  2IOQ A;  3SZR A;  5DS6 A;  4U5G A;  4PXF A;  2Q9B A;  2CDQ A;  4IB4 A;  2J0X A;  2H7B A;  3H2V A;  4GQH A;  1VLT A;  1CGM E;  4TL3 A;  4N6C A;  4OD4 A;  5E33 A;  2VT4 A;  3V2Y A;  1GQA A;  2JAF A;  2R9R B;  1EQ1 A;  2F95 A;  1M0L A;  4LDL A;  3MYF A;  3EHN A;  4NC3 A;  2YL7 A;  1RXQ A;  4XTO A;  1PXR A;  1T6U A;  3K7D A;  5G54 A;  1ST6 A;  1ORY A;  1OW7 A;  4WAV A;  2J8W A;  2XLH A;  3GWL A;  3DKA A;  3G4Z A;  4LDO A;  4J7T A;  2YLG A;  4C7O B;  3NYA A;  3WAQ A;  1E83 A;  2Z55 A;  1CGO A;  2O9X A;  1KGB A;  4MW8 A;  4YT4 A;  1U19 A;  2PBE A;  2KSB A;  1WWP A;  5B35 A;  4FA7 B;  3AJM A;  2W45 A;  4QDL A;  2LFF A;  4EKW A;  2R7W A;  5DVW A;  3RQE A;  2YKZ A;  3RFY A;  3QZC A;  4IAQ A;  3S27 A;  2CCY A;  1AVO B;  4MQS A;  2Y3G A;  5E2Q A;  4ANJ A;  3EGX B;  3J06 A;  2R7V A;  3TJ6 A;  1FFH A;  1HW2 A;  1Z23 A;  4C3D A;  5DQZ A;  4KNF A;  4Y9H A;  4X31 A;  2Y03 A;  3HNI A;  4BEJ A;  1K04 A;  2WVO A;  2BL2 A;  4WW3 A;  1T5O A;  1VOM A;  2HUJ A;  1R2N A;  3ASO C;  1DOV A;  2YCW A;  4XPW A;  2XXA A;  3KYJ A;  3JCU Q;  3FHD A;  4HEA J;  1BR1 A;  1M6T A;  2KW3 C;  4E0H A;  4BVN A;  4PK4 A;  2B0H A;  3ABM C;  1JV6 A;  1TFK B;  1Z6A A;  1SF8 A;  1OCZ C;  2LCH A;  2Y01 A;  5A8E A;  3IQT A;  3OE0 A;  2EIN C;  1SZI A;  4MVZ A;  3FOP A;  2VB6 A;  3O6X A;  4XPY A;  2J9W A;  2Y69 C;  3VI0 A;  5E3C A;  4LLE A;  2YL3 A;  1YAU O;  3UG9 A;  1Q0M A;  3IQ5 A;  1QVX A;  2YEV A;  4OD5 A;  3X2Q C;  1ZVZ A;  3V2W A;  4YWQ A;  1UCQ A;  2L81 A;  3JSZ A;  2G87 A;  4P9F A;  4RD9 A;  2YWA A;  2FGY A;  1S8L A;  2X51 A;  1HY5 A;  1MNE A;  5F8U A;  3JRM O;  4O6M A;  4OIN F;  3DI5 A;  5B6X A;  4XEK A;  5JT4 A;  4UG2 A;  4KLY A;  4ONS A;  4Z9I A;  5CIV A;  2AP3 A;  3VG9 A;  5EGY A;  1BRX A;  2I1X A;  1L3P A;  1WOL A;  2L6F A;  2ZXR A;  4B6I A;  3EFO A;  3US6 A;  3LNR A;  5L0C A;  1OW8 A;  3JSE O;  1WAT A;  1A41 A;  3W4Y A;  2HMZ A;  4BJ5 A;  4KNV A;  4A4A A;  3C8G B;  2VAS A;  2PED A;  5BUO A;  2HFI A;  3DXJ F;  4E7Z A;  4U5E E;  2YRF A;  3UZA A;  1O3U A;  2W4B A;  2QPE B;  4MVQ A;  1RCP A;  4LAC B;  4BEY A;  4FX5 A;  1SMY F;  5AC4 A;  3FMS A;  3FXH A;  4OV0 A;  1NLX A;  1KG9 A;  4A4M A;  4H54 A;  5ETZ A;  1E84 A;  1T9K A;  3WQJ A;  2NUP B;  2NUT B;  3X3B A;  2R4S A;  3FDQ A;  4G7Z F;  3T6B A;  5G2A A;  2YLD A;  3VM6 A;  1YA9 A;  1MMA A;  4I44 A;  5EN0 A;  2M64 A;  5KYX B;  3L34 A;  5AHZ A;  2P61 A;  1QPU A;  3U8P A;  5JLI A;  3QJT B;  3M1C B;  2R7R A;  4XEF A;  3ZQY A;  4I3M A;  4PFP A;  1XIO A;  4JCZ A;  5B2N A;  3M79 A;  2XM4 A;  1RMV A;  4JTD B;  3DAG A;  1DZE A;  5L0D A;  4FPD A;  5KKH A;  2GFH A;  3B29 A;  2A0U A;  4DS7 E;  4XT1 A;  4DBQ A;  4WAB A;  5AZD A;  4YL1 A;  3QW1 A;  3REY A;  2YCX A;  4ZLC A;  4CSA C;  5BQG A;  4EJ4 A;  5H2I A;  2Z73 A;  3S3C B;  3T6G B;  5KYU B;  2CW0 F;  3GEE A;  3D4S A;  2YZS A;  2XL8 A;  1M2V B;  2OCC C;  1AEP A;  2Y3H A;  4EIY A;  1C03 A;  4XLN F;  1E85 A;  3ZQV A;  3NDB B;  1T6Q A;  3SXK A;  1IZM A;  2I20 A;  1T6I A;  5E3A A;  3FAP B;  3OE8 A;  3S29 A;  2J45 A;  1NZE A;  1YYX A;  2XSE A;  3O39 A;  3ABW A;  3DJN B;  1D0X A;  3LEO A;  4PJJ A;  1Y4C A;  2QTV A;  3U0C A;  2I35 A;  3EZI A;  4FWV A;  3A9C A;  1C17 M;  4N6H A;  4QI1 A;  3U9J A;  1V54 C;  1VYK A;  1M0K A;  1M57 C;  4XTL A;  1U0B B;  4BPM A;  4CDV A;  3L8J A;  3QJQ B;  5AHY A;  3LES A;  4PAC A;  3H2U A;  1E12 A;  4AMJ A;  4F4B A;  5T3T A;  1BDJ B;  2IBF A;  3PDM P;  2ZXP A;  5B3I A;  3LLK A;  3RIP A;  4CS8 C;  1FR0 A;  1I4Y A;  2JD3 A;  2C03 A;  3S8G B;  3DWW A;  4J32 B;  1OCR C;  4DRH B;  3QBI A;  3AM6 A;  2Y3D A;  3Q7L A;  3Q6M A;  2WZG A;  3EQL F;  2FAP B;  1QZX A;  2YVK A;  3EH1 A;  2CNW A;  3UMI A;  2PX3 A;  1KU2 A;  4BJ6 A;  5JJN A;  4IGG A;  1P8H A;  4J4Q A;  2LQG A;  4K7B A;  3N0T A;  2ZFE A;  3ZTM A;  1BRR A;  3W2V A;  1AUE A;  3QVZ A;  4X1H A;  4MS2 A;  3V5Z A;  3K33 A;  2MYS A;  3ZVR A;  5KYY A;  1K05 A;  1M0M A;  5L3V A;  3NKD A;  1L7C A;  2R7S A;  1QM8 A;  2OOC A;  4OIQ F;  2J9B A;  2WVN A;  2EPL X;  3AG4 C;  3VF0 A;  4AL0 A;  3EFO B;  2NSF A;  4EBJ A;  4U9D A;  4A2N B;  4DBR A;  2R7T A;  2OJE D;  3SYN A;  4RBN A;  3O10 A;  2KS9 A;  1RKC A;  1NFN A;  4L35 A;  3RQF A;  3HLZ A;  3RZE A;  1FFT C;  4LDK A;  1CPQ A;  256B A;  5G2C A;  2XLO A;  5AGF A;  1PY6 A;  4EUK B;  3A7K A;  1A7D A;  2VH3 A;  3ATP A;  3ZWI A;  4JIO A;  2NTW A;  3ITF A;  4MVS A;  1EKY A;  3W8H A;  2D4U A;  2XL6 A;  1I4Z A;  2L9J A;  1P8I A;  1TWG A;  3EH2 A;  3K6B A;  4FBZ A;  2YL0 A;  4UHR A;  1S7Z A;  4DJ9 A;  3K1H A;  3UTY A;  4PR9 A;  3ZC4 A;  1VTM P;  3C18 A;  4U5C E;  3NG1 A;  2Q9C A;  5KYW A;  2ZIY A;  5EK0 A;  3K1I A;  4AE4 B;  1E2X A;  4GYT A;  1LE2 A;  5EHH A;  3NMK A;  4O6Y A;  3UGP A;  3NMI A;  2CYD A;  1EHK B;  1QQ3 A;  4O7G A;  1A7V A;  5FZT A;  4MND A;  1MND A;  1MMN A;  4J7Y A;  2YLI A;  5BQH A;  1YJG A;  3NY8 A;  3TOL A;  2ZZL A;  1OQC A;  2JAG A;  3ASN C;  1KME A;  1L9H A;  3EH5 B;  1TQG A;  3X3C A;  2XM0 A;  3C63 A;  4Z9H A;  2HSQ A;  4BWB A;  1GM5 A;  3ZPR A;  1OXK A;  1G5Z A;  3W8I A;  1APC A;  2LK4 A;  3WOD F;  2Y39 A;  3QVY A;  3ZDL A;  1VGO A;  3HAR A;  5JRA A;  2GA0 A;  1D1A A;  3EPV A;  3LS1 A;  3KJ6 A;  4JQ6 A;  4AX2 A;  4JUR I;  5JUA A;  3RQG A;  1Y6D A;  1VJM A;  3QJV B;  2GWW A;  3V5Y A;  2A1D D;  3PWH A;  3EG9 A;  2NTU A;  5A44 A;  4G7O F;  3SXM A;  4G70 B;  3NRH A;  4RDA A;  3OE6 A;  5F5H A;  3TUL A;  4E18 A;  2OG2 A;  3S9O A;  4XTN A;  2L6X A;  5T3W A;  4JVS A;  3TOM A;  3IEE A;  4O6N A;  3V7O A;  4XPX A;  1LKX A;  3CEX A;  5H2H A;  2ICW G;  5KYY B;  5B6Z A;  4CX9 A;  3I5P A;  3HNK A;  3PMR A;  3C9M A;  2CGE A;  3ZEV A;  1D0Y A;  2OQM A;  5L0F A;  1FMV A;  3ZG1 A;  3S84 A;  2AWY A;  1ZHY A;  4YJW A;  1GGQ A;  2WZL A;  3CSK A;  5IY5 C;  3M4C A;  3OE9 A;  1C3W A;  1YLM A;  3AQC A;  1S51 A;  2XLD A;  3DAF A;  1L0M A;  3SN6 R;  2OJQ A;  5DQT A;  2YDO A;  2FFH A;  4JZA A;  5B6Y A;  4Z9J A;  2DB4 A;  1XWJ A;  4DVY P;  4GP8 B;  1NFO A;  3GM3 A;  1BM1 A;  1JMW A;  1S8J A;  4CS9 C;  4XXJ A;  2QPD B;  3O55 A;  2I21 A;  4E7S A;  2P0N A;  4GP4 B;  1QHJ A;  3GEI A;  5H2O A;  5A69 A;  1LI5 A;  4BJ1 A;  3B0V C;  1TWH A;  2OU6 A;  5H2P A;  2L6H A;  2PF4 E; 
#chains in the Genus database with same CATH homology
 4MBS A;  5H2M A;  5AX0 A;  1JV7 A;  4G7S B;  3D4S A;  3MBV A;  4JE9 A;  2XL8 A;  3M15 A;  1UAZ A;  4EIY A;  3PXO A;  1E85 A;  3ZQV A;  5JJE A;  5B6V A;  5ITC A;  2I20 A;  4XT3 A;  4ER9 A;  4K5Y A;  1JFP A;  3HAP A;  3OE8 A;  3IQ6 A;  3AYM A;  3UTX A;  2HPY A;  1YYX A;  3QJR B;  5C1M A;  5FJG A;  3S8F B;  1FBK A;  3ABW A;  5G53 A;  5G36 A;  1NBB A;  1QKP A;  5G2D A;  4BV0 A;  1BRD A;  4G7R B;  2WJL A;  5AWZ A;  1F50 A;  2I35 A;  1MQV A;  4QRY A;  3COD A;  5JJJ A;  3QJU B;  5H2J A;  3C9L A;  4G7Q B;  2BC5 A;  5JP7 A;  1X0S A;  1O0A A;  3HAN A;  3T45 A;  4N6H A;  4QI1 A;  3VGA A;  2F93 A;  1M0K A;  4XTL A;  2XLM A;  4CDV A;  1FBB A;  3QAP A;  3C62 A;  4DKL A;  3QJQ B;  5AHY A;  1E12 A;  4AMJ A;  3QW0 A;  3UTV A;  4CIP A;  3HAQ A;  1LN6 A;  4BEZ A;  4HWL A;  4CDA A;  2KSA A;  3PQR A;  2X72 A;  2YCZ A;  5B3I A;  3DE8 A;  4DAJ A;  3FOO A;  1IW6 A;  4N4Y B;  4QID A;  1LM3 B;  4WGY A;  2J4Y A;  4G71 B;  1S05 A;  2Y00 A;  3EML A;  1XJI A;  3S8G B;  3QBI A;  4GP5 B;  3AM6 A;  5H2N A;  2RH1 A;  1KG8 A;  2Y04 A;  3DE9 A;  4BUO A;  5B34 A;  1CWQ A;  3DDL A;  4CJO A;  5TGZ A;  2XLV A;  4PXF A;  5JJN A;  1X0K 1;  1P8H A;  4IB4 A;  3COC A;  4J4Q A;  1X0I 1;  2ZFE A;  3ZTM A;  1IXF A;  1BRR A;  4TL3 A;  3QVZ A;  4X1H A;  1P8U A;  1CGN A;  2VT4 A;  3V2Y A;  1GQA A;  1M0M A;  1QKO A;  2JAF A;  2F95 A;  1M0L A;  3HAO A;  4LDL A;  1XME B;  1QM8 A;  4NC3 A;  2YL7 A;  3QJS B;  4XTO A;  1PXR A;  5DYS A;  2J9B A;  5G54 A;  5A45 A;  4PXK A;  4EA3 A;  4WAV A;  2J8W A;  2XLH A;  3NSB A;  4LDO A;  4U9D A;  2EI4 A;  2YLG A;  3PBL A;  3NYA A;  1E83 A;  4GBR A;  1TN5 A;  2Z55 A;  1AP9 A;  1GU8 A;  2QLA A;  3UON A;  1Q5I A;  5JS5 A;  5LWE A;  1CGO A;  2YDV A;  2KS9 A;  5ITE A;  1KGB A;  3S3B B;  4L35 A;  1U19 A;  1E0P A;  2KSB A;  3RZE A;  1GZM A;  5B35 A;  4FA7 B;  4L6R A;  3EH4 B;  4GPO A;  1CPQ A;  256B A;  5G2C A;  2XLO A;  1AT9 A;  5AGF A;  1PY6 A;  5G28 A;  2M3G A;  3A7K A;  3NS0 A;  1R84 A;  2YKZ A;  3ZWI A;  1C8S A;  4WGZ A;  4IAQ A;  2NTW A;  2CCY A;  3DQB A;  4MQS A;  1EKY A;  3CAP A;  1Q5J A;  2XL6 A;  1P8I A;  2LNL A;  4D4N A;  3BVD B;  4FBZ A;  2YL0 A;  4KNF A;  4Y9H A;  3UTW A;  4X31 A;  4UHR A;  4JKV A;  2Y03 A;  3HNI A;  3UTY A;  3ZPQ A;  3QBK A;  4WW3 A;  1R2N A;  2YCY A;  3NMJ A;  2ZIY A;  2YCW A;  2AT9 A;  4IAR A;  1MGY A;  3VVK A;  3NMK A;  1M6T A;  4BVN A;  1JV6 A;  3NMI A;  1S52 A;  2Y01 A;  1CPR A;  5A8E A;  3OE0 A;  1GUE A;  1YYJ A;  3FOP A;  1EHK B;  1QQ3 A;  1A7V A;  3VI0 A;  5J7A A;  2YLI A;  4DJH A;  2YL3 A;  3QBL A;  5DHH A;  3NY8 A;  3UG9 A;  5BR5 A;  3TOL A;  3IQ5 A;  4U9E A;  1H68 A;  2ZZL A;  1S54 A;  4GYC A;  2JAG A;  4X32 A;  2R4R A;  4ULV A;  3V2W A;  5B6W A;  1UCQ A;  2G87 A;  4G72 B;  1KME A;  3P0G A;  1TN0 A;  1L9H A;  1S8L A;  3EH5 B;  1S53 A;  3X3C A;  2XM0 A;  3C63 A;  5F8U A;  4JEA A;  1YZA A;  5B6X A;  4BWB A;  5JT4 A;  3M4B A;  4UG2 A;  3UZC A;  5JSL A;  4KLY A;  3ZPR A;  1APC A;  4LDE A;  3VG9 A;  1BRX A;  2I1X A;  3QVY A;  3HNJ A;  4MD2 A;  2KSY A;  1VGO A;  3HAR A;  5JRA A;  3KJ6 A;  4JQ6 A;  5JUA A;  1PXS A;  4CDY A;  2Y02 A;  1VJM A;  3QJV B;  4AMI A;  2PED A;  3PWH A;  2NTU A;  5A44 A;  3L1M A;  2BRD A;  1IW9 A;  4G70 B;  4JR8 A;  3UZA A;  2XLE A;  2QPE B;  3OE6 A;  1RCP A;  4BEY A;  4MQT A;  4XTN A;  2L6X A;  1JGJ A;  3VW7 A;  3TOM A;  1YZC A;  5H2L A;  3QDC A;  4OV0 A;  1KG9 A;  4A4M A;  4HYX A;  4CJG A;  5ETZ A;  1E84 A;  5H2H A;  3WQJ A;  5B6Z A;  3VRC A;  3VHZ A;  4CX9 A;  4HYJ A;  3HNK A;  3AYN A;  3C9M A;  3ZEV A;  3X3B A;  2R4S A;  4FAA B;  5G2A A;  2YLD A;  3ZTZ A;  4D4X A;  5EN0 A;  1JAF A;  3QBG A;  1E86 A;  1HZX A;  3HAS A;  5AHZ A;  4MD1 A;  5B0W A;  3ODU A;  1QPU A;  3U8P A;  5JLI A;  3QJT B;  2YL1 A;  3M4C A;  5DHG A;  3OE9 A;  3RFM A;  1F88 A;  5JVE A;  1C3W A;  1C8R A;  3OAX A;  1S51 A;  5H2K A;  3ZQY A;  2XLD A;  1XIO A;  3EH3 B;  5B2N A;  1L0M A;  3S3D B;  3M79 A;  2XM4 A;  3SN6 R;  3HNL A;  2YDO A;  4GRV A;  3QAK A;  1DZE A;  3NY9 A;  5B6Y A;  4FPD A;  5KKH A;  4DS7 E;  4XT1 A;  4GP8 B;  5AZD A;  1BBH A;  1BM1 A;  1S8J A;  4XXJ A;  2XLW A;  2QPD B;  2I21 A;  3QW1 A;  3REY A;  2YCX A;  2WJK A;  4GP4 B;  1QHJ A;  5AX1 A;  3PDS A;  5H2O A;  5BR2 A;  4EJ4 A;  5H2I A;  5H2P A;  1H2S A;  2Z73 A;  3S3C B;  4JEB A;  1F4Z A;  4N4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...