1XMEB

Structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
publication title A novel cryoprotection scheme for enhancing the diffraction of crystals of recombinant cytochrome ba3 oxidase from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 1xmeB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1xmeB02
3HB3B 4A2DA 1PXRA 3VHZA 4NC3A 3PWHA 3IBOA 3PQRA 4NAJA 4BWUA 1BQKA 1MG2C 1S8JA 5H2OA 1ADWA 5B3SB 1J9RA 1DZ0A 4N4YB 2YDOA 5A44A 5B0WA 3DKHA 4TXVB 1FFTB 4MQSA 4BDVB 1XIOA 3OE0A 1HAWA 4YSPA 1FBKA 4BEYA 3TU6A 2HRHA 3CVBA 1AS8A 5B1AB 2KSAA 3UGEA 5H2NA 4QLWA 1H68A 3TASA 2Z73A 4X4KA 1P8IA 4N6HA 5TGZA 3NS0A 3GYRA 4LDEA 2HXAA 2AZUA 4YSDA 4CSPA 5H2PA 1IW6A 3NSBA 2E86A 5PAZA 2I85A 5PCYA 5TK2A 4GYCA 3QAPA 4BWBA 4DP6X 2BP8B 2WJKA 4G71B 1OV8A 2VW6A 1X0SA 4A66A 1J5DA 1NIFA 4KO7A 2P80A 1VGOA 2KS9A 1JZIA 1BQRA 2BP0B 1IBYA 2FT6A 3UG9A 1L9SA 3AG4B 4A2GA 2BWIA 2DV6A 3CZUB 4AKPA 3ZEVA 4DP4X 3FSAA 4MD1A 1KDJA 2I21A 5EN0A 1TU2A 2VSMB 4DP8X 1PZCA 1GZMA 1L9OA 1SFDA 3T45A 4F7KA 3NSCA 4UANA 4DKLA 3MBVA 2NRDA 4QI1A 1T5KA 2XV2A 4W9ZA 2ZIYA 3G5WA 1XMEB 4N8UA 4JHVA 1NDTA 1GU8A 3PDSA 2AZAA 2EIMB 5E9NA 5A7EA 1XB6A 1L0MA 3WKQA 5ANHA 4HHWA 5G54A 2CALA 3QQXA 1OE3A 2PPFA 4JKNA 4YVUA 3OQRA 2Y01A 2UXVA 3AG3B 1JFPA 5B6VA 5A45A 3VI0A 3VVKA 3EHBB 3T71A 2A3TA 2FNWA 2AVFA 3AG1B 1AQ8A 4M3HA 3VGAA 1PZBA 3FSZA 2AFNA 1NTDA 4L0PB 2NTWA 2I7OA 1S54A 5G2DA 3QAKA 2Q5BA 5H2MA 3OMAB 4EA3A 1ZDSA 5DYSA 1M0KA 4DP2X 2YCXA 4GRVA 1NIBA 5LDUA 4HHGA 1LN6A 1L9QA 1PNDA 2DYRB 3ODUA 4G7RB 2IDUA 5LWEA 1QM8A 1SDDA 4EJ4A 3QJTB 4IB4A 3VG9A 1E67A 3N55A 3UAEA 4ENZA 4LDLA 5G53A 2CCWA 1AG6A 3UONA 3NJLA 3CDZA 1NIEA 1ILUA 1JXDA 3FU9A 4GP4B 3ASNB 3HANA 2VN3A 2NTUA 2I35A 4AZUA 4L6RA 1CYWA 4KO9A 3X1EA 1NPNA 4E9RA 1OOWA 3PLYA 1X0K1 2IAAC 4G70B 4BVNA 3FYEB 1AP9A 2YCZA 3WKPA 4IAQA 1N70A 2I1XA 2HZHA 2UX6A 3FU8A 1UCQA 5D4JA 1JV6A 1FWXA 4HIPA 4HYJA 1JERA 4LDOA 3FPXA 4BXVA 2RACA 2QPDB 4XXJA 3UZCA 1MZZA 4FBZA 4BWWA 2FQFA 1KG8A 1WAEA 1YLBB 7PAZA 5BR5A 2XVBA 3PAZA 2FTAA 4L35A 5B34A 5AKRA 4A68A 1BEXA 5B7EA 3WNIA 3JTBA 2FT8A 2VW7A 4HCGA 4NERA 2Y03A 1M57B 4WKXA 1TEGA 4BDVA 3UTXA 1WA2X 8PAZA 3QPKA 5ETZA 1J5CA 2GC7C 2FQGA 4HCIA 1X0I1 2GSMB 4GY4A 2R4SA 2VT4A 2FQEA 3S8FB 2XX1A 3QJUB 1KCWA 2L6XA 1FBBA 1XJIA 3OE6A 1JGJA 1E65A 1V10A 3CVDA 3NJHA 5EHFA 4HAKA 5TK4A 1NINA 2R7EB 1R2NA 3OD3A 1PY6A 1E12A 3T9WA 2EILB 3FSWA 1M9WA 2VW4A 1KMEA 3C9LA 3ZX1A 1TN5A 2HX8A 2JXMA 4Q8BA 2PP9A 3NJGA 2XWZA 1ILSA 2BP8A 1KG9A 3JT2A 1TEFA 4GBRA 3EF4A 4Q89A 3T6XA 3QJSB 2IDFA 1ZPUA 3FQYA 1M0LA 1X9RA 3EH3B 2Y69B 2GB2A 3BQVA 1MG3C 4KLYA 2H3XC 2YAFA 2BP0A 4A4MA 2PPCA 1MDAA 3QBKA 2FWLB 3DDLA 4UG2A 1WS8A 1ASQA 1AOZA 1XB8A 4QKTA 2ZZLA 4BK5C 2LNLA 1ZIBA 2B08A 3T6ZA 3QBIA 1JXFA 2BZ7A 5DHHA 1RKRA 5B6WA 5B6XA 1VJMA 3QBGA 1F4ZA 2HLEB 5J7AA 3ASOB 4PAZA 3U25A 1W6WA 2EI4A 2FT7A 3ABWA 1OCOB 3UTYA 3FQ1A 3FSVA 4KNFA 2F93A 4F2EA 1RZPA 2N0MA 4GP8B 1JVLA 3ZIYA 4ZK8A 3IE9A 5B7MA 1C8RA 2ZFEA 1L9HA 5BR2A 1V55B 5AFAA 2PLTA 1DZEA 3D4SA 3NP3A 3HEIB 1U19A 1AG0A 3QJQB 3ZPQA 4FAAB 1ET7A 3ABMB 5B1JC 1MGYA 1V54B 1PY0A 4JHUA 1NICA 3EMLA 1PZAA 3NSDA 2WSDA 2OJ1A 6PCYA 3WQJA 3DIVA 3S3CB 2VMJA 3NJNA 4PXFA 5JJJA 4KNUA 2YAHA 2WO3B 4RH4A 4IARA 2PCYA 1BRXA 4YSAA 2PP8A 3H56A 5I6PA 3GXUB 1WA1X 2CBPA 1A3ZA 2XUWA 2G87A 3S8GB 1WA0X 1AZUA 2J56A 3C75A 2X72A 3PXLA 4KNSA 1EHKB 4XT1A 3X1BA 5B7FA 1BQ5A 4QIDA 4EIYA 3PAUA 3FYIB 2ZOOA 1A4AA 3PCYA 5I5IA 1BXAA 3RFMA 2DY2A 4KOCA 5H2JA 1GY2A 2YQBA 4M4RB 4BEZA 1B3IA 1ASOA 5B1JA 2UX7A 2W88A 1SFHA 1AR1B 2XV0A 2M3GA 1AIZA 4XT3A 1GS6X 5I5JA 3T6VA 4E9SA 3QDCA 1RCYA 4E9WA 3TBBA 1MZYA 2J5WA 3ABGA 3QJVB 5KKHA 3NYKA 2R4RA 1F56A 1AS6A 1IUZA 4DP1X 1OE2A 2XU9A 3COCA 2YXVA 1SHXA 1I53A 2YCWA 1AZNA 3H4HA 1QHJA 5H2IA 1S52A 3X3CA 1SJMA 3KW8A 3H4FA 2XX0A 5H2KA 1BM1A 2KSBA 2I20A 1PF3A 2QDVA 2YARA 5B1KA 5F7BA 4CSZA 4EF3A 1CWQA 3FU7B 3OE8A 5F8UA 4DAJA 5G36A 1PMYA 1H2SA 3IEAA 3ZDWA 3UACA 4MD2A 1BXVA 1KDIA 5DHGA 2DWTA 3HAOA 1PLBA 1C3WA 2Y04A 1HAUA 4FPDA 1IKOP 4OV0A 1QHQA 4QRYA 3X1GA 2F95A 4DP0X 1NPJA 1JV7A 4Y9HA 2XV3A 5AHZA 5B1BB 3AYMA 3V2WA 2JAGA 1OCCB 4F2FA 3EH4B 2R7EA 2MRYA 5G2AA 1BYOA 3AYNA 5AX0A 1M56B 3OMNB 4YSSA 1OF0A 1R1CA 5D4IA 2IDQA 4JR8A 2AT9A 1VLXA 3IN2A 1E0PA 1KYAA 1JOIA 2GC4C 4KO6A 4A2EA 4E9TA 3NY9A 2J4YA 4UAHA 4DPBX 3X3BA 3NJMA 1J9SA 5G28A 4JQ6A 5H2LA 1N68A 2PEDA 1NIAA 2EIKB 1L9TA 2PCFA 2W8CA 4P5RA 5FJGA 2AANA 4BWTA 1A4CA 5I6MA 1ID2A 3UAAA 2PP7A 2HX7A 4MBSA 1WS7A 5B6YA 2X87A 3FQ2A 2CJ3A 1A4BA 5AHYA 3ABKB 4YSEA 4W1TA 3PPSA 4G7SB 3P0GA 1GSKA 4E9XA 1NWPA 1C8SA 2WJLA 3TBCA 1M0MA 3NJIA 2H47C 4KOBA 4E9VA 3NJJA 2VM3A 2JKWA 4AMJA 4XTLA 3OM3B 1RZQA 3CG8A 2BRDA 3N2JA 3OMIB 1E5ZA 2BHFA 4KO5A 4MFHA 2BO0A 1SF5A 2YAMA 4YSCA 4FA7B 1CUOA 2YAEA 4XTNA 4A2FA 1GS8A 2RH1A 1NZRA 1OCZB 4GXFA 1S8LA 3NYAA 3MBWB 3VW7A 2Y00A 1O0AA 3WNJA 2UXFA 5AZDA 5I6LA 4X1HA 4YSRA 2IH8A 2PPEA 1TKWA 1IXFA 1L9PA 2I7SA 2OV0A 1J9QA 5IY5B 2PPAA 5H2HA 2GBAA 3PBLA 1QNIA 1JXGA 2OCCB 1EZLA 2XXGA 4GYBA 4HYXA 3RYMA 1JZJA 1ZV2A 2YDVA 1ET8A 2TSAA 3AW5A 1JZFA 3AZUA 5I6OA 1CURA 3S3DB 3NSFA 4DPCX 4X31A 3CAPA 1XB3A 5C1MA 2LLNA 3QBLA 5B2NA 3V2YA 4YL4A 3HAQA 2YAPA 1JZEA 2YXWA 1PXSA 5I28A 1BYPA 3UADA 4BXSV 4BUOA 3NJFA 5I6KA 4DP5X 3C9MA 3V9CA 1AANA 3SN6R 3PAVA 3KJ6A 4G72B 1ZDQA 5AWZA 2Y02A 1SNRA 2BWDA 1AACA 3UTWA 2ZXWB 4UHRA 2IWEA 3FS9A 1IBZA 4DP7X 2XLLA 2IDTA 1KBVA 4WAVA 1SF3A 3NJKA 4E9QA 2VM4A 1OE1A 2BW5A 3ABLB 3V9EA 2IH9A 1J9TA 2YCYA 1E30A 3DTUB 3NT0A 3AG2B 4HCFA 1JZGA 4DP9X 4N4WA 1GYCA 4G7QB 2UXTA 1AZRA 1AZBA 1BRDA 2J55A 2DWSA 3X1FA 3X1NA 2BZCA 2FQDA 1Q5IA 3UABA 3SBPA 1JVOA 5D4HA 2HPYA 3FT0A 1X9UA 3CODA 3AY2A 3NP4A 1PNCA 3ZBMA 1GW0A 5AX1A 2UXGA 3T6WA 2IWKA 4TL3A 3FU7A 4AX3A 4YSUA 4J4QA 1KBWA 1KCBA 2YAQA 1IC0A 3WG7B 5A8EA 3TA4D 4GPOA 1URIA 1A65A 5ITEA 4JKVA 4DJHA 2QT6A 3AM6A 2P80D 1ZIAA 3IN0A 4A67A 2J57A 5AZUA 6PAZA 4XTOA 1GUEA 1HFUA 3MX0B 5I26A 2EINB 1E5YA 1KV7A 3UZAA 2CUAA 3UTVA 1IW9A 4YSOA 1P8HA 1BRRA 3WI9A 3WIAA 2B3IA 1GS7A 1PLAA 5JJEA 2H5UA 4HZ1A 3EH5B 2GHZA 4KNTA 1W8EA 4DPAX 1NWOA 1F50A 5G2CA 2CAKA 2VSKB 1R84A 3HASA 1GY1A 1AZCA 1SHWA 1FA4A 1L9RA 1TN0A 1QKOA 5B35A 2ZWNA 2JAFA 1ASPA 1CC3A 1ET5A 2PPDA 1GR7A 2GIMA 3CVCA 3NY8A 3GDCA 1QKPA 3L45A 4AI7A 2TSBA 1PAZA 1CYXA 1F88A 3D12B 1HZXA 3OAXA 4YSQA 2KSYA 2IWFA 2X88A 4E9YA 5I6NA 3NSYA 2FJSA 2GI0A 3SBRA 3SQRA 4GP5B 1Q5JA 1SDDB 4PCYA 1PCSA 1KGYE 2Z55A 4K5YA 4P5SA 3X2QB 2XXFA 2HX9A 1W6LA 2DYSB 3HARA 1BXUA 4K9JA 1JZHA 3SBQA 5ITCA 4YVNA 4AKOA 4YSTA 2IDSA 1BAWA 3CDZB 1A8ZA 1KGBA 4AMIA 3RZEA 1S53A 4PXKA 3REYA 3S3BB 1AAJA 1AS7A 2HRGA 2YAOA 4BV0A 5I5MA 2WO2B 4WW3A 1DYZA 2JFCA 2QPEB 3HAPA 1UAZA 9PCYA 4HALA 5F7AA 3ERXA 5B6ZA 3FPYA 3DQBA 1NIDA 1AT9A 2QDWA 3ZPRA 1P8UA 3BVDB 4HWLA 1PLCA 1S51A 2ZONA 3KW7A 3OE9A 1UATA 4WTQA 4AKQA 5JJNA 3PXOA 1QLEB 5FC9A 2Q9OA 4UF7C 2MTAA 2XYBA 4NB7A 1ETJA 2Y1AA 7PCYA 3A7KA 1OCRB 2BW4A 4X32A 4MQTA 2EIJB 4A2HA 3QJRB
chains in the Genus database with same CATH superfamily
4G8GE 2VSCA 4A2DA 3PWHA 4ZXBD 1DBJH 4J3WA 5IK3B 2EZ0C 4AM0B 4PLKC 2PR4H 4N2HA 4NENA 4P3CH 2OYLA 3S88L 4G83A 1BZOA 5A44A 2ZUYA 3UTTD 4ZPTA 1KIUA 2YMXH 3OE0A 4HCRL 4RGMB 4YSPA 2I24N 2HRHA 1FYTE 3UBFA 3G5XA 4PYGA 3UGEA 2J2ZA 3P40A 1AQKL 1OSYA 2AJ3A 2EP6A 1F4XL 3GF8A 1EA9C 2D03H 3EYOB 3MUGA 4JANB 4LHQB 2ZUQC 3O6LH 4U1MA 3MREB 4R90H 4F8PA 4F1SA 2JIXD 3UZQA 1AXTL 2HT4D 1CGSL 2ZP0T 4GRLB 4RMUA 3QHFL 4HU2A 3UO1L 1F4YH 3NZHL 4WENB 1OO2A 3CVHL 4AC4A 3O8XD 4PJDA 1O7SA 4C54A 3HRPA 4LLYA 2P8MB 4XO8A 1UG9A 5JIPA 4WUUE 3I02B 1L0QA 1VHPA 2YGQA 5HHOB 1K72A 4MD1A 1KDJA 2R0LH 3NGBC 4UTBL 4ZZKA 2XIDA 5DQJB 2NY6D 2VIRB 3V0JA 3VXUB 1T1XB 3TBYA 1PD6A 3QW9A 2ZWSA 1IIKA 4OFIA 3FO9B 3L4WA 5F71A 3WENA 1C5BL 2Z9TA 3FOLA 5I15L 4OCYL 5I6MA 4M8QB 4D9RD 4TMPA 5FV2A 3WELA 3VYNA 4W6YB 3TIEB 4M7KH 4DKAA 1TXKA 5EORL 3O45A 2R4SL 2FB4H 3AG1B 2EE6A 4Z8FL 1JF1A 3L3GB 4KZEL 4GMSH 2NTWA 1ODAA 4LLVA 4YPGA 2X6VA 1AYOA 4PIRF 4XAKD 3NZUA 3QCVH 1BX2B 3PWPA 3SDYH 1F1DA 4PJGF 3HE6C 4F15C 1UH3A 3ULVE 7FABH 3ZDYB 4F58L 3ESMA 2VC2H 3L3DB 3BSZH 3NFPA 1AH1A 2YK1L 4Q4EA 4M6OH 3EOTL 1CLYH 4KDVA 4QRRD 4Z3FA 3EZ8A 3LZFL 3P69A 1PSKL 4PCTA 3X17A 1YMMB 1N19A 1KB9K 5F88A 1GZPA 1P6WA 5ANMA 5F9JA 1BVOA 2GFBA 4Z7NF 1M53A 1UT9A 4AITA 3CFDB 3FFDB 2JKJA 2ZCZA 3SPVA 4NRZA 4HOZA 2EDYA 2VABB 2WNXA 1QLEH 3TCLA 5EF2A 3Q48A 4HJGA 5I8CB 1QWUA 5F97E 4FYQA 2K3TA 2KDYA 5MERA 2W59A 3N06B 3VQMA 1QI5A 3Q01A 2Q6WA 1FZOB 2WVTA 2WJ5A 1A8JH 2RACA 3WE6A 2HG0A 5DYFA 1YLBB 2Q86B 3QUMH 3U4AA 1AXIB 7PAZA 4KTEH 5AKRA 5EULV 3ZO9A 2Q76B 4F9PC 4ZX6A 4K0OA 1G4MA 2WOYA 3CUPA 4JAMA 3ROOA 5A43C 1KBGH 1WD8A 3GUFA 4BQBA 3EDDA 5IIEB 3QXUA 1RHFA 2JK5B 2ADFL 5SV3A 4JO5A 3HW7A 1KCWA 3S8FB 5E2VH 2DQDH 3CVDA 3DPBA 5J8OA 5DRWB 1I3GL 1ZHNB 2CK0L 2EDEA 3FSOA 3BUPA 5LAXA 1FZMA 4DQAA 3MRGB 1WEJH 2HX8A 1BQHG 4Y5XB 5D1ZI 4WI2A 2XQYK 4JUTA 4K55A 3EFDH 4ZX5A 5CINL 4XMVA 1RJZA 4AYFA 4F80A 1OQXA 2X9YA 4I7ZC 4LNRA 1G87A 4MJ5A 2ENQA 4X5LA 4ZUSB 2RCSH 4RGOH 5JW3H 1S5IL 4JCMA 3RWCB 1CICD 1HYSD 2VISA 3QR2A 4FXKA 5DD3H 5GGVL 3I9IA 5H2BB 4APQA 3MRIB 3VI4A 4I85A 2FJGA 5K1VA 5HHOE 4LNVA 3CXDH 3KPRE 1CE1L 1BEYL 1OLZA 5I1DB 1RH8A 2IGFL 3VXUE 1OCOB 2FBJL 1OPGL 4I2XA 1RZPA 4KHXH 4Y5VC 5FO9A 4GP8B 5E8OB 1JVLA 1YEFL 3SJVD 3U79A 4NQSA 2ZFEA 3BZDA 4MXWL 3GSRB 32C2B 1MH5A 4MWFA 2P7TB 3NMEA 1ET7A 3S36H 3ZXAC 5FF6A 1OF2A 5JIDA 1PZAA 4TL4A 4W68A 2CRYA 1KIRB 2XG4A 2H6OA 4PJ7A 2CLZA 2VN5A 5IMMA 1J87A 4JN2B 1S5HA 1FL5B 1UJTA 1D5IH 4FQQA 2ZKWA 4HXAH 1SM3L 1R5WB 3DSFH 4P5TC 2GPZA 8CGTA 4R9HA 4NQDB 3EYVA 1AY1L 5E99L 4UQ3A 4GQ9L 5EU5B 1DVZA 3MJWA 2J6WA 4QXUL 3KL3A 3ARGB 4HT1H 4BZ1A 4QIDA 4LP5A 3ZDYE 5CBEB 3FT2A 4S1QL 4OZGF 1BIIA 1GY2A 1DVFA 1AKJD 1M7IA 3VDBA 1LMIA 1D5RA 4X7DC 4YXLL 3DURA 3GMMB 1AE6L 2IBBA 2FJHB 3CV5A 1YMME 3SE3C 1MIMH 3ABGA 1RIUH 4L3FA 3ULUE 2EYSB 3HS8A 4JG0L 4Q52A 1NUDA 3OZ9H 4YZFE 2P5WD 4N22A 4XNBA 1PZDA 1U95B 2HFEA 4K3EH 2XZAH 1FGVH 4XNMA 4XVTL 4P05A 1TQBB 5KYNA 3IKCB 2I5YH 1H5BA 4LVHC 1CCZA 5KOVC 2DQTL 3U36A 4D0CA 1R5VB 1Y0LB 1N9PA 5B1KA 1BAGA 2X3AA 2X6UA 4FGMA 2EDXA 1VGEH 4HUXA 1E4XI 1RK0A 3U7YL 3BWUC 3GRWA 4ODVH 1NANH 5G36A 4NQXB 1H2SA 2YSSA 2FYYB 3UYOD 4HIHA 4Y9EA 3VXOB 3HAOA 3JTSA 3I6KA 3MOBH 4YE4L 5FUOL 3U4EA 1LP9F 1V3MA 2BNQA 3NK3A 5J12C 3WN5C 3FXIC 3GIVB 4LLAA 5DRXB 1NPJA 4R84A 5BZWB 5D72H 1AGCA 2R15A 3FAXA 3ZE0F 1WZAA 2VDQL 2VN7A 4PJBA 4KVPA 3TESA 1K2DB 2H2PD 3GEWB 4L2YA 3D2UD 3GGWA 2GT9B 5G2AA 4OQTA 1BJMA 2XVLA 3RBSA 2G60L 3WFEH 5GZOD 1JZ4A 5D4IA 4KWUA 3RWGB 4JR8A 3IN2A 4XVOA 1GJUA 4HUCA 1TTGA 1WD9A 2ADGA 1MWAH 1MCNA 1P4LB 2A99A 1RIHH 5E94A 4WWNA 5CD5D 4WEEA 3GLZA 1TJGL 5B38A 1CDIA 2UVEA 4OZIB 5AHYA 1EEYB 2ZWLT 2AEQH 4N2IA 5D7IE 5FV1L 2KHAA 3MRQA 3SGJA 3FF8A 5GGVY 3QCTL 1OTSC 1A02N 1M0MA 1OGPA 1N4XH 2VMDA 2JKWA 4M61A 2N7BA 1CD8A 1F8TL 2HVKB 3KD4A 1KSRA 2UZXA 2BNRA 3RWIA 4BFRA 2EDRA 3N2JA 1YA5A 5DMIL 2K4WA 4PREA 4KO5A 4HWZB 1KGIA 1WZ1H 2I9LB 4U6HB 4WI7A 5ESQA 4A2FA 1I9JL 5HJBA 2QADC 1R5IB 3MBWB 3OAUL 5DHEA 5BMFH 1E0OB 4X1HA 1PY4A 1YYLH 2IXQA 4S1RL 3SKJH 1EVTC 1J9QA 1IEAB 2CXGA 4M93B 4YDIH 1QFWH 3DJSA 1BZ9A 4NZUL 4U1GC 1R33A 3O3AB 2G30A 4X6EA 5IB3B 4B3VA 5GHWH 3N1QC 5DQDL 1ZV2A 2VLJA 5IT2H 3FB8A 3KLLA 2AJUL 4H8WC 3NSFA 4X31A 3CAPA 1Z9SA 1DN0A 4PFEA 3TJPA 2XY1A 3L2NA 4NQDE 3BUIA 1TO4A 1BYPA 3UADA 4BXSV 4OCLC 3LKNA 4AG4H 5B8CB 1GOHA 1J5OH 2VUKA 4XTRD 5AAMC 2VM9A 3T6QC 4KHTH 4OQTL 4U1SB 1QEXA 4EUPB 4RAHA 3LSOB 4XNAA 3T0BA 1AC6A 2X6CA 4TVPE 4XOCA 3DMMA 12E8H 1YC7A 1XO8A 1XZ0A 1IGTB 3A67H 4LB8A 4PSRA 2YIHA 3AFLA 1RIVH 1AD9A 1MCKA 5F0JB 1HEZB 1RVFH 2XWDA 3OG4B 1AJ7H 4V2BA 2BMKB 2OR8A 4WW1B 1E2WA 2LE9A 3QVAA 3WTSA 4AENA 2PWEA 3NDZE 2W60B 1R3KB 3MMEA 2DAVA 2DI8A 4GT0A 2EEDA 1TQTA 3JV0A 4APQD 3FQWB 4DEPB 1X9UA 4CBZA 1IQDA 1QABA 1JNNH 3QEQA 4Q9QL 4R7LA 4UNUA 5IQ9B 4J4QA 1KBWA 2WOBA 3ETSA 3GMOB 3BH9B 4PGJA 2QT6A 3DOSB 2VCOA 2J7LA 5D1QD 1T2XA 3A24A 4XVJL 4AIEA 5GS0L 1WAAA 3F62A 4B9ZA 2FD6L 3UTVA 5A2JH 1BRRA 4N85A 1T0OA 3DXAB 4KKAC 1MN4A 3RTQA 2ICEA 4L1SA 4UV7L 4A7QA 4HG4K 1SZNA 4FNLL 3AWFA 4ORZC 2C3HA 1JBJA 4MJIA 3FNKA 4C57C 3ESOA 3MODH 3QO0B 2BPBA 2BVPA 1UB5A 2PO6D 4NQTA 5F1NA 1SVZA 3PUCA 1KUMA 1CYXA 4HH9B 43C9B 4M6AA 1F88A 2Q7YB 3GB7A 3I50L 2CKBB 2IWFA 1QSEE 4PJ9D 5JIMA 1EAOA 1ND0A 1QR4A 3SQRA 4OZIE 4FHJA 4C4KT 4L37B 2JB6B 3CAFA 3ZN6A 1HJCA 1S9YB 2E6QA 1HU8A 4WY7H 4XP6L 2NY1D 2AS5M 1NAKL 4TF4A 1CGVA 3KYMA 4GKSA 4PWKA 1OAXL 2JNZA 1C12B 2WMPB 5DZPA 1E9QB 3V6FA 2APXA 3RB5A 1LO4L 4ANUA 1F2XK 5DS2A 3BIBX 5T5FH 3PHOA 4IJ3C 4BA8A 4DQOL 1ZK9A 3HAPA 2ZX9A 3P2TA 2VR5A 2VDKB 3L5XL 4HALA 1Y6MR 4Y9BA 4ZS7L 5B6ZA 2XNAA 3CH1B 1AT9A 1PW3A 3D06A 2MCPL 3MNMA 1P7QA 4GXVL 3ARBD 2FWOA 2ICWI 3SKOA 3IMRA 1XF4A 4K3DL 1WRFA 4NNXA 4UF7C 4NB7A 3Q1SH 4L4TD 2FEDD 3D3VB 3ARRA 4GAFB 2NY0B 5EPMB 5BUAA 1J8HD 3HB3B 1YQVL 1X7TA 1U8IA 5AW5B 1T89A 2ENSA 2LV4A 4EUPG 4QIRA 4JMXA 4J3OF 2Y7QB 4JFWA 4QI3A 5F6IB 1WGOA 5I1KH 4ZMAT 4KROC 1RZKL 3PWJB 1HAWA 2BDNH 3TU6A 5KS9B 1NFAA 3WTTA 4K8RC 3VFVB 5H2NA 3KGSA 1H68A 2QKIA 2WAQA 4PV8B 2KYIA 5IEKB 2C4XA 3NAAL 1P1ZB 2C3VB 35C8L 5A2LH 2X7LB 4QT5A 2WSKA 4PTUA 2Z4QA 4WFFE 3NS0A 2EACA 1WFTA 1T3FA 3PWLA 2N59A 2OAAA 4NBYB 3LQZB 2H45A 2G9KA 4JFDA 5PCYA 3VFGH 3SDXA 4MKMA 4UINH 2OI9B 4U1IB 3VX0A 3DX3A 4FQ2L 3ZTNL 3PNWA 3T4YB 4ISVA 1Z9OA 4AT6A 4MASA 5KSAC 5D1XB 1UGNA 5DWUH 2P80A 4JPKH 4BHUA 4S11A 1RI8A 5IVXB 2FT6A 1X4YA 3HZ3A 3ZEVA 3VGAC 3FSAA 5ISZB 2VSMB 3SCMB 4DP8X 5JPNB 1TDQA 1SEBB 1Q1JL 4OB5L 3CSYB 4I0PC 4AVIA 4X7FC 5INCA 1PKQB 1CGWA 1T0MB 4LCWB 3RIFF 3V7AG 5J89A 4O9HL 5F70A 2HVJB 5EIVA 4J3OC 1JSYA 2P43B 3NPSC 5JORA 4JKNA 5C0CB 4ERSL 2UXVA 2NX5D 3UTPD 3CFBA 1B4LA 1FO0A 3VWKB 3T77B 3AMKA 3FRPA 4AW7A 6TAAA 1YUHB 3DXAE 3L6FA 2CBMA 3GMQA 1ZHBB 4HWNA 3KBHE 3MKKA 3L4UA 1K8IB 2AFNA 2DQHH 4ADGA 1S7TA 4UILL 3V7AE 2X4OA 1GCYA 2NNAB 4PLJD 2WZ5A 4G9DA 4IOIB 4X7TB 1AC0A 5DYSA 2CO1A 5M7QA 1F6LL 1R24A 3QB7C 3H3PH 5D93C 3V4UL 4L3EA 3B9VA 3MLYL 4IIQC 4JFYB 2P8PB 3ODUA 1SDDA 4HH8A 3PABB 1E5AA 3UAEA 4NM4L 1JWUA 3BRFA 1ZTXL 2FJUB 3EYQC 1DO6A 3WHXB 3ZE2F 4G1EB 1KEMH 2NTUA 3BN9D 5ALBL 3O3EB 5MENA 3PLYA 2EVGA 5C8JA 3DUUA 1H9DA 1D5ZA 4M6ML 1S3RA 5I75C 1UH2A 2N1TE 3V0WH 4QPEA 3P30L 4GW5A 5F2FA 1UCQA 5FYJU 3CC5A 3MCYA 4LOUC 3CQPA 3E6FA 3KPMB 4K7PX 2OMTA 5JQ6L 1JWMA 2HKFL 3D3VE 4ALAC 1A3LL 5B1CA 3ZZQA 2IAMD 4KH2A 3IU3A 3M1BA 1CD1A 3ZW3A 1NGWB 1F0LA 1I8AA 5BVPL 5AYUL 4LLWB 3QIBA 1M1XB 1FO0L 1L7IL 1PQZB 5IBLD 4NS0A 4GY4A 3I84A 3RPIB 3ILQD 1NCJA 4I9WE 5KS9E 1AI1H 4XPGL 1JYNA 2E7CA 5D7SL 1NINA 2Z7YA 3A4AA 2DYPB 3OLGA 1DQJB 4LRIC 2DJSA 4LPYA 4L8BA 2OYPA 1SY6A 4FLQA 3JWOH 4HGWA 1HK6A 1I9RH 5DQ9A 3SN6N 2FSEA 2ZYIA 2ETWA 1OGSA 3MBEB 1T7WA 1DJIA 1JV2B 5I1LB 1T22B 3B34A 5TE6H 5DD6B 2EKJA 4XNQB 4ZTPL 4LBAA 1DUZA 5D70H 1OP4A 4PJHF 5HYQA 4MNQD 3UAJA 2XCMC 5JW5A 4WHCA 5D1XE 4C56D 3QH3B 4KI5D 2AHIA 2DTML 1FN4B 1NCAH 1NMAL 2YBGA 3EKCA 5LGHH 3TCTA 3ZYJA 3LN4A 2YPVH 5JHLA 1P4UA 4NQVB 2D0FA 1MW0A 3L4CA 1NCTA 1GH7A 4OJAA 5ISZE 1FVEB 3BUDA 3MLWL 4TSCL 3TJHD 3DC0A 4HBQA 2IV9A 2GW5A 3VM5A 3FSVA 1J9CT 3ARFC 1AVAA 2CM5A 3IU4L 4PGEB 1PKQE 2Z31A 4P23C 2AW2A 1C8RA 3C87A 4LCWE 4JVWA 5DFVD 1DZEA 1U19A 1KN2H 3ZPQA 5C0CE 4X6CA 1NICA 6PCYA 1AGBB 3NESA 5H4ZA 2R83A 3VFPA 4PGCB 3L3OC 4XO4A 2ENJA 2NDFA 1ZXQA 3H8NA 5AW0B 1THCA 2ADYA 2OL3H 3LN5B 2EXSA 4ZOCA 2OZ4H 4GO6B 3WFDH 2Z91A 1XDTT 2X2YA 3K0YA 3NQIA 4MMXA 3QXAB 3VTAA 4GSDH 3M86A 1I8UA 2DIJA 3PP3K 1F90L 1U93B 3DK2A 3GSXA 4HJIA 4XMKL 5T1KB 3ZKSD 5I1CH 4LAQL 1N5YH 3G5ZA 2QVMA 1ASOA 1FSKC 4XT3A 1FLRL 1EAPA 1MCCA 2A1WH 4Y2LA 2YGOA 1CDGA 4JFTA 3BFWA 4XC1L 2MCAA 4ZFFA 2X4SB 4AQ1C 1C1EL 5BNXD 1A47A 3QXDA 3BP6B 2BZDA 3EJQA 2E4FA 5DEFB 2CQVA 1GMEA 2YWZA 4NN6C 3PP4L 4O00A 4F91B 1FNSH 3UPRA 3FB6B 1MNUL 3CN2A 2XX0A 3MLRH 5JUEL 3RNQA 1HH9A 3ZE1B 1RULL 1L9MA 1EV2E 3MCG1 2DBLL 5HY9A 4PGDA 2NZ1A 3U1PA 2G75B 2I25N 2J8UB 3X3GH 5SWSD 2BFGA 1NGYB 1WAPA 3HI1A 3X14B 3S2AA 4FPDA 1K4CB 3ARPA 3KMDA 2JELH 1JV7A 1E3FA 4M7LT 5C0RL 4XXCA 4M43L 2MH4A 3ZUNC 4A7GF 1X4ZA 2R7EA 3EOBB 5AW9B 4B5EA 5IWLA 3BGFB 1IZKA 4U7SA 4GRMB 3REVA 4CVZB 3QI9B 4OF0A 4OD2B 3BIAX 4PP2A 5H4YA 5BPPA 3L48A 3V4VB 4A2EA 4IHOB 5I1JH 4LSRH 3NJMA 4ODUB 1NSNL 2EIBA 4LDLB 3GJFH 2VN6A 5DRNB 5A2FA 1WSST 1L3WA 1EJOH 2JB5L 4P46A 2O26U 2OXGA 1FF5A 3VDAA 2H6UA 3ABKB 4XP4H 4S1DD 5C09A 2CD0A 4L29B 2WTRB 2EYTB 4HKZA 3RVUD 4XGZB 5F7KC 4X8XA 4ZFGH 1A14L 5IQ7H 3BO8B 3WMQA 2ZJSH 3KM1A 5CSZA 1H3WM 1B9KA 2NNRA 3NA4A 2RD0A 3SE8L 1G43A 2GJJA 2J6EA 2HB0A 2DQIL 1DVUA 1GOFA 3J27A 5F7DA 1UZ8A 2F8VA 4ODTL 3F7YB 1QPXA 3C08L 1OCZB 4XPBL 1NGZB 1QBMH 3CIAA 3VG0H 3BEVA 4DF9A 5JYLA 5HJ3A 1T1ZA 1B0RA 1MHCA 1XL6A 3MRBB 3E0GA 1XXDC 2BXZA 1XTMA 2H6PA 1ESOA 1JI2A 3N3EA 3N91A 4D94A 3AY4C 4TLSA 4YZWA 1W0VB 2OCCB 5CZKA 2ARJQ 5JZ7D 5FXCH 3OQ3B 2XN9A 3NRQA 4HUNB 3O6FC 4Q0XL 4KPHH 3VFUA 3I74A 2ZNWA 3JT0A 1S2EA 4HJJL 2EC9T 2HN7A 5C1MA 4FG2A 2D7TH 3EGDB 1QACA 4LSVH 2IPKA 1OAKL 1JZEA 4U2ZA 2HT3C 1QBAA 3M45A 1Q8MA 3AU1B 4HJSA 2A83A 4DP5X 4CGTA 1LQBC 4NI3A 4M00A 4G72B 1CDHA 2EDBA 4POZD 4YHLH 1X9QA 1DJWA 1IGML 4PLNC 4JM2C 4JFEA 3RZCB 4R0LB 3Q3GB 1BGXL 4N2GA 4E9QA 2WBJC 1P9MA 3OAZH 5DS8B 5BRZD 1OE1A 1MIEH 3DX8B 1ORSB 5EBMB 4KX8A 1J8SA 1ZHKB 4UIMB 3DBSA 4PJXB 3FONA 4ODXA 1UJ3C 1LEGA 2D3LA 4RNRA 3X13B 5K9OA 4JFUA 4LKCB 3LPFA 2BZCA 3IJ8A 3QZBA 3EO1A 4G82A 3VFWB 2XQYG 4UIKL 3ZBMA 3RJQB 5J3HC 1SXBA 3OB8A 4GBXA 3T6WA 3CZEA 1FORH 3THML 4KTDL 2EIZB 4XCCH 5FHBH 3ZE1E 5D55A 5HHMB 2YQGA 2B1HL 4Y16C 1IAKB 2BHZA 2C1PA 3ZIMA 2QVIA 1DQDL 1T80A 4P2QD 2AJVH 3MSPA 1XGRA 3REWB 3T3MF 3MOAH 2XPZA 3MVSA 2IQAB 1GUEA 2J8UE 2MEJB 4ZUTB 5I26A 1E5YA 3QCUH 1A6UH 3TVMC 4KZ0A 4GLRI 1DDHB 1YEDB 1KIQB 3O2VH 4V1DB 5HBBA 3MV11 1DBJL 3FT4A 3TYFB 1BF5A 3CC1A 1YN6B 2PR4L 4P3CL 1I3RA 4HZ1A 5D1ZD 2DWDB 2LU5A 1Y18B 2XBDA 1MAML 4MCMA 3LY6A 3LS4H 1EGJA 4KFMA 1N8OE 5ECJE 5IZ7A 4UYPA 2J71A 1JK9A 1KG0A 4PB0H 1CC3A 3GXPA 3BSZA 5HXMA 2PPDA 2ZF8A 4G6FD 4LEEA 2D03L 3RI5K 4ANXA 5FUCC 1KB5B 3APCA 3MV9A 3O6LL 2EVHA 4MTMA 4R90L 4PJEB 3QUZD 2CRZA 2W0PA 3P3YA 4ZSOA 2CNYA 2EXTA 3FB5A 4NDMB 1F4YL 1I7UA 2D73A 2NTFB 4O2FA 3UGUA 1PIFA 4JRYD 2WKGA 1ZHLB 3V6ZB 2ORBH 1S7WA 2B4CH 3O11B 3E3QE 5JDSA 5ABZA 1I1AB 3II3A 1X5KA 5F9DC 1PDKA 3C6SB 1W6LA 2X1XR 1HQ4A 3KWTA 2IDSA 2BVYA 3U46B 4GUPA 3GK8L 3RKPA 5B3NA 1B2WL 3IDIA 2R0LL 1MEXH 4OAWA 5FK9B 3SDCB 2YSTA 1IJ9A 1UAZA 2FHCA 3EDKA 4G9FA 4PJFB 2CGRL 4BH8A 1JYXA 1EEZA 2J4WH 3FCSA 1S51A 2AKRA 3ZLQC 2WQ8A 3MKGA 1W16A 1F1AA 5CJ5A 5I66A 2YJLA 2EICA 1Y07A 4X32A 4XNZB 1IC5H 3QJRB 1HH6B 2J1ZA 4JFFD 4LESA 4M7KL 3SBWC 2E7LC 3QQDA 4HKJB 1WCQA 4MCYA 2GJRA 3LZPA 1BD2B 4JO2H 5GIRA 3FTSA 3US0A 4I1NB 1A2YA 2C7FA 1VEMA 3H9HB 3A6BL 4Y19A 5JW4M 1T1WA 1PG7H 3OLDA 3DO7B 3FTGB 2WXRA 4PJ8B 2ITCB 4N0RA 3AWGA 1IEBA 3QCVL 3V0HA 4N6HA 4N8PA 2V9UA 1EO8H 3OLEA 1HI6B 1DBBH 3BSZL 5IEHB 3RWDB 2O6DA 3AWEA 4X83A 5IR1B 4M6OL 3LEXB 1CLYL 3FUEA 1W0YT 4LVNB 4LRNH 3VXMB 4G8FA 2QV2A 3BPNB 4MCNA 2O6EA 3MHZA 3O9WB 4PJXE 5AAWC 2V0AA 4A66A 2NTSP 2RQ8A 2YBRA 1NDMB 4Y5YA 2Z0BA 4AMXA 1BAFL 4X98A 4OU3A 3PWUB 1P69B 4J39A 2BINA 3TURA 3L5JA 1P4BH 2IWGA 4ETYA 3TN0B 5CFAA 1G7PA 4FQHA 3CZNA 4Y89A 1I7ZB 1NCWH 1OAQH 2YUZA 4N5UA 1IM3D 2NRDA 3I75A 3QIUA 4MBOA 1MCQA 5CUSH 5DMGC 3DROB 4X80H 4KKBC 3G5VA 3VWJC 3CPUA 3T8XB 2EIMB 3CD4A 5D7LA 5CP3H 1FG9C 2QR0B 5FO7B 4IRJC 3QUML 3QQXA 1OE3A 4KTEL 1KV3A 2QGCA 4PWHA 3IRZA 4I0KA 4V1DE 4K9EC 4XXDA 3JXAA 5T1LA 2UYLB 4HAGA 2FNWA 1A1MA 2H3KA 1KBGL 5CFHA 1OZUA 3RB7A 4BUQA 1S54A 2NYYD 3QK0A 5E2VL 1TO5A 1IX2A 2DQDL 5H2MA 4UUJA 4P4KC 3DX6A 1ZDSA 2AJYH 5CD3B 3KWUA 1KCVH 3LEYH 4MMZA 1O9WA 3B37A 3FOMA 4ZXBC 3FT9A 2HLAA 2FO8A 3QNFA 1LM8V 4NPYA 1U2CA 4WI9A 5EO0B 4PJEE 5TH2A 3S98A 4G7RB 2VXUH 3P73B 3R1GH 1QPKA 3EFDL 4MA3A 1S7SB 4IB4A 2CA3A 4P2RB 4Z77A 2F1EA 2WLLB 2BRRH 5I1AB 3ZYZA 2P46B 1H3GA 2RCSL 1D2PA 2ZICA 4RGOL 5CHNA 5JW3L 4QWWD 3KH4A 2Z0UA 5DUBA 5DD3L 1NCBH 2HT4C 3EH2A 1TVBB 5KVGH 2I9TB 3CXDL 5D4QA 5AUMB 1Z9MA 3N85H 4Z7QB 4Z9KB 3RFZC 3PQYD 3O8XC 4PJFE 2IBZX 4XNXH 1S7RA 3AABA 4GBXD 1NUFA 4KHXL 2CLRA 1IE5A 2J88H 2AQSA 4JNXA 1S9XB 4UOJA 4FBZA 4TUUA 2VSDA 2UWEB 3S36L 4EIZC 1T7YA 3U0WL 1MLBA 2FTAA 4A68A 3K46A 2NY6C 3EYFB 1J11A 1BD2E 5DUPL 3VXPB 1C5DB 1ZY9A 4Y4FD 8PAZA 3ULVF 2WXGA 2NY3B 4IGBC 1D5IL 5EOCH 2BHYA 1W72B 2GC7C 1J0JA 4HXAL 3R8BB 5FUZH 2ZXBA 2CK2A 2VT4A 1D5MB 3CFJB 3VTMA 2FO1A 3K71A 1V10A 1PS3A 2ZF9A 1S7XB 4NYLA 2MFNA 2IQ9L 1UACH 2QL1A 3HC4H 3HG3A 1E12A 3WOVA 5HHQA 2EADA 1QWHA 3GPEA 4NQCB 1KMEA 4DUWA 1M7DB 1U21A 2R1WB 2PP9A 4F33A 3MV9D 1KYOJ 3DETD 3O4LB 1HHGB 1HL8A 2BP8A 3WUWB 1UA7A 3T6XA 1ZPUA 5EEXA 5I2IB 1BOYA 1QFUH 4Y7OC 3BQVA 3VXME 4ELMA 1RIUL 2IADA 5TE4L 4BH7A 4PW9A 3GFUA 3OZ9L 2EDDA 1MHEA 1M05A 4N20A 5ICUA 4F5CE 4Z7WF 2VDRL 1KWKA 5SX5H 4ONFH 1FGVL 3DX1A 3T6ZA 5HHPA 1QO3A 3QULA 3MRCB 5J7AA 1EDYA 2I5YL 1W6WA 1NC4B 4NUJB 3ABWA 4PJCA 4U1JA 3TT3L 4N2MA 2BH0A 1A1OB 3QO1A 3UP1A 1YECH 4WFED 4AUYA 2PW1B 3WLWD 1A6PA 1CF1A 2VZTA 2FVNA 3IE9A 5JOPE 2W0FA 4ODVL 2E4TA 3FTUA 2XWTB 1KLGA 4NHUA 4QHNB 1L0PA 1AG0A 2W95A 4FAAB 2XN0A 4Z1PA 2ILLA 1RUQH 4KKZA 4HMCA 1P4IH 3MOBL 5EUKA 2OJ1A 2WD0A 3H55A 2BVOB 2C1OB 3PGFH 4PXFA 5D72L 2P1YA 4K5NA 4OCMC 4R4ND 5KSBA 5F7YC 3ZQXA 4D0BB 4ABQA 3IGKA 3DHUA 3H56A 5J1AA 3H42H 4NOFA 4NQEB 3MLTA 4JO3H 5DZLA 4W6XB 3WFEL 3QUKA 4EBQH 1B0GA 4NO5A 1LK2B 3C75A 1RZFH 3PXLA 3MZTA 2V8MA 3S97C 1A6ZA 1MWAL 3TJEH 2BSRB 3ULUH 3EO0A 3PAUA 3QFJE 3RG1C 2VYRE 1QA9A 4ODWB 3GSQA 5B1JA 4WU5A 5CS7A 3QXTA 5BS0A 1AR1B 1Q9OA 2WB1A 4NAQA 4P2RE 4E9SA 1ZANH 2EH7H 3MN8A 2AEQL 1E42A 1MZYA 1MJJA 3ES6B 2UY7A 1JN6B 3HMXH 1XIWB 3VXTB 3UCRA 1FZKA 1NBQA 4YE0A 1N4XL 1AS6A 1IUZA 5JO5A 1HQRB 2VRKA 2NR6D 3MRJB 2DQMA 4X9BA 1NEUA 1Y6KR 1WZ1L 4AV0A 3QC5X 4Z7QE 4AZ8B 2DJUA 2HSIA 5E6ID 1ZKAA 4N28A 5CP7B 5BMFL 1QFHA 1YYLL 1CICC 3L5WB 1T6WA 5SWZD 4ZNCD 5LWYH 1HYSC 1IBGH 2AV7A 1WO2A 3KDPB 3SKJL 3KS0J 3LAFA 2ZXEB 2UWEE 3LQAC 1QFWL 2DWTA 5CN1A 3NUKA 3BESR 3TS8A 4LLQA 4QRYA 4U7KA 5EN3A 1TZIB 4Y9FA 5IT2L 2C9QA 2XV3A 4B41A 1F4HA 4XH2A 3WUWG 3ZDYF 3O81A 5C2UB 3LD8C 3AYNA 2Y7SA 5D7JB 1H3UA 1JI1A 5KBNC 5BV7L 4AG4L 1G7HB 3BQUD 2EDHA 3H9ZA 5KYUA 4QOKA 4FQCL 1OZTG 5CZVH 3ULUF 1VFUA 4NQCE 4WCYH 1FJ1B 4FJ6A 3DX7B 12E8L 2AANA 2ZXDA 3O4LE 3A67L 2PP7A 2F7QA 2CBTA 3CVHB 3OJ2C 4HIXH 1CQYA 3CU7A 4GKNB 1RVFL 3U9PH 3LKOA 4KX7A 2P9RA 4TM9A 4BKLA 4UQ2A 4QJ5B 5J6HB 1AJ7L 3D39D 1NCGA 4E9VA 2H47C 1QTPA 4J3BA 3G5YB 1H6EA 3PJSB 4JY4B 5HHME 3V0EA 3WTYA 4MZRA 4GXUN 2CRIA 3PXJA 1CXIA 2H3NB 4JZJC 5SX4I 4FERA 3SODB 3U9UB 4EAEA 5LDSA 3ARZA 5LLIC 3HA0A 3MI6A 2NUTB 2DQJH 3LRHA 4XCEB 4WQOA 3GINA 4GQZA 4POYA 3AT8A 1WVZA 5FKAA 2Z4TA 3HG0A 4BZ2A 2EC9U 1TKWA 1BSIA 3AREB 1TFPA 3NIFB 4NBXB 3GSVA 5ENWA 1VENA 1IZJA 3EOAB 3RP1A 2FO4A 2DLTA 2PYFA 1VZHA 4PD4J 5IOPB 1LLAA 1UM4H 1CURA 1T83C 4XN5A 4QHMA 1IO4C 4WO4A 5BZZA 4LPUA 2UV3A 4NENB 2LLNA 4TVPH 3QBLA 4NN5B 1JK8A 5F3BA 1CBVH 1WG3A 2FZ3A 4FFWC 4NQEE 3V8CA 3J8F7 2LU7A 4ZPTB 1KIUB 3FN9A 3MODL 3BZ5A 4ZMVA 3G5XB 3M8OH 2J2ZB 3PL6A 1AQHA 3L95A 2AJ3B 1LD9A 4U31A 1KCSH 2H2PC 4U4BA 1FL6A 4U1MB 3W0WB 2SEBA 2A7BA 4WWKA 3Q0HA 2X40A 3EJPA 2BW5A 3HI6H 2WUBL 4ZO6A 3FN0H 4KK8C 1W80A 5F7UA 5GZOC 3GS0A 1VA9A 3SGDH 4N0YH 4WY7L 3BPOB 1BRDA 2R56L 4TVUA 3RIAF 4PJDB 2VMFA 4LLYB 3GI9H 3ZZLA 4GMTH 3OKNA 1XH3A 2VH5H 5T5FL 3CODA 1GW0A 2UXGA 3O6KH 5DEGA 1A6AA 1KNOA 2H32A 4PPTA 4OBSA 5F8RC 3IRPX 3UZVA 3TBYB 2OYMA 3HFML 4HU8A 3VXRD 2A9NH 4LLUA 3IDNA 4TN9A 3UZAA 1R3JA 2GTZA 4XCFH 3LNEA 4I3SH 1SN5A 2IH1A 5E7BA 5HDQH 2OS7A 4Y5XC 5K1JA 4A55A 3P4NA 4KNTA 4FQLH 3AT9A 1HCYA 4DZ8A 1WCBA 3TBWA 2K9UA 3O45B 3H85A 4P2CG 3GJEB 1JF1B 4PR5A 4W4OC 1SYSA 1BF2A 4MZ2A 4LLVB 4M62H 4YPGB 1TETH 3P54A 1A3RH 4MD0A 3NY8A 3L45A 5GSRB 4DW2H 4H8VA 3QNXA 1TR7A 2V2TA 4HLJA 3PWPB 4KZDL 1IKNA 2VQTA 2QSCH 3F3HA 3VFGL 1UA6H 5LN8A 1E27A 4UINL 3NFPB 1S78D 3L1GA 3SDDA 1U6AH 4FS0A 3IETA 1H8LA 2Z55A 3MLXH 2EEFA 3IXTA 4K5YA 1GC1L 3H53A 4HUVA 4IRSD 4XTRC 5FM5O 4MAYA 1Q0YH 3BVUA 3H54A 4JFQA 3SBQA 5DWUL 1QI3A 4JPKL 3D18A 5F88B 1GZPB 3FCTA 5ANMB 2LR4A 4MLSA 5I74B 4OIAA 2GFBB 3RA7H 3RZWA 5J56B 1UWGH 3Q8BA 2VLKD 4WW3A 4NRZB 3SPVB 3GBML 4R4BA 3FUNA 1ES0A 5T33H 1Z9LA 4RESB 3TCLB 1TZAA 1NIDA 1TOXA 5I5IA 4HJGB 5CLXA 2AQNA 4KJYA 3GI8L 1N59A 2C9PA 5MERB 5CSGA 2R8SH 3DJ9A 3G6JB 1J05A 3NIFE 2Q6WB 3WE6B 3IBOA 4OZFH 3WFHA 5B3SB 2BX5A 4TL5A 1KBPA 1JTPA 4TSAL 3TEUA 3UZEC 4EUPH 3CUPB 2RAMA 5D1QC 1HZLA 3TH2T 4JAMB 2DQHL 3ROOB 1FBKA 2C9XA 2IAND 3C60D 1Q9LA 4P49A 2KSAA 1CIUA 1Z66A 1GTFA 1JZDC 3EBHA 4OZIF 4PMFA 5KBPA 4RDQG 5K9QI 3H3PL 3AQDA 3LMJH 1VJSA 4BFJA 2O5NA 1MCFA 3QWNA 1EHLH 5LAXB 5KBKA 1FZMB 1KIPB 2XTJD 5ESVA 3WFCL 5EEZA 5F3HA 4JJHA 2DI7A 4ZFOA 1EFXA 1XFPA 1RJZB 1BQUA 3OXRA 4LNRB 4W4NA 2MPAH 2PO6C 4MJ5B 5CEYA 1KEML 4PJDE 3HG1A 1OGTA 3BAIA 1OVZA 1T0NA 4PJ9C 2KMWA 2VISB 3C8HA 4FXKB 1JTTA 4GKZA 2OLDA 4Y4KA 4UQCA 3UJIL 2A9MH 3VI4B 5C08D 5E00A 3BKYH 2FJGB 4G1MB 2F19H 1DQQA 1X5XA 3PE9A 1UOLA 4Y9CA 1NGXB 1GGUA 1IJNA 2NY1C 1A9VA 4XMWA 1KN4H 4RAUA 3MV01 2GKIA 2X89A 3FU6A 4I2XB 3SDAD 5FO9B 5I0VA 2XQBH 3IMSA 4NQSB 5D6DA 1HIMH 1A1NA 1FH5L 4BFBD 3T2QA 3UAFA 1MH5B 4MWFB 5FF6B 1KXQA 2X41A 3CFKA 3S5ZA 1KACB 2B2XL 5TQ2H 1BVNT 3VMPA 2XG5A 2VDQB 1GGCH 3KPSD 2XG4B 2XHNA 3QUXA 4PJ7B 5KBLA 2CLZB 5IMMB 1KPVA 3ARBC 3IRCA 3U30C 2FNBA 3DARA 1S5HB 1E4JA 1MY5A 2CU9A 5DFAA 4CC4A 5IW3A 5L2KD 5LXGL 2FEDC 3EHBD 2BVTA 4Q6IC 1Q38A 4X7SL 3EYVB 2WXJA 4E42B 2QHRH 4UQ3B 1CL7I 5TDOA 1YJDH 1NIBA 1GZHA 4XWOD 1KZQA 3HAEA 4XE5B 3K6FA 1PNDA 3JWOL 4MS8D 3CSPA 3H2WA 3WXWL 3PWPE 4GUQA 1I9RL 3V4LA 1P0SE 1IAOA 2XV6B 3FT2B 4NN7B 4QHLA 1BIIB 1DVFB 1M7IB 1N5AA 3BT0A 4ZZFA 5TE6L 4ZW7A 5D70L 1JXDA 5TQ2L 3IMTA 2CR6A 4L6RA 1NCAL 2N56A 5LGHL 3TTSA 1NPNA 2YPVL 4IBLT 4DK6A 5IFAH 1S9WA 2DF3A 2YCZA 3EJUA 1HT6A 1ZAGA 1OM9A 4XNMB 2F61A 1IM9A 3RY6C 2VQ1B 1RPQA 3VXSD 4DCQB 4PVBA 4PY7A 3NTCH 5A6LA 2P5EA 2J73A 1H5BB 5GJTL 3K72A 4LT7A 4GSUA 4D0CB 3U36B 2QPDB 3UZCA 1SJXA 4HUXB 4D8PA 1RK0B 1Q0XH 1DE4A 1JDDA 1QFWM 2X4RA 5B34A 5HVWA 1MAKA 3IGUA 4Y2DA 1BMGA 3JTBA 2YSSB 3VQ1C 4HCGA 3JTSB 3U1SH 3I6KB 1E4KC 5C0FA 2BNQB 3TFBA 5E5MA 2FQGA 2OZ4L 2LABA 1AGCB 4PJBB 3ZRSA 2VL5A 3WFDL 3DHJA 4PWIA 3GGWB 1KT2B 3FFOA 3GJFA 4KJPD 2YD9A 4GSDL 4YDZA 4XHJD 3L5HA 1ZMYA 1NKRA 3ARDA 1TN5A 2APSA 3FQNA 2KT6A 2ADGB 2CNZA 4MD4A 4JFSA 4J1UA 2VXSL 1N5YL 1ILSA 3D0AA 5E94B 3VFRA 3GBEA 3ETTA 3KLHD 2B0SH 3AB0B 3EH3B 1FNEA 5B38B 3D30A 4EIBA 1E6JH 5GQBA 1SOSA 4PBDA 1E2ZA 3MRQB 3DDLA 5D96B 4R26L 2X3BA 5EN2B 2ZZLA 4FYRA 4R7XA 1JXKA 4M61B 1ZCRA 3KPNA 1ICTA 5DHHA 2UZXB 2BNRB 1FNSL 4H0GA 4P5MA 2YRPA 3RWIB 1I8MA 3VI4E 2DD8H 3MLRL 4YEEA 1N18A 5DC0A 4H0HB 5AALA 4JG1H 4X99A 5ESQB 2B5IC 5AFAA 5ES4B 2F53B 3E38A 2PLTA 1JGDA 3D4SA 4I2XE 2DTSA 1EFQA 4XPTH 3X3GL 2IXQB 3ZDXF 3ZKMC 4OGAD 5KS9F 2E74C 2OR9H 4KVCL 4KI5F 2VMJA 1BLNA 1BZ9B 3LTVA 2JELL 2XPGA 2YAHA 4X6EB 4FLRA 3CMOL 1FG2A 5GGRY 4PJ7E 2NT0A 3CSBA 3PDOA 5CKGA 2VLJB 4L8SC 3A3YB 3FB8B 1SJHA 2ZIDA 2CDFB 3FUMA 4WI8A 3GXUB 1XD0A 2ED8A 5HVGB 2KI6A 1Q9KA 1DN0B 1YRKA 1Z9SB 1QHPA 2IAMC 3TO4A 3FUHA 5I1JL 2Y3AA 4BJLA 3LKNB 4XP9H 3FYIB 1GIGL 3K2UH 2W91A 5IBLC 2AMGA 4P3DA 3BUBA 1JGIA 5IVXF 4HGKC 4XMUA 4XPAL 3ILQC 2M3GA 3AM8C 4YPJA 2AVGA 3DMMB 5BOPA 4XP4L 1XZ0B 1E2VA 5IJKA 5BO1H 3ZY7A 1AD9B 4U1NA 4ZFGL 3DI2B 2NY4B 5IQ7L 3RURA 3EBGA 1WFUA 4B0MB 4TRPH 4AENB 3KBPA 3OC5A 3X3CA 2MOQA 1YAIA 3H4FA 4BV1A 1FHGA 4WV1A 4Y4KD 2JH2A 3OVUB 4U1KA 1QBML 1IQDB 5DJ2A 4CSZA 5CKAA 3QEQB 4EF3A 3CXFA 4OZHA 5KVDH 1MNNA 1I1RA 4KI5C 2WXIA 3MACH 1Q72H 3OAWA 5EFIA 1MREH 3DHMA 1QHQA 4N2EA 3FU0A 4BFKA 5D2LA 2ZP9A 1OK8A 2BNQE 5AHZA 1EH9A 4OD1H 3RTQB 2ICEB 4HSCX 4DT2A 2D7TL 4JDZA 5DFVC 4LASH 2ZYRA 4LSVL 1NDGA 4YSSA 4PJBE 3BGMA 5B38G 2RIKA 3W5MA 5F9AC 4KO6A 4FXGB 4QJ4B 5HYJA 3I2CL 3NY9A 1QBLH 4MJIB 5TJWK 2AJZA 4YHZH 4YHLL 5H2LA 4JQ6A 1EPFA 2IIJA 3MBXL 4QRSB 5K59F 3K6OA 3ZHLA 2CMRH 4IEFA 3UAAA 1JGUH 3C6LB 5B6YA 4HLZH 1MIEL 2IPUK 4RA3A 4OI9A 4WAFA 2GTWA 4G7SB 4PN6A 4GO8A 1ND0B 2WJLA 2XYCA 3BXNA 4NKMA 3PDDA 3IJEA 5FPIA 4XXWC 3WAJA 2PETA 2X70A 1F58H 3AUWB 1HINH 4JDVA 3MQIA 1CFSA 4HIJA 3POHA 4XMZA 3KYMB 3T2NH 4GKSB 4DGUA 1NBVH 3HKFA 1TTRA 2BNRE 4IDJL 3V6FB 5C70A 1FORL 1DR9A 5F96H 3W9DA 3EXJA 4XCCL 5FHBL 1SJVA 3X3FH 3NYAA 3PHOB 3JZYA 1WT5C 3CZKA 5E0QA 1FGNH 1UD2A 2AJVL 1P84J 2PPEA 2XNAB 1ITBB 2I7SA 3MOAL 1P7QB 2KKQA 2FWOB 1QEWB 3QCUL 1U4EA 3SKOB 1XF4B 3O2VL 4NNXB 5ABAA 3UTPE 1CFBA 3FF7A 4FKHA 1U8IB 4WWPA 4XVUD 5L8JB 3MRRA 3LS4L 2VLJE 3MTRA 5L4JA 4JQIH 5B2NA 1VDGA 2CSPA 1CXLA 1NMBH 5J06A 2GJZA 3EDFA 4CBPA 1RY7B 1BF8A 5C6TL 4M4RA 3MUHL 1DQVA 2QKIB 3BDBA 3HBZA 4N2BA 4OLVH 3TF4A 1ZLSH 3LN9A 2AAAA 4QT5B 1UURA 3PNRB 2Z4QB 4PTUB 3VFOA 3AXHA 1T3FB 3IFLH 5FOBA 3QZNA 2ORBL 3PWLB 1YEGH 2B4CL 4H88H 4JFDB 5IBUG 1G9EA 3SDXB 1GYCA 3OKOA 4JPVL 2ZOKA 3GRBA 1PU0A 4KQ0A 1WICA 3PNWB 4HF5L 4ISVB 5T3XD 1P6AB 3VDCA 4F9LC 3RKDD 4AT6B 4OCNC 2P48B 3DA0A 3BAWA 1MEXL 1BVKA 2F5BH 1PNCA 5L6YH 4PJ5A 4TL3A 3NVQA 4S1DC 3TBSA 4PS3A 3WG7B 3TV8A 1IC0A 3RVUC 2J4WL 3VU1A 4TQIA 1SGKA 1A65A 5ITEA 3QEQE 3JWNE 3L16A 2XRAH 1JRHL 5INCB 4I18A 3T0ED 2ZUSA 5BXFA 4YSOA 1IC5L 2GK0A 2J8OA 1JYVA 5J1TC 2HA1A 1XH2A 3OGOE 4JO2L 1WAAE 4JQXA 5JORB 3V4VH 4JL1A 2FX8H 3CFBB 1FO0B 3RNKA 3FRPB 3L6FB 3T8VA 1MRDH 3GMQB 4KJWD 3D0VA 2F74A 3ZT6A 1SHWA 1UWFA 1A4KA 4KUCD 1TN0A 4CU7A 2ZWNA 2XWJA 4X6BA 1YYMH 2JAFA 1S7TB 2WLNA 2IGTA 1D6EA 3VE0A 2X4OB 3B9KA 1TMQA 5JZ7C 2ZPKH 4MJIE 5I71B 5L88H 4HSQA 3H9YA 3HVDA 1WE5A 1R24B 2EJ1A 1CFVL 1MFVA 4CILA 3W81A 4L3EB 5I6NA 2NNCA 2RTTA 4FTVD 3NEEA 4LRNL 4G3YH 1SDDB 4KC3B 3BZEA 3C5ZA 3KCWA 1JWUB 1UWEL 1YEHL 1HXMA 3B1UA 4WF7A 1UUNA 2YRZA 4KXBA 4UDUA 3L7FA 3WMPA 3ZK0A 5C07A 1P4BL 3N40P 4BV0A 4YNYA 2J8UF 2CO7B 3CQFA 4N2DA 2L7JA 2ISDA 5MENB 4RGND 4UT6H 2HH0L 3DUUB 5IJVA 1D5ZB 2VXQH 2YEZA 5FM8A 4JR9H 2YRBA 4YIQA 4XP1L 3KW7A 1DQLH 4X80L 5CUSL 1TSRA 4AKQA 2GEQA 3CBRA 3APMA 4GW5B 3CC5B 2D0HA 3N9GH 2Y06H 2OMTB 1SXNA 2CPUA 1JWMB 2OMVA 4BFGA 1H8SA 3ZL1A 3QJXA 4EVNA 4JVPA 1XR9A 2C3WA 5CJOH 5TDPA 1ZE3H 4ABWA 3IU3B 3M1BB 1CD1B 3HE7A 3VI3A 5L9DH 4GS7C 3Q6GH 3TA3B 3VH8A 1K4DA 3CVBA 3QIBB 5B1AB 2WV3A 3OXSA 5HYFA 2WIIA 4L2LA 1XTLA 1L0YA 2B1OA 2BIOA 1J0IA 1KTBA 4CJ1A 4J3TA 5D1ZC 4DEWA 2VXUL 3JQOB 3R1GL 3N0PB 2EABA 1LWRA 4L8BB 4YK4B 2HJLA 1QW9A 1Z1WA 4WSJA 1JYWA 1QASA 2DWXA 1ZTXE 4HGWB 2NSXA 2FSEB 3QUYD 4JFDE 4AL8H 3SDXE 3CWGA 1OARH 5TD4A 4WFHD 4PMEA 4XMLL 1JZIA 3OV6A 1L9SA 3QUZC 4U6VH 1DUZB 1HCZA 1NCBL 5FDWA 5HYQB 5KVGL 5JW5B 4ZUWA 3N85L 1RUML 1GZMA 3LN4B 1WBXB 3PXHA 4PY8J 2E7MA 1VEPA 5D7KD 4XNXL 2YD7A 1J0HA 5T1JA 3FRPG 2J88L 3QJHA 3UIZA 3PDSA 4H8QA 4JO1L 3HS0C 4LF3A 2VR6A 4XMPH 5T1MA 4KK9D 4KKNA 3UTSB 4Z5RA 2CALA 3WN6A 5HGGS 2PPFA 2Z31B 3ECBB 3MCKA 2Q10A 4L9LC 1JGLH 4LSQL 2DLEA 2UUDH 3CMGA 4LKXB 4WHYH 5GGSY 1JPSH 2FX9H 1KB5H 3VFPB 1UA3A 5EOCL 3UG3A 5FUZL 3WS6C 1HZKA 4ZAKD 2QEJA 3QG7H 2OKMA 2E46A 5BOJA 4EA3A 3RX7A 2FX7H 3HC4L 3RIFK 4PJXF 1OGAA 2Z91B 4FA6A 4ZBJA 1LN6A 4JY5H 1QNZH 4L3EE 3GSXB 1E67A 5D5MA 2R69H 1ZS8A 4BQ6A 1QFUL 1KTCA 4KAQH 3SYAA 1D5XA 4HG4J 1MHHA 1EAPB 4GP4B 1SMAA 5CJQH 2FEEI 5KANG 4F93B 3OR7A 4QCIA 1SVBA 1CYWA 4QAWA 4R7DA 4J2QA 2QGDA 1T21B 4ZFFB 3GXFA 5HPOA 3KAAA 4L4VA 5DVNA 3QXDB 2IOMA 4M7ZC 4IAQA 3HE6A 4R4FH 4AEIH 5CR1A 5MENE 3WTWA 4PJ5D 5C97A 4AYBA 3UPRB 1YECL 3CFCL 4HYJA 4H13C 2WCSA 3WY3A 4DAGH 4K7PL 5EU7C 2RFXA 1I9IL 1V7NH 5GGTH 1T04A 5I18H 3B8SA 2AEOA 1RUQL 4L35A 1A0QH 4C4KO 5HY9B 1C5CH 4PGDB 2WYTA 1I85C 4NKQB 5AYQA 3OKKA 3FQRA 3PGFL 5EO9B 1EXUA 4WKXA 2AEPL 1RFDH 4FRWA 3HI1B 4XBEH 1RK7A 5EO1A 3BH8A 1CLVA 3O3DA 4PJEF 1M71A 2YD4A 1JGJA 1E65A 2CJTA 4JO3L 2JI3A 4JKWA 4G6JH 4YMPA 2NYZA 2R7EB 3DHPA 1RZFL 4K94H 1IGCH 5AVTB 3SOBH 3REVB 4LVEA 4B9IA 5IVZA 3N41B 4UM9A 5KN5A 4PP2B 3QRGH 4M3KB 4FNUA 5LBSH 3P9MA 2LW3A 2WPGA 3GSNA 2NYYC 4F9PA 1IQWH 2GIXA 4TQEH 2Y69B 5BRZE 3QWRD 4P46B 4BFFA 2PPCA 2OXGB 2PABA 4PJFF 3QA3A 1WP6A 5C09B 4Q9RH 3C5ZD 2JTYA 4HKZB 4PJGA 4BK5C 1ZLVH 3D85A 5B6XA 5DFWH 2BOLA 3A4DA 4PJIE 1M2OA 1NAMH 2ZXAA 1Y7VA 3KWWB 4KNFA 1S8DA 4J3SA 5F7DB 1UZ8B 1MFEH 3HUJA 3NCWA 4FXTA 4QWWC 4UAOB 4YHOH 5IHLB 5LWYL 1IBGL 4EN3D 3BEVB 3ZKQD 5HJ3B 1T1ZB 1B0RB 1MHCB 2GJ6D 3V2AR 2OCJA 3BWAA 3HPLB 3HVNA 1U8OA 1XGTA 2H6PB 2Z7ZA 2WSDA 4R3SA 1MDTA 4G6MH 3SOTA 1SXZA 3R06A 3P4OA 1X5IA 2CO3A 4HPYL 3FJTA 5DJXA 4X6CE 3DGGB 1G6RA 2XN9B 4X0NA 1AIFA 1INQB 4TLKA 4UT7H 1CZ8H 5C1MB 3RVXD 4Y5VA 5FX3A 4ACPA 1NL0L 5IW6A 1RJLA 2IPKB 5CEZD 1LEIB 3BT2H 5CZVL 1CXFA 2A83B 1MFCL 1VZGA 4WCYL 1U8QA 4Y4FC 1HSBA 4W9IC 3GIZL 4BK8A 2K45A 5I0ZA 1MHPH 5E1AA 2Y0SA 4WW2F 4ZNEE 2BJMH 4HIXL 4JFEB 1AIZA 2ZUWA 4WLCA 2WVUA 3BPLC 4JHZA 3QJVB 4K9EH 4TUKH 4GO9A 3FONB 4ODXB 4P5TA 1JGVH 1X5MA 4XNZC 1LEGB 4RNRB 2LOEA 2Q3XA 5K9OB 2YCWA 3DETC 3MLSL 4UYQA 1TJXA 1EAJA 5CN2A 3EO1B 2JJSC 1FNAA 25C8H 1D5BA 3D87B 3T0XA 4P8QA 2C1PB 4LK4A 4ODHH 1W72H 2Q0ZX 3PWNA 3SE3A 5TF1H 5DHGA 1D9KD 1XGRB 1IKOP 2Y1YA 3QDJD 4FMFA 3SGEH 1UM4L 3QQNA 4ZW6A 3WIFA 3WLWC 3ARVA 2JAGA 4LVNC 5IB4B 1I3RB 1CBVL 3MRHA 5AX0A 3O9WC 1M56B 4ODSH 1R1CA 3K5RA 3O41A 3UIYA 4NCC2 4RA0C 1XX9C 1CF8H 1KTKE 2ZOWA 1JK9B 4WW2C 3M8OL 3UJTH 4DKTA 3ISYA 5C6WH 1KG0B 2C7UA 3B7SA 4MNGA 4MNHA 3NSJA 4R4NC 2RQEA 2BOBA 4Z3GA 4ZSOB 2HPOA 4N2KA 3WN5A 1GCFA 3HI6L 3LRKA 3FB5B 4DGIH 1I7UB 4O2FB 1MKFA 1F2QA 4Z7QF 5KZCB 4KXZH 4N0YL 4L1LA 3OC8A 3SO3C 5C0AB 5JDSB 3VNYA 1A6VH 5C09E 2JKXA 2IOOA 3GZPA 3OM3B 3GI9L 1JZ6A 1CFQA 4X5XA 3UH8A 4GMTL 4HOWA 1WHOA 2WLIA 2F9BT 2VH5L 4FYTA 1HQ4B 3ZL2A 4KRPB 4KBPA 3IT8D 1SQ2N 4GUPB 2DW5A 2ZSVA 5F7HA 2UWEF 2W0KA 3JUZA 3O6KL 4L4VD 2CJUL 3CX2A 3IDIB 4ZOAA 5FCUH 4OAWB 4N24A 5C71A 2Y00A 2MQ0A 4G9FB 5I6LA 2A9BA 4BH8B 5I9QB 2L7UA 4NRYA 4OZFA 4DFIA 3FCSB 3BIKA 2AKRB 5FYLD 4JMNA 1QNIA 2NR6C 5HI4D 4XCFL 4GRWH 4I3SL 2XXGA 5HDQL 5I66B 2Q3AA 2VZUA 4GYBA 4HYXA 1C9SA 4JG9A 5C7ZA 1JZFA 4QRAA 5E6IC 2OMUA 2BVQA 3QQDB 4FQLL 4JHAL 3RPKA 3C12A 3NH7H 4O02A 4RRPA 4MCYB 5GIRB 4WFGE 1A2YB 1ZLWK 2XN9E 3HAQA 1PY9A 3ZGHA 1QI4A 4Y19B 2EVIA 1T1WB 4NNYA 4DKEL 2KLRA 3C9MA 2WO4A 3P0VH 3ZKMD 1TETL 1A3RL 4DW2L 1MQKH 1BCIA 2ZXWB 3CDYA 3CGTA 1IEBB 1PBYA 2H8PA 5F6HJ 2QSCL 2MKWA 3UYPA 3WNNA 1UA6L 2NOYA 3TONA 3MJGX 4JFEE 5JYMA 4IJTA 1U6AL 3ESNA 4KNQA 2EDQA 2ZUXA 3MLXL 4YDVA 3BQUC 1Q0YL 4G8FB 5IB2A 3OAYH 3I6LD 4RDBA 2YBRB 1JVOA 3BKMH 3MRMA 4JM0A 2EO1A 1HEJC 4Y5YB 3AY2A 5AAMA 1I8IA 1UWGL 1JP5A 1RJCA 5DURD 1G1KA 3D85D 5T33L 2YAQA 5EC1A 4B9FA 2TRYA 1C7TA 1AGEB 1G7PB 4RCAA 4JKVA 1U8HA 4FQHB 4QHPA 5A2IH 3AM6A 5JXAH 2RJMA 4NCC1 5KYWA 3QIUB 3I75B 1SLWA 3TH3T 2EEAA 15C8L 3G5VB 4LLDA 2R8SL 4HCRH 4WVRA 5ALCH 2A77H 2BP5M 5D7LB 3UP6A 2WP3T 3HNVH 3CZFA 4O2EA 3ZT5A 2BY2A 1GGIH 1AQKH 1F4XH 1XCTA 3GHPA 2P47B 4YHMH 3UBXI 3QAQA 2HKAA 4NXSA 1QHOA 2R29A 4XXDB 5L4IA 4EMZA 4NLHA 5T1LB 2NSMA 1A1MB 2X3CA 3UO1H 4K71B 3W1ZA 2YMOA 1IV8A 1XGPA 3DUSA 5T3ZD 1KGCE 3D25A 1SMDA 3GLDA 5AVZB 3CVHH 4QRPA 2XWRA 3QUHA 1GR7A 4ZDHB 4UUJB 3D7PA 4AWJC 3W2DL 4F37F 2Z65C 3KNBB 1SXCA 3FOMB 1UUSA 5JIQA 1ZXKA 2HLAB 2A4CA 4CNIB 1EHLL 5FM4A 1Z9PA 3JWDC 3MV9E 4NPYB 1OOAA 4M9OA 1Y1DA 4ZSOE 5TH2B 4EEEA 3AROA 2VDNH 4E41D 2Y25A 3NIGE 4LGPB 4MA3B 4PRAA 3WDHA 2R2EA 4Z77B 4QD2E 4OJDH 4NWTH 4K9JA 3HARA 4AXWA 5ITCA 2VDRB 2G3MA 3MNZA 4OCYH 4H8WL 1MJ8H 4LCCC 4P5TD 5CHNB 3VD0A 1S53A 2ARJA 4IBTA 3B2UD 3CTTA 1N64H 5DUBB 5BZXA 1U8JA 4J23A 1DYZA 2A9ML 5BOZG 2HJKA 3BKYL 1IB5A 3EJYC 2R1XA 3KDMA 3DVNB 3ZPRA 1PLCA 2G5BA 4WTQA 3EFFA 3IBEA 4G9FE 1S7RB 4WFEE 1KN4L 2UVFA 4RFEB 4Z8FH 4ONOA 2DQ6A 2CLRB 1ACCA 1NFDB 3F65A 3KLAA 2XQBL 4MA1B 4RFNC 2BW4A 2QBWA 3GRGA 4N1CA 5BQDA 1HIML 4Q7DA 3TBCA 4E9XA 5ILTH 5EU4B 4RAVA 1LE5A 2C5DC 1A21A 1MLBB 1ERNA 3DV6A 1X5YA 4P2OD 1GGCL 1PX4A 2A5UA 2CE6A 1OWRM 1WYJA 4DSYA 2XY2A 4RZKA 3TOPA 2VOTA 2R29L 4Y19E 4OIBA 2ZX7A 5C2BH 1Z5YD 1IGJA 3LKPA 1CN4A 4IM8A 4IOFD 3GMRA 5AL0A 3K71B 3F7LA 2CHWA 4JDTL 4X5WA 2A0LC 4LDEA 4BINA 4BSJA 1URLA 3RVTD 5ADPH 4OGXH 5C0BD 5HHQB 1IW6A 5IB1A 4F33B 4PBXA 3F6LA 2BP8B 2WKLA 1OKEA 4NKDA 4W6WB 5DLML 1J7VR 3CU1A 4YHNA 5I0DA 4TQ8A 1J5DA 4ELMB 1G4RA 1FCGA 2IADB 4XI5D 4IS6A 4BH7B 2K70A 1T6BX 2APFA 1MHEB 1M05B 2VLRA 1MVUA 3KXFA 3NIFF 3T45A 4AJWA 5HHPB 1QO3B 4F7KA 3NSCA 3QULB 4DKLA 4BGDA 3NTCL 4IRSC 3KYOA 4QRUB 4PJCB 5D7JC 4U1JB 4ZMYA 3ISRA 3QO1B 1QSZA 2ADFH 1OY3B 2DLIA 2CIIB 4QUOA 1Q0XL 2W0FB 3B2PA 4TNVF 5FYKE 5D7LE 2EEBA 1KLGB 4NHUB 2EAEA 5KSAA 2CK0H 3DVIA 1UD6A 3T71A 3U1SL 5CLYA 5EUKB 1AQ8A 1KJ2H 4YL9A 3VGAA 4L0PB 2IGLA 3FUJA 4J4PD 4NFBA 4X2UA 3WJMA 5KSBB 5G5DA 4GPVA 1VERA 4I0PA 3OMAB 5BV7B 2Y7LA 4P9MH 4X7EC 5J1AB 3QQ3A 5L4MA 4FLOA 5GRVK 2LLLA 3QUKB 1QSFA 4GRVA 1B0GB 1RURH 2V7HA 3JZ7A 1T7VA 4NO5B 1JUFA 1ML0A 4RDQF 2GSGB 5LDUA 3LCYA 4MCZA 4GIOA 3ZDZB 1A6ZB 4FQPA 4PJDF 4D9LL 3V8OA 2VB5A 3EO0B 1MFUA 4AH2A 3WO4B 5L2JA 3B3IA 2B0SL 4XE0A 3C60C 3GSQB 4AIZA 1F3JB 4WU5B 4LPTA 1G0YR 5BS0B 1Q9OB 2IGFH 3FULA 2HTLD 4ESKA 3FU9A 5L4FA 1MJUH 1OPGH 4HKBA 4PV9A 2EDTA 3CFIC 3WMSA 1MJJB 4OLUH 1YEFH 2UY7B 3RDJA 5DC9B 1FZKB 2E59A 3T0WA 3KE0A 1X0K1 1N67A 2AK4D 1SYVB 1N0LB 1FFNA 1XVSA 2XIIA 3IJ7A 5JO5B 2LFEA 5INDA 2ZX8A 4K8RL 4MD5B 3UG4A 5B4MD 4HJEA 2DD8L 4RVBA 4IIQA 3HN5A 2FATL 4GSXA 5IHZA 3IM1A 3FB7A 3W38A 2XDHA 1JNLH 3NG5A 2XVBA 2AV7B 2B15A 4QXUH 2G3NA 4PRID 4P48A 2Y03A 3ZR5A 3UTXA 2V4LA 4FHBD 5DDHA 3KPPA 3LH9A 4LLQB 5J5EA 3SDAC 1RUKH 4BM7A 1KBBA 1E9OA 4JB9H 4XH2B 3OR6A 1AE6H 3QARA 5E24E 4NM8H 1MFBL 2RA1A 3ZTJH 3VM7A 1KPUA 4XP9L 3MJ9H 5MHSD 4Z7VA 5KYUB 4QOKB 3BFQG 3K2UL 3PHQA 3WV0A 4B6ZA 4OUOA 3FQYA 5JIKA 2B9BA 2AEIT 2GB2A 5AWNH 1VADB 3EHBC 5BO1L 2H1PH 2BP0A 1VPOH 4C8XA 1RU9L 2GSIA 2DQTH 2Q3ZA 1ZLEA 3H1ZA 3OKEA 5DJAA 1QLRB 1JHLH 4XWOC 4BKLB 3E8VA 4ELME 2FBRA 4MS8C 4WEBH 1O7VA 4TRPL 1DP0A 4X4YA 2BZ7A 1RZ8A 2NCMA 3ML8A 4LRIA 5A16A 3G6JF 1CG9A 1IAIL 3FBKA 4NBZB 5LJYH 5HI5C 3JVGC 1XF2A 2F15A 5DLLA 3N6YA 4PJCE 3L9EA 1O7DC 2VDQH 5HGDB 5C9KA 3W57A 5CU5A 3Q2VA 2LHAA 3MACL 5DVMA 1Q72L 2W81C 4ZPVA 5FKAB 5D6CA 5GS1C 4AYSA 1MREL 1TKWB 1X6NA 3BN3B 3TNNA 3SKMB 1WBZA 3SIKA 2J43A 4KQ3L 3GSVB 5ENWB 4KNUA 5IFHH 2L7EA 3RL2A 3Q8EA 4L8CA 4H20H 4EI0A 2FO4B 4OD1L 2PYFB 4BZ1H 1EAQA 1M2VB 4QHMB 1TJGH 1MCDA 3I9AA 4LASL 4WO4B 5KSBE 3F7VA 4FFTA 1WA0X 1Z2KA 4AYGA 3EBAA 4Y88A 3ARFA 5HGAA 1JK8B 2PXYB 4OLXH 5CJXC 5F3BB 2EUZA 5ACZA 2ED7A 2V2XA 2FZ3B 4P23A 1QBLL 1CI3M 1FC1A 1LO3L 1QVOA 5E4EB 1J5IA 4YDJA 4YHZL 2NXYB 2YN3A 1COBA 1IT9H 1F8TH 5K39A 3ZDZE 4BEZA 5J11C 3PL6B 3CHSA 3L95B 4LL4A 1LD9B 5I5JA 2WCGA 4PRHD 2COQA 3L3OA 1PD1A 1FL6B 2OTPA 2SEBB 4WWKB 3VI4F 2X9ZA 4KJPC 4BYHA 4CKQA 5BS0E 5DMYA 4TULH 1OE2A 1F58L 1PZUB 1HINL 2Y7NA 4YUEH 5H8DA 3MRFA 1QRNB 1AZNA 3RI5F 3T2NL 3FZUD 1NBVL 1JAEA 1F4AA 2WYHA 3U2SA 2VLRD 4HEMA 4ATTA 3GRWH 3OKNB 1XH3B 5CEXA 6CGTA 3X3FL 5DQDH 5F7BA 1WUZA 5DEGB 3S5LG 3CFMA 3IAQA 1A6AB 1KNOB 2AJUH 2H32B 3QDHA 3WGVB 4UMGA 1UHVA 2K6ZA 4PJ7F 1VEOA 3UZVB 5EZJA 1G7JA 2CUHA 4ABUA 5KVFE 3QPXL 4QNPF 2Y72A 4AQ1A 5SX5K 3PGCA 4U05A 3IDNB 1R3JB 2GTZB 5DMJB 5I1HH 2IH1B 5B3JE 4IMLA 3K0WA 4GAJH 3AYMA 5EWIH 5DR5H 4HOMA 2YO3A 4HETA 5DHYA 4JQIL 1TIUA 3OMNB 3UTZA 4DZ8B 1WCBB 3TBWB 4BQ8A 4YAQA 5ID0A 4OGAC 4HPOH 3ZRFC 3P1VA 1DVXA 4MQ7A 4PR5B 2JJTC 2GBUA 3B9AA 1XQ4A 2XTLA 4OLVL 1ZLSL 1Q9WA 5CLTA 4G8EA 2KLSA 5E8PA 4MD0B 4OIFA 4QOKE 4UQDA 2BIMA 1YMHB 1OB0A 4NIKB 3QNXB 3BRGC 4J3OD 1B90A 2V2TB 3KG5A 3IFLL 2XTJE 2FLMA 4F7PB 1YEGL 5EBWA 1ZLUH 3RILA 1E27B 3EO9H 3NJIA 4KOBA 1NUNB 4LSTH 3NJJA 3SDDB 2OTUA 4GW1B 3IETB 4HUVB 1XGYL 3IXTB 4NO0A 2A2QT 4GI6A 5F72S 4MAYB 1KYOK 2YEVB 4JFQB 5A6MA 3VFTB 4LSUH 4M5YH 3SE9H 3D18B 2F5BL 3QDGD 1HKLH 4CA4A 3FCTB 5L6YL 3WE1A 2FD6H 1LNUA 5EC2A 1PX3A 2V7NA 1BFOA 3MV8D 4R4BB 1ES0B 4UV7H 2HPTA 4FNLH 4K4KA 2OV0A 3U4BH 1WV7T 4QRTA 1BA9A 2PWGA 3R7RA 3WBDA 1FQ9C 3VGGA 4KJYB 3DIFB 4LCUA 4OF8A 3WY1A 2DWYA 4B5ZA 5IREA 4PJBF 1N59B 4F92B 3RLSA 3U1QA 4N3UA 2ZOLA 5AVQB 1J05B 2DWEA 2KLTA 3AXLA 1XGQA 2FX8L 3H9SD 3T4AB 4P07A 2X2HA 3MZGB 3VRJB 2QGEA 1MRDL 4KVNL 5EIIG 4YBLB 5DHVA 1DL7H 3LB6D 1CO1A 1HS6A 5FAAA 4WK4B 2V6HA 1YYML 5CZXD 5DJYA 5E8DL 1Q9LB 2MNJB 4FADA 2YQ2A 1SNRA 3HZYA 2WUCH 3LH2H 3QZOA 5L88L 3L8QA 2ESVA 4R97C 3AY4A 1OAXH 3HRZB 2FK9A 4A7GA 2NY5H 1LO4H 4PW4A 3D69A 2YA1A 3MLUH 4G3YL 4DQOH 3NEXA 5ESVB 3O6FA 3KCPA 2X0UA 5C0EA 1T5WA 4G7QB 1WFJA 3B7RL 5F3HB 4P57A 4ZFOB 1EFXB 1XSKA 1DJHA 2XA8L 3X1NA 5CNHA 4HX1A 3FHEA 3JWNH 1N3NA 4A37A 3LKQA 1VZIA 3FT0A 1E8XA 2NT1A 4KZCA 5CEYB 1JMZA 3HG1B 1A7QL 1OGTB 4ZX4A 1AQDA 3BEWA 4ZMTA 1T0NB 1BJ1J 3BSHA 1KCLA 1I7RB 1KJMB 4GKZB 4UT6L 3QIWD 4JM2A 4JREB 4JR9L 4S2SA 4DJHA 1DQLL 2D7OA 2ICCA 1DQQB 2WBJA 1FFOA 1RZKH 2YRLA 5EB9A 4F7MA 4HJTA 3SZ6A 1ED3A 1UJ3A 3N9GL 4RAUB 3RIAK 3WIAA 2A74C 5DEZA 3QZLA 3K6SA 35C8H 2H5UA 1ETZA 5CJOL 5E1HB 4YGAB 5L9DL 2XA3A 3CFKB 4TNFA 2A9CA 1RZIA 3Q6GL 2XG5B 3OKDA 1FA4A 3QUXB 3KLDA 4FQXD 1KPVB 4GW4A 1DFBL 4ZOBA 3RWEB 4Y16A 3J7HA 4FI6A 1TTBA 3RGHA 3GDCA 4EKJA 3BE1H 1UENA 3ZTNH 1F3RB 1F42A