1XMEB

Structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel cryoprotection scheme for enhancing the diffraction of crystals of recombinant cytochrome ba3 oxidase from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 1xmeB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1xmeB02
3IEAA 3UACA 4IARA 4EA3A 1ILUA 1KBVA 1IKOP 3AG2B 4E9TA 3QBKA 2H3XC 5E9NA 4AKPA 4FPDA 2J57A 4Y9HA 4TL3A 1SF3A 1X0K1 4XTLA 1R1CA 1BXUA 2PPCA 2QT6A 3NJMA 5F7AA 4FBZA 3SBRA 3VG9A 5ITCA 1GSKA 1SDDB 1XB6A 3S8GB 3TA4D 3V2WA 3NJJA 5JJNA 3JTBA 1AS7A 2BP0B 4XXJA 2VW4A 1JOIA 3FQ2A 1A65A 3L45A 4HCGA 1XMEB 1FBBA 1ETJA 1KBWA 2FNWA 2I85A 3FSAA 1AR1B 4XTNA 2BP8A 2R4RA 3C9MA 2LLNA 3ERXA 5AX0A 1NIFA 2YAPA 1NWOA 2Y69B 2BP8B 1S8LA 2BW4A 2XYBA 1NDTA 2JKWA 3ABMB 1E5YA 1CC3A 4WAVA 2QPEB 4KO9A 3OE0A 5JJEA 1IBZA 3WKPA 3QJRB 2XUWA 5BR5A 2FT7A 2DWTA 3AG1B 3ZPQA 3SQRA 3FYEB 1IXFA 4G7QB 2ZONA 4E9XA 2HLEB 3UABA 3T6ZA 2I7OA 4E9SA 1T5KA 5B34A 4HYXA 5AKRA 4X32A 2A3TA 2JXMA 3CG8A 2YCZA 4AKQA 5H2LA 1M9WA 4YSEA 5ITEA 5B1JC 1P8IA 4DKLA 3DQBA 1QKPA 3NSCA 3ODUA 5B6YA 5EHFA 3DKHA 1J5CA 3UTYA 3G5WA 5AZUA 2BWIA 1AZRA 1AP9A 3KW7A 2IWKA 1EHKB 2CCWA 5FC9A 2W88A 9PCYA 5DYSA 2I20A 4X31A 5F8UA 1AANA 4WW3A 4LDOA 2Y1AA 3AYMA 3OD3A 3V9EA 2UX7A 1SHWA 1TEFA 1FWXA 2Y00A 5H2OA 2GSMB 4KLYA 4HZ1A 1AAJA 3ABLB 2RACA 2YCXA 4L35A 1L9QA 1RZQA 4YSQA 1JZGA 4ENZA 3CODA 3FSZA 2WJKA 2Y01A 4KO5A 2BRDA 1UATA 5EN0A 1PLAA 3N55A 1QHJA 3IE9A 4GYBA 2PPFA 2AVFA 1LN6A 1RKRA 4DP2X 3UZCA 1IUZA 1KYAA 1GY2A 2IAAC 2MRYA 2Q5BA 3T6XA 3PDSA 3GYRA 1L9HA 3D12B 4YSRA 3ZX1A 5PAZA 2KSBA 4MFHA 2X88A 3HAOA 1DYZA 1L9SA 3HAPA 5B3SB 4YSPA 1BXAA 5B1KA 1ET8A 3EH5B 3NJIA 3ZDWA 2Y03A 2AANA 3DIVA 4M3HA 1S54A 3UTXA 1GS8A 4KOBA 1TN0A 3FSWA 3SN6R 1QKOA 4X4KA 1PZCA 3OM3B 1ZV2A 5H2HA 3C75A 3CAPA 4DPCX 1SFHA 1SDDA 2B3IA 2LNLA 3X3BA 1ID2A 1V55B 2CJ3A 3OMAB 4DP1X 2BHFA 3ZPRA 2ZXWB 3S3CB 1L9RA 3MX0B 1XJIA 4GRVA 3ZBMA 5B1BB 3T45A 2YXWA 1PNDA 2AZAA 3NJHA 3AM6A 4DP0X 3KJ6A 4DP9X 3TBBA 1NIDA 1F4ZA 2QDWA 4DPBX 1O0AA 5TK4A 3OE9A 5H2JA 1AG0A 2EILB 2FQFA 2YXVA 4F2EA 3V9CA 2NTUA 2IDUA 1JVOA 1ADWA 1P8HA 1JV6A 2DYRB 7PAZA 2GC7C 2JAFA 2Z55A 1QHQA 2YAEA 1JZJA 2XX0A 4JR8A 1X9UA 1BYPA 4E9WA 1PY6A 4NC3A 4AMJA 5KKHA 1PF3A 1W6LA 3NT0A 1UAZA 4IB4A 1JZEA 1AZUA 5H2MA 4AMIA 4UF7C 1P8UA 4YL4A 1GUEA 4DP7X 3UTVA 1A4AA 2BP0A 3PBLA 3RZEA 1OE3A 2KSYA 1M56B 3QJTB 1OCRB 2H5UA 3FQ1A 4GYCA 3NYKA 4K9JA 2PP9A 1DZ0A 1NPJA 1W6WA 1MGYA 1KMEA 2IH9A 3T6WA 3CVDA 2AFNA 1AG6A 1NICA 5AX1A 4A2EA 2YAMA 4HHWA 1IW9A 3WQJA 1N68A 1ASPA 3UADA 1OV8A 2YAQA 1AZBA 3T9WA 3FU7A 5C1MA 2YAHA 6PAZA 5I26A 1ASQA 2IH8A 4YVUA 4HWLA 1KG9A 3PXOA 3QQXA 4MBSA 4AKOA 2AZUA 1EZLA 4BWBA 4E9RA 4EF3A 1ZPUA 2UXTA 5I6LA 2HX9A 3VHZA 1U19A 4A2DA 2YCYA 4DAJA 4CSZA 2F93A 4X1HA 4DP4X 4QI1A 2OV0A 3UAEA 3EH4B 2IDFA 1BRXA 2GI0A 2XXGA 2VW6A 2GC4C 3JT2A 4KOCA 4YSTA 5B1JA 2GB2A 1F88A 1AOZA 4BDVB 2NRDA 3QDCA 1OE1A 2EIKB 2B08A 1R2NA 1BQ5A 2X87A 5B7MA 1WA0X 2XWZA 1L0MA 3MBVA 3NYAA 1X9RA 3AY2A 3NSFA 4KNSA 4BDVA 4DP8X 1AZNA 1PAZA 2IWFA 5I6PA 4L6RA 1PLBA 1C8SA 3AYNA 1XB3A 4W1TA 4F2FA 3PAUA 3MBWB 1UCQA 2JAGA 1GU8A 2F95A 3QJVB 1VLXA 4G7SB 2R4SA 4PCYA 2J4YA 4QLWA 4JQ6A 2ZFEA 4XT1A 3X3CA 3OE6A 3CVCA 3NJLA 3FT0A 2M3GA 2HRHA 1CUOA 1PCSA 1H2SA 2FJSA 5I5IA 3P0GA 3ZIYA 2HZHA 1SNRA 1TEGA 5B6VA 2QDVA 3KW8A 3NP4A 4TXVB 1J9SA 1A4CA 1JVLA 2FTAA 1KDJA 3PWHA 1JZFA 1J9RA 3CDZB 5H2NA 5JJJA 2WSDA 2DYSB 1X0SA 2WO3B 4NB7A 4YVNA 2VN3A 3OQRA 1JFPA 4CSPA 1M0KA 4FA7B 5FJGA 5IY5B 4G7RB 2CALA 2E86A 4GP5B 3WG7B 1OCCB 5H2IA 2ZZLA 1V54B 1CURA 1E5ZA 1JXGA 3ABGA 4XTOA 3HB3B 1GY1A 4WKXA 5PCYA 2HPYA 4YSCA 1VGOA 1WS8A 3WKQA 2DY2A 1GYCA 1OCZB 1ZIAA 5A45A 4UAHA 1JZHA 4G72B 3HANA 5G2DA 5ANHA 4GY4A 1Q5IA 2H47C 5I28A 4M4RB 3UZAA 5G28A 4BXVA 3S3DB 2R7EA 1JV7A 3NSYA 4HAKA 1PZAA 3RYMA 5I6MA 3CZUB 1BRDA 3EF4A 5G2AA 1XB8A 3WNJA 4YSSA 3EMLA 3ASOB 2MTAA 1M57B 1NIAA 2BZCA 1OF0A 3RFMA 4HYJA 4BWTA 4LDLA 1IC0A 2PPEA 3X1EA 5A44A 2UX6A 4UANA 3DDLA 4DJHA 4Q89A 1PXSA 4DPAX 1QNIA 2N0MA 2YDVA 3OE8A 3VW7A 4DP5X 1BEXA 1JXFA 1BQKA 1FBKA 4XT3A 1GR7A 4KO7A 1ZDQA 5LWEA 3IN2A 4HHGA 5I5MA 2XU9A 3N2JA 1Q5JA 2IDSA 3AG4B 5I6KA 1HFUA 1KGBA 2YQBA 2UXFA 1WAEA 4EJ4A 4GBRA 4HIPA 3X1BA 4MD1A 4IAQA 3SBPA 4JHVA 1ILSA 1WS7A 2W8CA 3CDZA 3VGAA 4HCFA 4EIYA 8PAZA 3QPKA 3IN0A 4L0PB 4AI7A 4BXSV 2UXGA 4KNTA 1OE2A 2HX8A 2FQGA 3UG9A 1GS7A 1AT9A 5G36A 1A4BA 3NS0A 1L9PA 2IWEA 3HEIB 1V10A 3SBQA 3UGEA 1FA4A 4W9ZA 2ZOOA 1F56A 5TGZA 1PMYA 1E12A 2I35A 1SF5A 3A7KA 2PCFA 3OMNB 5H2KA 2PPAA 5G54A 2R7EB 1PY0A 1RCYA 1X0I1 3FPXA 1IW6A 1A3ZA 2AT9A 1PNCA 2J5WA 5AWZA 3PAZA 2CBPA 2KS9A 1AZCA 3PXLA 1S51A 5BR2A 3QBLA 2QPDB 1WA1X 1QM8A 4GP4B 1MDAA 2YAFA 3FU8A 2BWDA 4BVNA 1TN5A 4A66A 2I1XA 2J56A 3WNIA 3PAVA 3GDCA 3QJQB 4QIDA 2PEDA 2HXAA 3NJGA 2TSBA 3C9LA 1IBYA 1MG2C 2PP8A 2FT6A 3H56A 1H68A 2EIJB 4A2FA 4N4WA 1MZYA 4BK5C 4HCIA 4GPOA 1M0LA 3FQYA 2YDOA 2GBAA 4ZK8A 4E9VA 5TK2A 4MQSA 2XV2A 4QKTA 4BEZA 4GP8B 5B2NA 2X72A 5I6OA 1BXVA 3UONA 5DHHA 1JGJA 1BM1A 5B6XA 1CYWA 1I53A 2VSMB 2YCWA 1J5DA 1S53A 1MZZA 2FWLB 2DWSA 3NJKA 4N8UA 2I21A 5A7EA 4OV0A 1YLBB 3TBCA 2BW5A 3WI9A 3QJSB 1S52A 4BWUA 3GXUB 4BV0A 4E9YA 3U25A 3ABWA 4QRYA 2PCYA 3REYA 1DZEA 1C8RA 1KDIA 2I7SA 2TSAA 3FYIB 2P80A 3UAAA 1N70A 3AZUA 3X1NA 3X1FA 1AACA 1AS6A 3NJNA 2VM4A 2YARA 7PCYA 3EH3B 4A4MA 4A2HA 4YSUA 1RZPA 2OCCB 1ET7A 4BEYA 4MQTA 1GS6X 3TASA 1WA2X 5B7EA 4DP6X 5B7FA 1A8ZA 2DV6A 1NWPA 2EINB 5AHYA 4K5YA 2GHZA 1CWQA 2VW7A 4P5SA 4FAAB 3PCYA 3S8FB 2Z73A 4UG2A 4GXFA 4N4YB 4E9QA 1AQ8A 1BAWA 5B6WA 1SJMA 1CYXA 1KCWA 4JHUA 1S8JA 3AW5A 2J55A 1TU2A 4NERA 1J9TA 3FU7B 3NY9A 5D4HA 1M0MA 2PP7A 2XLLA 2HRGA 1E65A 1E30A 1W8EA 5AHZA 3PPSA 4RH4A 2UXVA 2L6XA 3FPYA 3X1GA 1KGYE 4LDEA 1VJMA 2FT8A 4HALA 4F7KA 4PXKA 3S3BB 1B3IA 2RH1A 5B1AB 3QJUB 4N6HA 1L9OA 5I5JA 3IBOA 3HASA 4MD2A 2CAKA 4A2GA 2VT4A 5B0WA 5DHGA 3DTUB 5F7BA 4YSOA 1KG8A 5J7AA 1F50A 2NTWA 3BVDB 2EIMB 2G87A 4NAJA 4AX3A 4J4QA 2XVBA 2HX7A 4YSAA 2IDQA 5B35A 2Y02A 3NY8A 4Q8BA 3HARA 2P80D 2WO2B 3ZEVA 2Q9OA 4KNUA 1QLEB 2ZIYA 1NIBA 1E67A 2FQEA 5G53A 1AIZA 2FQDA 4G71B 2IDTA 3EHBB 3NJFA 1HZXA 1R84A 1HAWA 3CVBA 1PXRA 1PLCA 5H2PA 5B6ZA 3D4SA 4JKVA 3VVKA 2WJLA 3ASNB 4PAZA 1C3WA 1BYOA 1GW0A 3QBIA 1OOWA 2VSKB 3H4FA 1L9TA 2CUAA 1KV7A 3H4HA 3T71A 5G2CA 3FU9A 4P5RA 1SFDA 2XX1A 1KCBA 3ABKB 2ZWNA 3OMIB 1TKWA 3PLYA 1PZBA 3WIAA 3X2QB 2Y04A 5A8EA 1NPNA 5ETZA 4KO6A 1FFTB 4WTQA 3VI0A 3NSDA 2BZ7A 1E0PA 2KSAA 1JERA 2VM3A 4JKNA 3HAQA 1JXDA 1URIA 2XV3A 2PLTA 6PCYA 1NINA 5I6NA 1J9QA 1JZIA 4AZUA 4YSDA 1MG3C 4A67A 1OCOB 3QAKA 1BQRA 4KNFA 1ET5A 3UTWA 3PQRA 2YAOA 3TU6A 1AS8A 2XXFA 2EI4A 2JFCA 3AG3B 2VMJA 1ZIBA 1SHXA 1HAUA 3QAPA 3NSBA 4PXFA 5D4IA 1NTDA 4A68A 1GZMA 3BQVA 1ZDSA 5D4JA 2BO0A 3NP3A 5LDUA 1BRRA 3OAXA 4G70B 5AZDA 1NZRA 3FSVA 4BUOA 3COCA 4BWWA 2OJ1A 5AFAA 1ASOA 3V2YA 2XV0A 1NIEA 3T6VA 2PPDA 2GIMA 4UHRA 3FS9A 1XIOA 3QBGA
chains in the Genus database with same CATH superfamily
2Z7ZA 4X6CA 2C5DC 2WKGA 2XNAA 1K4CB 1PYWB 1CN4A 4TTDD 2BK8A 2V0AA 3ZE1E 3KPQA 5FK9A 4Y8AA 1IAOB 2KZ1B 5IW6B 4Z7UF 3DJZA 1JGEB 3M1BA 4RGND 1AS7A 2DS4A 1FE8H 5AAWA 3L45A 1KBWA 4LLUA 5LAXB 2X7LB 4DVBB 1XGTB 3SGEH 2OSLA 3ZGHA 4HH8A 5B38B 2VQ1A 4JKPL 5SWQB 2HMID 2Y69B 5EUKB 2MQCA 1OD7A 4P2AA 2BW4A 4H2CA 2SEBA 3AUWB 4GBXC 4BZYA 5EA0H 1BVLA 4ZOBA 5HI5C 2QPEB 1CGSH 3CQQA 5KYYA 3HG5A 4NO3A 4QI3A 2I32A 3S7GA 5L2KA 3CVIL 4K3EH 2VLJD 1TJIH 3G5XB 4ABWA 5BW7A 1UB6B 5GRZA 2HLFD 3HMWL 4KV5E 5K39A 1EJ8A 4DN4L 5I71B 1CBVH 1XH1A 1ZOXA 4XZUA 4A37A 4DKLA 2ODHA 1LYQA 3MRRA 4F8PA 3DJTA 4O4YH 4GAJL 5LBSH 4N90D 4W9HC 1Z9MA 3KW7A 4MLSA 5AOLA 3T0EC 5DYFA 4UTAL 4HJIA 3S5LG 3UC2A 4XAKE 2Z8RA 3G5XA 4YBQD 5C2UB 1Y18B 3FFOA 4XNMB 2Y00A 1BQHB 4TRPL 5JPMA 3AS0A 3RZCC 3QXVA 4PJ8B 4Y5VC 5KYYB 1WWWX 2C4XA 4O2FB 1RZQA 3HRZC 3GUFA 3I85A 5IESH 1WHPA 2EVIA 4G8IB 2MTPA 2EDLA 4PY7A 4XP6L 2CJSA 2VQ1B 4PS4L 2COVD 2YXFA 2WYIA 4PVNA 4IMKA 1UXLA 2EUVA 3D4YA 3C09B 2FZ3B 3IJSA 4U1HA 1KYAA 2NYYC 1NBZA 4I0KA 2W0PA 3D85B 1LMKA 2C3GA 4TUUA 1TQBB 1ZTXL 5IEKA 4UQ3A 1OAKH 1KPVA 1FPTH 2X88A 2C26A 1RZKH 2W95A 5TGBA 1ET8A 3VFMB 1GRWA 5D72L 3GSOA 3EFOB 5EU5A 3KPQB 3F8UB 4HHAA 1KFAL 5CIPA 4QWWD 1M7DB 4ICXA 1U92B 1QKOA 1YY8B 4G6KH 2FWSA 3GMNA 3VFWB 1SFHA 4PRPA 3I02B 2F6AA 4IGBC 1QAWA 1QWHA 3EDEA 4GQZA 1XJIA 1TVHA 3BP7A 1GYVA 5CLTA 3F7QA 3GSNB 3K3QA 3DNKA 4NIYE 2QQQA 3DLQR 5BOPA 4EI5B 2VDPL 4AZ8B 5F7UA 3WN5C 5C0IA 3RBSA 3ZTEA 3RILA 1AHKA 1JGDB 1JWSB 5HHOA 3K7UA 2A6JB 4HSCX 1MI5D 3RVUD 1UCBH 1U8KB 2QVMA 2VDLB 1ZK5A 2XX0A 3M8OL 5EUKA 3V0DA 2AK4E 3B6SB 2KPWA 2UYLA 5ID0A 1W0WA 1QSZA 5JDSA 4KDVA 1UAZA 4OKVB 2EDOA 2K1MA 3KPMA 5IVNA 3RY4A 4GPVA 4HUVB 2ATKA 5CSZA 4AMIA 1NC4D 2WQVA 4HV8A 3O4LD 4D94A 4NZRH 1BZ9A 3EJTA 3ULVD 3FB7A 2FO8A 1ORSA 1RZIB 5JOPE 2UY7B 3ALWA 1UZ6F 3F58H 4F91B 2DQJH 1DZ0A 1KMEA 2NDGA 4GRLB 4MMYB 3FONA 5JYMA 5AX1A 1CGUA 3TBWA 2X4RB 2IPKA 5DC0A 2EJ1A 3QIUC 4KJQC 4ELDA 1FNGB 2IPTL 3IJ8A 4WEBL 3CFCH 5C97A 2W9EH 4BFJA 1E4WH 1H3VA 2YAHA 4ZPTA 6PAZA 3BSZL 4W9JC 1MHHA 2FLMA 4MA7L 2AAAA 3QFGA 3KPOB 1YEGH 3CQPA 3NRQA 4ABVA 2YOAA 3L3GB 4QXGL 2HFEB 1RHHA 3VHZA 3QEQE 2CA3A 2VRQA 4BK5A 5D1QD 2CRYA 3BGAA 5IG7A 4Y2DC 4M4RA 3MUGB 3UZQA 3QDJE 4OLZH 1F6FB 3RTQC 1I7ZA 2GB2A 2VZ1A 1KPRB 4G6FD 1IM9A 3KWTA 3II1A 5C08B 3HNVL 3W3BA 3L3OC 5HYQB 4DZBA 2WXGA 3MTRA 1TITA 1TSHA 4YBHA 1C8SA 3DROA 1D6VH 3DTXA 1MFBL 4OFQA 32C2B 3STZA 1TCRB 3MRQA 1DBMH 3AROA 1RIVH 3F6LA 3MV8D 4JJHA 4OM0L 5JO5A 2EUXA 2ZFEA 1SOKA 2RCSH 3Q13A 1SHSA 1AKJD 1CUOA 3CSTA 3Q2CA 2FJSA 2WUCH 4GIAA 4N2CA 2ADJA 2DQFA 3EJSA 3V7AG 4G6JL 5HHXH 1KIRB 2KQMA 3TYFA 2VDNH 4P4KC 4TLTA 5H2NA 2Z31A 3HPLA 4X9BA 5AW8B 3F65A 4H8WC 1EH9A 1JK9A 1Z5LA 2D4DA 3KWXA 3L4CA 5DGQA 1FFOA 5ICYA 2X28A 2K3TA 2AQQA 3NBNA 3V6BR 1NMBL 3CHQA 3L17A 4UDUA 4YHZH 1OCCB 1C8PA 1E5ZA 1YN6B 4WWKA 2X0WA 3L8QA 4LPTA 3H7BA 4PTUB 4L1BA 1GY1A 4WSKA 4N6RB 4XPHH 4R90L 1R6VA 3IGAB 3L3DB 3UO1H 4P07A 4BYHA 15C8H 2DY2A 2OMWB 1JZHA 4LOFA 2XSKA 4JFHE 3A6BH 4OFDA 2VE6A 4BRVA 1H6EA 3RL2A 1OVZA 1P5UA 3VWJD 3MNZA 3LNIA 5DMKB 3ATFA 3NFNA 5EU3A 1JIBA 3HE7A 2WNWA 2P44B 4YSSA 1XH3B 3MROB 3DTXB 3R8QA 2XG5B 4V1DB 5EBGA 2CDFA 1IC0A 4BH7B 1KEGH 2UX6A 1XGRA 2N0MA 1G0YR 3GS0A 2KZKA 4KQ4H 3S36X 1BEXA 4PRHA 5B8CC 5EU7C 5ILTL 3PG2A 4W70A 3OZLA 2YZ8A 4HHGA 4LSVL 5DSCA 3N2JA 2VLMD 5E2TH 4XMPH 1KTCA 2P8LB 3HRPA 5K1VA 1XSOA 3ZGIA 4QMEA 2FDBP 5F1OB 3IXTA 1TO5A 5F0PB 4XNDA 3VFOB 3HJEA 4WEBH 1LP9A 4ZUUA 3W5MA 4MHHG 2Z35B 4K3GA 1FDLH 1FL6B 4EIYA 1QBLH 2BSSA 4UNVA 3VWKA 2VR8A 4LO9A 4MQXC 5KYXA 3T2QA 3A6CL 4QXGH 4RGMB 5CILL 3CMOH 3QIUD 3GBNL 4HWZA 1B0RA 2VLJE 2Y22A 1H19A 1NGQH 3STBA 1JN6B 4XXWA 3IGLA 1MVFA 3FK3A 5KSVA 2KS9A 2K7PA 3DV4B 4PHZA 1EZVY 1WA1X 1BFOA 4H25B 1ZVYA 4JRYD 4QY8A 3VFGL 5J1SC 4CVZA 2F5BL 3P4MB 2Z35A 3D39E 1FUNA 4NO0D 1ZT1A 3LPWA 3NJGA 4OZGB 1L7IH 4X6CF 2CXKA 4Y4FD 2F08A 3MCKA 5BQ7B 1HYSD 1D7BA 3UTQB 4XVUD 5F96L 2QEJA 1JE6A 1A25A 1IGCH 2WUCL 2XQ0A 2HJFA 1U3NA 4PEEA 3MRHB 2CLRA 2W0KA 2ZD0A 5DA4A 5CEXA 1DDHB 4RMBA 3B56A 2K78A 1DP0A 4AQ8A 5B6XA 2WXJA 3BAJA 2IOMA 1J5DA 3LEYL 4MDIB 5CGTA 1Q9KB 4N8UA 1YVLA 2I21A 3GDBA 3K0YA 3OJMB 5A7EA 1DQJB 1E28A 2VDLH 3O2WL 4KH9A 4WHDA 2QKSA 1MCOH 1DQVA 1EZVX 1OQOA 1E27A 1HKLL 3JWDL 2YEZB 3C2SA 2G3XA 3JT0A 4OF6A 1PZDA 4ZAKA 1RURL 5GS2H 3QAZC 1XVSA 3BKCH 4DOHB 3K72A 2PYFB 4LLYB 5AZ2H 2GTZB 2CNYA 1OAXL 4KKAD 4DOHE 2GKIA 4PJDF 4ZYKB 1CXIA 5D96C 4H8PA 2ZOKA 4GMSH 4GAFB 4QXVA 5AHYA 1JPSH 3FUJA 2Y7LA 2V5MA 4FAAB 3GZKA 2JJTC 1T66D 3K91A 5FYLE 3P30L 1O7SA 1SY6L 5IVOA 4BJLA 3C5SB 1R3JB 2EACA 3FZUD 2WXRA 2OX5A 3S88H 3HMXH 3MCG1 1P4IL 1BG9A 3PNWB 1H6UA 3FU7B 4HJUA 3CFKB 4TUJA 1EBPA 1JGVH 3X14B 1E5UI 3HZKA 2ZF8A 3UPRA 5C2BH 3ARYA 3IBEA 5FGRA 4DN4H 3S5YA 2X70B 1SOQA 1CZ8H 4F7KA 3G5ZB 3IXAB 2MCPL 3CCHA 2OYKA 2OZ4H 3WEXB 2GEEA 4QRSA 2OMXB 5ADPH 1WZKA 5FOJA 2LR4A 4U6XA 4I1PA 1DUYB 4G2AA 4F7PB 4UV7H 3V0FA 4PRDB 2L7JA 4N85A 4H26B 5HDQH 3DOIA 1M1SA 2QR0B 4B96A 1I4FA 3FO0H 3OHXA 3MRRB 1O6SA 2Y0SA 2NLJB 5C0DA 3CFJA 3GMNB 4KNUA 5AVSB 1JN6A 4DHLA 1UYWH 2NY2B 1RHFA 3DOSB 1DVQA 5IJBC 3BLPX 3PGFL 5G53A 3EHBB 1EGJH 3H1ZA 3NJFA 1VACB 3PFQA 4UYQA 5SX4I 2MCG1 2DBJA 5GZOA 1RY7B 1I85A 3QBIA 1JPTL 3DX4A 1CXKA 3HC3H 1PPIA 3MYZA 3LKPB 5JXEA 4MZRA 3H4FA 5CJQL 4Z3EA 1NC2B 3ARTA 3FT2B 1RK0A 2XX1A 3NPSC 1PZBA 4YDJB 2KL6A 1N2RA 2JKNA 1REIA 2Z7YA 3EF7A 5DVOA 4L29B 2EDKA 4Y2LA 3GRWH 1JPEA 1WIUA 4P2RA 1UH3A 3FN9A 3DDFA 3KPRA 4L8CA 3N0PB 3Q0HA 4Y4KC 4LHUG 5I9QB 3MREA 2E9GA 3Q44A 3IK2A 4Y16B 5I0DA 2G30A 3QAKA 1B2WH 1Q72L 4UV4H 3UTWA 1NCGA 3QZMA 2JB6A 5F6HI 4AE0A 2R2HA 2O30A 3D06A 3QJHB 3UTTB 3W39B 3OPZH 4LNVA 1A6PA 4Q9QH 1ORQB 4ZODA 4NENB 1U2HA 3RKDC 2AJVL 4N86A 3ZE0B 4AZ8A 3L7EB 1Y07A 2APBA 2VDMB 3WDHA 3H6AA 3ILQD 1JTTA 3DGGA 3OXRB 5KUMA 1IKOP 3ZO9A 4M4PA 4Y2DB 5AVUB 3RPBA 5GS0D 1K8IB 2PPCA 1J05B 4LASL 1QVOB 1T04B 3HE6D 4X6BA 5FWQA 3I02A 3TA4D 4YXLH 1OPGL 3TX4A 1H3WM 4HP5A 4JL2A 4K5OA 1H0DA 3HPLB 5HHQA 2FR4A 3GM0A 3OKDA 2D9QB 2X9XA 4LVNB 2EDJA 1T7YA 4ONOA 3DSFL 5AX0A 4W6WB 1BQUA 2JQMA 1SN0A 3PWLB 4PJ6A 1E3XA 4KY1L 4UQ3B 5IEKB 1R5IA 1U42A 1WC7B 2R23A 3AQZA 4OFPA 2DPKA 1OP4A 4IEFA 3WS6A 1EEUA 4DTGL 4H5SB 2OQJB 4X5QA 5KJRH 1OAUL 2XUWA 2GK2A 1FYTB 3BWAA 4LU5L 4MD4B 4B9PA 4D8OA 4AQAB 2X1XR 4KVNH 3KBFA 2XQBH 4RGNE 2CLZA 4YHPA 5B34A 3W82A 1QTYT 4X32A 1M7IB 1CFQB 5HGBA 2XXCB 1C9SA 1Q0YH 4XP1L 4Z77A 1CGWA 2NY5L 1EAPB 1H3PH 1HHJA 2PCXA 4WEEA 5EHFA 4DAGH 4ELMF 3UTYA 2BERA 1IAIM 4MAYD 1DL7L 3HS9A 2YZ1A 3RGVC 3VRIA 1U0QA 2ZUYA 2OZNA 3T77B 1M7XA 3EDJA 4JVWA 2GITB 3FXIC 2AEPH 4TNVK 3RP1A 1CF1A 3NEOA 4Q74A 2FJHB 2JCCA 1IBGH 3NCFB 4BE6A 1M7IA 2FSEB 3QQ9C 2BDNH 5HGBB 3U4EA 1D9KA 1AKJA 3MFGB 1HVXA 3DRQA 4OQTL 5KVEH 5FYJL 4GSDL 3UYPB 3VI3F 1KTJA 5J6GA 1F6AA 3DMMC 3BWAB 5KBNC 1JZ7A 2BNQA 2CUMA 2X9WA 4WNQA 2YPVL 4Z9KB 3IE9A 1BXXA 1BZ9B 4NENA 1PZ3A 4M7KL 2C1PA 5IQOA 1W0YT 3V0WL 3B5GA 3IDJB 3QUXB 4WO4B 4QRFA 1P7QB 2IFFL 3BWUF 2KSBA 3CK0L 4P49A 1W0WB 3HHMA 1EFXD 4YSPA 1A7NH 3IU4H 3GI9L 4KJPC 3DX7B 3RWFA 3IF1A 1NJ9A 2ARWA 1A9EB 2DJMA 3QORB 3LKSA 4G8FB 4B9FA 3VFSA 4M1CC 4FXGC 4XMKH 1PZCA 1T7WA 1BQHG 3LKRB 3OM3B 1DVFA 4LDCA 4OD1L 2EIEA 3HRZB 3CSFA 4YC2B 5CD5D 2V3EA 1HQ4B 4ZMAT 1OAQL 3O2DH 3U1PA 3B2DC 3ZLQC 3U4EB 4PG9B 4MVBC 1SHMA 3EUDA 3I3DA 4ZQKA 3KJ6A 1G6RL 2VERN 4IDLA 5TH2B 4JFZL 5FA4A 3R8BB 3GF8A 4IIQB 3LYRA 2AJUH 5DU7A 2YN3A 1BQLH 2X4SB 4AV4A 3O4LA 4ELMB 1AQKL 4BKSC 1UD8A 3QULA 4JR8A 3LEVL 3VDCA 4NC3A 3SOTA 1PF3A 4XNUL 1BEYH 1IC5H 1XSJA 2QZ5A 1B90A 2F68X 4K7FB 4JRYE 1JZEA 2WOBA 4XNZC 1P8UA 5CZRA 4AIZB 2VRAA 5TDOA 4LKCB 3TVMD 4Z1PA 4Y89A 2CDEA 4KVCH 3VJ6B 1OCRB 4FKHA 5DZVA 5EZJA 1RZ7L 5CP3A 3TNMB 2FBJL 4XCEB 3GGWB 2UZPA 1MWAL 2WIMA 1L9NA 3L54A 2A73A 1R5WB 4FYRA 2DBLL 3LB6D 3B9AA 4W4OC 4PJFE 3JV0A 1P84K 3F6IA 3VD2A 5IIEA 2VJ8A 4M48L 3T9WA 5C1MA 1Z3GL 5AAWC 1YMHB 3GSVB 5LGYA 2W07A 4FS0A 5LBVA 2P8PB 4HULB 1KELH 3CLEL 3F2LA 1U2YA 4OV5A 1EUTA 4CSTA 3HG1D 2HX9A 3MXWL 5L0QB 5FW7A 2FJUB 3P73B 4X80L 3L81A 5BMFL 2OV0A 2IDFA 2K3HA 2XXGA 4HS8L 3SJVE 3D2UA 3EO9L 4NUGH 5KVEL 3HFMH 4I18C 5LHDA 4NO2B 2FEDC 5EU4B 4GG6F 2OMBA 4U6HA 3V55A 1WFOA 4Q7DA 4IRZL 3WENA 3EOBA 1MVYA 4ZFZA 2FATL 1Q9LA 4FA8A 3L16A 5LG6A 3AB0C 2QHRL 3FT3A 2JAGA 4OVUA 3WLBA 5AKVA 2B9AA 1F02I 4RGOH 2DL9A 1YUHB 3BSHA 1EDYA 4JFHD 1BVLB 4NLAA 4XT1A 2I9LA 5AOIA 3EXLA 1KIPB 5C0CE 3QUGA 3EDKA 5E5MA 3JWDH 3BKYH 1C7TA 2FLRT 3DI3B 5IBTH 1U3HC 2OSLB 1S9WA 5JOEA 2ZYSA 3OJDA 4MHHI 4XC1L 4AMWA 1A0QL 1TYJA 2WO3B 1S7UB 5I1DA 2JV6A 2VN3A 3LQAL 1XR9A 2WSPA 2YFNA 3GXNA 3QEQD 5H94A 4FA7B 2D7TH 3BX7C 4K94L 1CDCA 2E56A 4GBXD 3WFHA 1G7IA 3ABGA 1WFNA 1AXIB 3U0TA 2EYSA 1TJGH 1X7QA 3K6FA 3OC5A 4RFNB 4X2UA 3O6KL 3MC0A 3K72B 1MFCL 5ALBL 4M5YL 4ERSL 5JQ6L 3B9VA 3FT9A 4KX8A 3ILQC 1SUHA 5I28A 1WUZA 3DTDA 5GJTL 4C56E 1T2QL 3KZ8A 1DBBH 3S3DB 3OB0H 4FHJA 3GS7A 1A7QH 3FRPA 3NSYA 1TR7A 1G9MH 4TV3A 2GSGB 1PZAA 2VOTA 3LPPA 4OF8A 4PB9H 1BRDA 4ZNEE 2V37A 4H8WL 1PAMA 3L6FB 4HG4J 2NY0B 3INOA 2JKRM 1GW6A 2J4WL 4LOVA 4UU9A 3ZN6A 2I26N 4F1SA 4L8BA 4NQXB 3RFMA 1I8AA 5KBMA 3NIFE 3LH9A 1YEIL 4P2RD 3PGDA 2BFGA 3SYAA 4FLSA 3DJ9A 1G6RB 3ESVF 2UZXB 3OC8A 3FRUA 3PP4L 5FLUA 5TF1H 1BQKA 3UTQA 1FBKA 3SPIA 3WEXA 1V7ML 3RI5K 1WFMA 2IDSA 3AG4B 4JFED 1E5AA 5AW4B 1QW9A 3GZQA 1G6RA 1HZKA 3SQBB 4LB8A 4MD1A 5J57B 3HZKB 4AGOA 4U3CA 1YC8A 1X5AA 2X3BA 3NACH 4EVNA 1YNTB 5K9KA 5E00B 2V7NA 3N3EA 2ZUTA 4JPQA 3VX1A 5F7DA 2HX8A 2FQGA 3T4YA 2PO6B 3HEIB 1AQHA 1L7TL 1RK7A 3D48R 4H1LB 1VGKB 5DHVH 3A7KA 3OMNB 3JTSA 4GLRI 3AY4A 4FFZL 1AZCA 4GOSA 5J5EA 1IJ9A 3IFNH 3I9GL 1BMZA 3C9NA 1FBIH 1R3IL 4P5TD 2GTZA 4YN3A 5D1QC 3TFKC 4KV5F 4Q9BA 2AK4D 4EXPX 3HI1A 4QIDA 5IBLD 4LLWA 1F4XH 2FH8A 1FAKT 4OGAC 4WW2A 1IGIH 1P5UC 4JRXB 3AREB 1MZYA 2CM5A 3TEUA 1XR9B 1MEXH 2JI2A 3KCPB 3ARGB 3II3A 4KMQA 3V10A 2J1WA 2DM4A 1Z32X 2YDOA 2DIAA 1NUFA 3BKYL 2DMCA 3C8KB 3DMMD 3GXFA 4GAGL 5TK2A 3T09A 4IMKC 2IADA 3LN5B 4UQEA 4JFDD 5FYLL 4BEZA 3VO0A 3CLWA 4I3RL 5DFVD 1TTCA 2EEXA 4K3DH 1A7OH 3E3QC 4Y4KB 4XN7A 3LRLA 1IGFL 4PJHE 1CDUA 5F72S 2VSMB 3HTLX 2YCWA 3BWSA 3QEQB 3UTSD 4EZLA 3FH7A 1JZ5A 3PHQB 4O51A 4ZW5A 1U8JB 4J23A 2CG9X 2GSIB 3UIYA 4QRYA 3U0WL 5JQIB 1XGQB 1G1KA 3X1NA 3ZMEA 3NJNA 4A63A 4M1CD 2VM4A 2O5ZL 4Z7OE 3MUY1 4MB4A 1N0LB 1WCQA 3U6XS 1RZPA 1NMAH 3GB7B 5MHSE 1FV1B 4Y4HB 2P9RA 5KSAA 4BEYA 3GNML 4DP6X 2W94A 4XMXA 4X4YB 1IFHH 1HX0A 1L5GB 3PCYA 3QJOA 4BZ1L 1KJ3H 1I3UA 1RU9L 4X6FA 5CEYA 3MRIA 4YHKH 2NNAB 2DAVA 4JKPH 5DDHB 3MBEA 5F8QC 5BZDB 4AXWB 4PUBH 1PDKA 1H3GA 3RRQA 3A67H 4FCAA 4MJ5B 5E4AA 2BS71 4MJ6A 3QEHB 4I0CC 1AMXA 4UINH 1CFQA 4WRLA 5GS1C 3X1GA 5JW4Q 2QGDA 1MCCA 3BAEH 3QXAA 5B39A 2PTTA 5E8OA 1HSBA 3KPLB 3KR3H 1DJYA 4U6TA 4N6HA 4JQXA 3ZQ9A 1I7RA 1WZAA 4BFKA 2KLSA 4MNHB 3ZO0A 2QTEA 1ECYA 5F7BA 1UTDA 5J7AA 3P4NA 2R2BB 4TQPA 3VXUA 1WEJL 2X0VA 4NAJA 4JRYB 4R8WH 5B35A 4C56B 5JDSB 1SXNA 2Q7AA 2YRPA 2ZCKH 1PTZA 3L95A 5D1XD 4RMRA 2FJGB 1BBJA 3QIUA 1NIBA 4OGXL 4J6RH 4HJTA 3KD4A 1T83C 1BJ8A 3G5YB 3QDMA 4NN5C 1DJSA 3ULSB 2BIIA 1JNNH 2OCFD 1QSFB 4OJFL 1HL8A 1EEYA 2BVQA 4I2XA 3FUHA 1GW0A 4YHML 4RIRA 3VA6A 4CNIA 3TEWA 4M6NL 2X4RA 4Y2DA 1M9SA 5EF3A 3FU9A 3LHPH 3LXAA 1BBDH 2IVFC 5KN5A 1UFGA 4N28A 4X5XA 3WE1A 5CEZH 4CNIB 3AQXA 4IK6A 1FFTB 5IB4A 2C4FU 1E0PA 3GI9H 4G6AC 3KDPB 2VR9A 4JMNA 4TUOA 4XO8A 1IZJA 3JUZA 1FPTL 5IEHB 2P8PA 3WL9B 5I30L 1FVDA 4KITB 1J9QA 2R27A 4XVUC 2XKSA 1YNTF 4NSKA 1J12A 4XX1E 2FWOB 3NK4A 1DJXA 1KJ2H 2H3NB 3QBTB 4WI9A 1E6JH 4XCFH 4D0CA 3ZXAC 2VMJA 5GGRB 4JREB 1F58L 4Y7OC 2D4FA 4DKAA 1YJDC 5D4JA 3Q9PA 4Q9CA 4G9FB 4MZ3A 5KVDH 2EE6A 5A1AA 3T6VA 4TNGA 3MOAH 4UM8A 3UACA 3AMKA 1GYWA 3A6OA 5I74B 3U0PA 3A23A 4MNQE 3QBKA 1AQKH 5I18H 3CFDB 4TLUA 1O7DC 4D9LH 3Q48A 2QT6A 1NGYA 1QA9A 3MUHL 1A6AB 4JFPB 5AYUH 5F9OH 3NJJA 4N0YH 4RBPK 5T1LD 1P7HL 4OCWH 2AV1A 4AK2A 5DDHA 1BMWA 1SYVB 4L3EB 5H37A 1QEWA 4MXVF 3DSNA 3AJ7A 3WHXB 4F9LA 4Y19A 1AFVL 1QHOA 1E6OL 4P5MB 5D7IE 3SO5A 4DUXA 3SDAC 3VXSB 1DHKA 1MJ7L 5K33A 3VI4E 4BFEA 5IUCA 2ICEB 1MCLA 3BIKB 3MV7B 3U48A 2PETA 3B9KD 4UM9D 3QI9C 2YS4A 3UZEC 5C0BA 3R19A 4X5RA 1MCJA 2Q87A 3BQUB 1KGCE 1RSYA 3DETD 2Z8VC 4M8QB 3KCWA 3O41B 2OQJA 4E9XA 1J88A 3CXHJ 4HXAL 3BKMH 4IS6A 4AITA 2C34A 5MEOB 4Y1AE 4PYHA 4X80H 5H37G 4L4JA 4APQB 2HUEA 4MA7H 1QKPA 2QQKL 4NIKB 1AXSB 5E1QA 1RL1A 2ADGB 2G9HA 1YC7A 2JSFA 4KQ0A 3ZZLA 2ADFL 5JW4N 5I1IH 4OJAA 4OJFH 1M6OB 1MCIA 1VFBB 4NXSA 2E7HA 2FL5B 3SDDB 3VYNA 4YHMH 4XHJC 2ZUQB 3AT9A 4PG2A 4FLQA 1H8OA 3LCYA 3D69A 3JWNC 3O9WC 5LCVH 4A7TA 5BCAA 2DH3A 1GAFL 1AAJA 3WTYA 4L3CB 4FQJH 4MA8H 3OQ3B 2ESVD 1X5XA 1RZFL 5L4IA 3LKPA 2VR6A 5J89A 3KWWA 3NZHL 3VXSA 2BRDA 4G5ZL 3TESA 4NM4H 2CGRH 1T6WA 4PJ5A 1BECA 3RNKA 1NSNL 5CJXA 1R4XA 5IBLC 4UT7L 1RPQA 2QPFA 4YFLI 1GY2A 2EYTB 3S4SA 4HXBL 1BX2A 3QFJB 2D7TL 5F7KC 5CN1A 3SQOL 4EIZC 3BVUA 5MENA 1RI8A 4LSSL 1QYGH 3IJ9A 5K9KB 1CL7H 1K9TA 1YNKL 4HMEA 1M6OA 2DMBA 3BAKA 4XVOA 2FLBT 2FK9A 2WV3A 5ALCL 4LPYA 3L4VA 1TNMA 1ZV2A 4K8RD 1TQSA 5IW6A 4HLEA 5FGBA 3S5ZA 1FAIL 2E47A 1FFRA 4IJ3C 2VLRB 4Z0BH 3VFRB 5HHPA 2ZXWB 2KMWA 3V7AE 3R7QA 15C8L 1K4CA 2XNAB 4NUJB 1GOGA 1OLLA 3UPRB 4LCUA 4GQQA 4F27A 5I1CH 1T1XB 3SKMA 3KYMB 1HOEA 3LH2H 4CADA 2HUHA 1F4ZA 1NDGB 2X4QA 3DO4A 1O0AA 3LAFA 4YZFF 4ZPVA 2BNQD 5JLZB 3VH8G 4DKFL 4YGVA 4MYPA 3BVNB 4NXKA 2WPGA 5B3JF 3RWIA 3RTQB 3ARBB 5DJZA 5IB1A 2VDKH 2GSGA 3LNEA 4G9DA 5IMLA 5L4MA 2COQA 2WQ8A 3CVIH 3H3PL 5EIQA 1PY6A 5GISL 3OHXB 4NRXA 3WO3B 1H3UA 1MHEA 1XGYL 3QUXD 5DJYB 5C7XL 4IB4A 1Q0XH 1UUSA 1G94A 1H9DA 3L3HA 4PJAE 5IF0A 5EEZA 1DJZA 3V6FB 2YEZA 1KPUB 4GYCA 3FFCE 2Y23A 5HDBE 2GBVA 2PP9A 1TVDA 2A9NL 1YY9C 4MXVE 1FC2D 5H94B 1Q90A 2AFNA 4TPRL 2JELL 4PJ8D 5INDA 1EHLL 4LL1A 4D0DA 2YAQA 4ONGL 5KVFL 3FU7A 4JAMB 1IU1A 5TQ2H 1A6TA 2NYYD 4DUVA 1CDHA 4H2AA 2IMNA 4MAZA 2YEVB 2Z1PA 5I75C 4NI6A 4Z7QF 3P4OB 3QRGH 4L8CB 4UUJA 1AGFA 5F3BA 3UCQA 3BVWA 3M1BB 1OY3B 1ZE3H 3CZEA 3JV4B 4S2SA 1SXSA 1KTKE 2HWZH 2VW6A 4Q4IA 5I1GL 1K6QL 3QZWG 3OX8A 1R2NA 1XL4A 5AW5B 4BSWB 1EEZA 5D2LA 3U7YH 1OAKL 4MJ6B 3AC0A 3QEGL 1AZNA 5EEXA 4ORGA 2D7QA 5BRPA 2F7RA 1UCQA 3A3YB 3N44F 1IGFH 3HE6A 5E9AA 1KFAH 5C3LD 3IAPA 2ITDA 3DYPA 4TKWA 3R0MA 2BVOB 1H5BB 4OZIF 1DBJH 1V5JA 3ML8A 1TZAA 2HJLA 3FHEA 3D39D 5JNYA 1ZS8A 3G04B 4UDTB 3DX9A 5FDWA 3SJVD 4HC1L 5I0YA 5JJJA 1RUAL 4JDVA 3MZTA 1UVQA 4HIJB 4WI5A 1RFDL 3QRBA 1YYLL 1LO2L 2E75C 2M1KA 4G80B 3CSYB 2IXQB 4FZ8L 2BVEA 1N5YL 2WXOA 4GP5B 1XGQA 3WNKA 3UBXB 1KCUL 5KYUB 2L7EA 2VL5A 1ZWIB 2D7OA 2ZICA 3NUKA 5HHVH 1RVFH 2X4UB 1Z9OA 3B2VL 4PUBL 1GSMA 3TWCH 3O3AA 4Z7OB 4BHUI 3HVDA 3CFQA 4NEHB 1LE5B 3T2LA 4K55A 4UAHA 3K6NA 1KF9B 4GY4A 5DK2B 1WLHA 5DD6B 5HD8C 3SDXB 2GY7B 2R7EA 5MERA 4JO4L 4TSBL 4X6DF 3FH8A 3S48A 3WTUA 2R0LL 3F12A 1DQQA 5EPMA 3H2WA 4NQSA 5ICZB 1UG9A 4XE0A 4M1GL 1RJZB 4HYTB 1Q0XL 1Q94B 2Z64C 4YDIL 1PCXA 5ACLA 2Y5TB 1DN2A 4D0BA 3HI1B 2P48B 2LU3A 4XHJD 3UCRA 1GYAA 4ZO7A 3IS0X 4MA1C 4Q6IC 1X9LA 4XN2A 35C8L 2A9NH 3QDGB 3DX6A 1AI1H 1KGBA 1JI2A 2N0KA 4HIPA 1CICB 1KXVA 3EDFA 2IWGA 3LKSB 4RGNC 5FM4A 3CDZA 4BKLB 2CPCA 3NJVA 2X38A 3QWOB 4XVJL 1NFIB 4JJOA 4WWKD 4EBQH 4HEMA 3IGFA 4QRTB 1WFTA 1RAMA 2ZOOA 3P4LA 3FFDA 1SF5A 2PCFA 4HIIB 4YXHH 2DB8A 3EW3B 4MD5B 1X0I1 1KCLA 2QMJA 1EERB 3OSVA 2O5XH 4JL1A 4KJPD 3WGUB 2J5WA 3RVTC 4EAEA 2E76C 1QM8A 1XEUA 2XN1A 3C6SB 4P2RE 1JD7A 2LAAA 4M6AA 2R0KL 3FQXA 3MLVH 1MG2C 1YEKH 5AB1A 2FT6A 1XAKA 3NA9H 2Q6WA 3EYSH 4BK5C 3U4AA 3VXNA 5AVQB 3ZDXF 4A38A 1GGIH 4OZIA 3SE9L 1BD2E 4EN3B 3AU0A 2JB5L 4ZK8A 4QF1A 3OKOB 1LNUA 4RMUA 5J06A 4YHNA 5HDBB 4P9HL 2DQFB 4WI8A 1F11A 1JDAA 1OHZA 3UONA 1XGPA 2IJ0C 4APQD 3TBYB 1SM3L 4K94C 1INQA 4O5LL 2NX5D 4OV0A 1YLBB 5DO8A 4CN1A 3MXVH 2HVJA 4RFOH 2XA8H 2QV4A 3BC9A 3IRPX 2AEWA 3VVVA 2HVKA 4L4TA 3BZ5A 4FGMA 2AP2A 5SV3A 5IWLA 1FO0B 4URTB 1JXKA 2J1YA 4YAQA 1X5FA 1R3HA 3H2QA 3F7YA 4A2LA 2XG5A 3BPOC 3MV7D 1HSAA 5JZ7D 3WJMA 2R0LH 1T0NB 2BSTB 5DYOA 2P52A 3FUMA 5F1NB 3MNZB 2IH1B 1XBRA 2YKKA 2EIDA 3EOTL 3K46A 4XZ4A 1EFQA 4LOUD 3IMSA 3AW5A 4U1IB 4IOIA 1F11B 4ZPTB 5HI5D 3VTMA 3NY9A 2VN5A 4P2OB 1E30A 1HXKA 1F86A 2C3HA 4IRJB 5DT1H 4EN3A 3GLDA 4NO2A 2VUOA 5DZAA 2CIIB 3N50A 5CU5A 2EIZA 3G7TA 4LDEA 5C9JA 4PXKA 3RY5A 4PLOB 4KBPA 3HHSB 3MDJA 1UH2A 3MBWA 4ADJA 1QMUA 5E5UB 3ZDZF 3BHBB 1JRHI 2B0SL 5IMMB 5I5JA 1FFOB 1UWEL 5F7EH 5ICYB 1TJHH 2VT4A 2AJZA 3DX8B 5KYNA 1B4TA 4DZ8A 2AC0A 3W81A 4YFDB 3BIBX 3EBAA 1NL0H 5DS8B 3H3BC 3NY8A 2WVSA 4FI7A 2ZAIA 4PGDB 3WFHB 2WO2B 1B6UA 3CWGA 4LCYA 3QIBC 4Y16D 3ZE1F 4EDWL 2W38A 4FQJL 4MA8L 3D25A 3GMPB 1XAUA 3R1GL 4OI9A 3QO0B 2FQEA 4PJ7F 5IFAH 2IV8A 1YSOA 5T5FL 4R0LB 1QUNA 5AVWB 3OLDA 3ASNB 1Z3RA 1TPXB 5CCGE 5DHYA 3HNTH 1HEJC 4PR5A 3QIBB 3WO4C 5MEQA 2B39A 3WFCH 3WNNA 4AGNA 1CF8H 2E46A 2FHFA 3HBQA 4HDIA 4LPUA 3LDBC 4O2EA 4PJ8A 2P5EE 4YL9A 5LGKA 1MLBA 1RMFL 2EZ0C 2GAZB 4JZJB 4NN6B 1HK6A 3T8VA 5ES4B 1YEHH 2WB1A 4NGHH 1JXDA 5SX5H 2IPTH 1KB9K 2GT9B 1RLBA 2ORBH 3NAAH 4PS3A 2H2SD 4OSUH 1IL1A 2VR5A 1TQVA 3DOSA 4NM8L 1MCOL 1A47A 3DRTA 4KDTC 2F18A 3WKML 2AJ3B 2PWHA 1ZT4A 3PFUA 4IU2B 4DN3L 2OW6A 5EOTB 5GS0H 2Z91A 4E68A 1QO3B 3GRBA 3GSNH 3EO1A 3PGCA 2CKBA 4PJ9A 3OF6D 5DFVC 5KUKA 5GSRA 3ZMRA 3QA3A 4FHBD 4UZGA 3AU1A 2V5SA 3VXUE 4G70B 2EDNA 2FGWH 5IMKA 1ZVNA 1ASOA 3GMQB 1RPKA 1NIEA 4L2LA 4RFEB 5HYJE 4S1DD 2D7MA 3MRLB 5D7LA 2BLFA 1DO5A 3N42B 5LN4A 4NUJA 3DUSA 2AI0H 5I8KH 1K8DA 1SF3A 3GXIA 2XN9D 3L9RB 4XTLA 1R1CA 1S7QA 4KXZI 1BOGA 2Z0BA 5F7AA 3SBRA 4NZUH 3S8GB 3R4DA 5JJNA 5D7IF 1JDCA 3A47A 1HNYA 2JLPA 3MRMA 4K5MA 5C86A 4LNRB 5C2BL 4JO1H 1JOIA 2ZUUA 4CSSA 5ICXB 2KZWA 4XNUH 5F9DC 5JIMA 4P2CG 3V0JA 5C07E 3PXHA 1HQRB 4FRWA 2W91A 4TQIA 5CBEB 5LXGH 3VG0H 3QFJA 4TPRH 4JQIL 4M7JH 4ALAL 4D8PA 3QDJD 1CC3A 4Y5YB 3HNSH 5SX4H 2QHLA 1UCTA 3H0TB 4Z3FA 2F19L 1EXUB 1S78C 4Y88A 2NSMA 4PJ5B 3BGMA 3G6JE 4XMTA 4I8DA 4HT1L 4OTXH 2DQTH 4G1MA 4MCYA 1WV7T 2E9BA 5GPRA 3N6YA 3VWKC 1VKXA 1N8ZA 1QBAA 3AQYA 3QG6A 3TPKA 2GJJA 3O3EA 4PR5B 1SBBA 4NP4L 5CBEA 2C1OB 1FFPB 5D7LE 4JRYA 1QUNB 1KTDB 3CU1A 1HHHB 1MELA 4PREA 5FC9A 5HPOA 1FZOA 3ES6A 5C9KA 2LVCA 4DPBX 5F8UA 4JG1L 4N8CL 1TQTA 3IFPA 4UYPA 5DUJA 3B2UD 4AEIL 1TTAA 1WFUA 2EXYD 2GSMB 3D39A 1XF2A 5HHXL 1SBSH 2WBKA 1BIIA 1GZHC 4JFOB 3LEXB 2F74B 3S3JA 3HHRB 4K07A 4RGNB 1PDKB 5IKCB 2ZYIA 1JGUH 1OO2A 3OKDB 5AZEH 3MO1B 3L3HB 3AU1B 1FIGL 2W65B 3RX5A 1QW8A 4NQEE 4NQCB 3EJPA 1QBLL 4JFFE 3HUJF 2B5IC 5IM7B 1C12A 2A9DA 2YPVA 3CFJB 5EOTA 4NKOA 1MQ8A 1SXAA 1Q9WA 5T5FA 1CVRA 3VI3E 2DQ6A 3BW9B 3CN1A 4H26A 4JRFA 1GS8A 3FO9A 2GCYA 2RIKA 4ETQA 1DZBA 3T4AB 5HPMB 2DKSA 5F97E 1MW0A 1E43A 2YPKB 4WCYL 4IRSC 1L0XA 2LNLA 3X3BA 1QI3A 1T03H 1V55B 1G9NC 3VD1A 4QOKA 3RG1C 4HIXL 1PFOA 5DHMC 5C70A 1AH1A 2HT3D 2BMKA 5KSBB 5CZVH 3WIIL 3X11A 3QJHA 4LQFH 3UTTA 4X9HA 3P3YA 3GMLA 1ONQA 3N40P 3BGFB 3L2LA 4DP9X 5FYJU 4FXKA 3CFUA 2VMFA 4NO5B 5EO0B 5TK4A 3F7VA 1HSBB 3KPLA 3SPHA 3V4VL 4QNPE 4G1EA 5E0FA 4KKPA 1CLCA 1P8HA 4BFFA 7PAZA 1UEMA 2GC7C 2WCPA 1INQB 2WLKA 4KKCC 4GW4A 1BVKA 4AJ0A 4ZFOA 2ZXGA 2G2PA 4E9WA 5G5DB 4AMJA 1P1VA 2ZXEB 1G7JB 4AQ1C 3ULVL 3HKFA 1HT6A 3HLAB 2EE0A 4LLAA 4E2OA 4YLCA 1UWXH 1YN7A 4JR9L 1UFUA 2Y7OA 5H2MA 2EEDA 4QHNB 3QHZH 2LABA 5FAAA 4YX2L 4S1QH 4OIAA 2H41A 3L3IB 3PBLA 3RZEA 4AIEA 2QQNL 3D0AA 4BQ8A 1F1DA 4AEEA 3NTCL 4WJKB 4GBXB 2OFQA 4R5TA 1LMIA 1J5HA 2EH8L 2NW3A 1NPJA 1K8IA 1IC4L 3SDYL 4NJAH 4WGVB 2F5BH 3KH4A 1T80A 3W9EB 2JKXA 4NP4H 1VZHA 1WIOA 1ZGLP 4EDXB 4QRPB 1M05B 2ZT9C 5F9WB 3BAIA 2Z7WA 5DVPA 4AM0A 3SKNA 1ZTXH 4QXUH 5HYSG 5I26A 4IOIB 5CMAB 1KG9A 3C60C 4K7PX 4QYAA 5HXMA 2L7QA 2EDEA 2R0KH 2APWA 3I6GB 4BWBA 3LKNA 4HIIA 1GKOA 4TLSA 1UD6A 3BZFB 3K2KA 4XVSL 4KROC 4AQ8C 4KZEL 2I69A 1ZLWH 5J3HC 4EIGB 3UZVA 1A6UH 3DVNA 4JGUA 5CNHA 3SYCA 3JT2A 5F8RC 4CVUA 4IBWA 3P4NB 4NC1C 2FBRA 4LL4A 2EUZA 1PKQA 1XL6A 3CK0H 3BKJL 1NBYA 5E9DE 1EMTL 4NZDA 1TU2B 4B5ZA 4PJ5D 5FYLD 5C9JB 1F2XK 4GRWF 4JCLA 1J10A 5J56B 2Y5EA 2EZ0D 1AYOA 3MQIA 2ESVA 3MXVL 5I73B 5AL8A 4Q56A 5I5IA 4LVOB 1WBYB 4PMEA 2DW5A 2AMGA 3GSXA 1RIUL 2VMEA 3D5OF 1D6EA 2FUTA 4FQ2L 1LP9B 1MI5A 4NNYA 2R69A 5D6DC 1NUGA 3UH8A 2E86A 1IFRA 4JPIB 1W8NA 3N04A 5GRUH 4FLRA 4AYDC 1MLBB 2B7DT 3NABL 1N7ML 2BVUA 2AXFA 5F9JB 3RVWC 4QTFA 3UTPD 5KSAB 4IM8A 3W2DL 4BZ2A 3VX0A 3VI4F 2IPUG 2WINB 3KPMB 4HUVA 4FTVD 2C9VA 4U3XA 3WFBH 4GS7C 5D5MB 4GKZA 1UURA 2ALWA 2PXYB 3LMJL 4MD5A 2IANE 2OM5A 3WAKA 4IOSD 1Q72H 4UV4L 1T6BX 2QLYA 2RBLA 3LNHA 4GI6A 3GTVA 3O4LE 4ZO9A 2MPAL 4ZMOA 3W0WA 1OF0A 3ARDD 3K4ZA 3MA9H 3ARDA 3W37A 2A6KA 2XIDA 1LNUB 2IAMC 1O9VA 3OKOA 4QRPA 1SVBA 3K8LA 1PXSA 4UI2A 5DF0A 2XWRA 3TLRA 2IH3B 4IOSA 3VXQA 2VDQB 2VH5L 1CLZH 1QBBA 5HHMB 1U58A 1P6FA 2J6EH 2XU9A 1JWMB 4QRAA 3ZKQD 5BV7L 5KSVB 4LKXB 2YQBA 5DUML 2FEEL 1WAEA 3BDYH 3V5HB 4CJ0A 3TTYA 2X89A 3IDMA 3TF7C 4OV5B 1KCSH 4H7VA 1KEMH 3DX2A 3VGAA 3QR0A 3HJ0A 4Z95H 4KKZA 4IHBA 2FNBA 2A77H 5M7QA 1S5HB 1D7DA 5HHMD 1TQCC 2DIEA 3HFML 1F4YL 3ULSA 3V5KB 3MRFA 1HH6A 2CK0L 2LVEA 3TP4A 3DSFH 4EUPB 1PY0A 3KXFE 2JNZA 1F90L 3FTWA 4V1DD 5C0BE 4LLVB 2CLRB 1CFSB 3U4BL 4D2NA 4NWTL 5I1HH 3Q06A 1ODAA 1NBYB 4YAQB 4YHZL 3FBQA 2AABH 2UZYA 1JUFA 3N1QC 3H53A 5JPMC 3L13A 3O0LA 3RWCA 4LLVA 4X42A 3V4LA 4A2FA 4EZKA 2G2NA 2ICWI 3MGOA 3TO4C 5INCA 4P59H 4AL8H 3DVFA 4OZGA 5J6HA 3C87A 5IW3A 3PF2A 3RL2B 1CK0L 2WXMA 3FO1B 5CJXC 5DLML 4QWWC 4QY8B 1S5HA 1BFOB 3GBLA 4H25A 2F0CA 2DD8L 1CICC 1OF2B 2HRPL 2LU4A 1BF8A 2WK2A 2JJWA 4NCC2 1IKNC 2F7OA 4N2MA 1I53A 3P73A 3A4AA 4WHTB 1S53A 4TNVF 2DWSA 5GHWL 3CVHB 1XV8A 3LJ3A 3MRDA 5I1LB 3QDMD 3D4ZA 3NABH 2J7LA 2ITDB 4I77H 2W07B 3TCTA 1QSEA 2GIYA 3Q01A 2Z9TA 2F5AH 3AZUA 1L3NA 3V4UL 3QEUB 2BJML 1MY7A 4JM4H 4GG6B 1URLA 3P40A 4GSDH 4GJTB 5I8OL 3CPLA 2BIHA 4TNEA 5IQNA 4JGJA 3LQZA 5LN8A 4WY7H 2A6KB 2OS7A 4K7PY 2R2CA 2OJEA 3BOVA 3KPSA 4MRBA 2VDQL 1MWAB 2X2HA 1OAUH 2ZG1A 1I3GH 1A8ZA 1FDLL 2ADJB 2DQEH 4OQ1A 4R4BB 1SOSA 4Y5VB 2AGJL 2B77A 3UGUA 2NMSA 4RZCB 3SDXF 4J3OF 2BNRD 2IPUK 5CHNB 5LWYL 4N4YB 3IU3A 1OOAA 3AMLA 3PJNA 1BAWA 1SLWA 4DFIA 3P4OA 4HFUH 2J8UE 4GQRA 1CFNA 1NEUA 3VFUA 5C0FB 5AD0B 2Y3AA 4HETA 4ZMQA 4JAMA 4U4BA 5CF3A 2B1HH 4PJAB 1GC1C 4L9LB 1AE6L 3VFGH 3ZL2A 2DEXX 3Q43A 3RWJB 2H6OA 1Z7JA 3EJCA 2XDHA 3MJ7A 4N2HA 3RURA 7CGTA 4N0FB 3WMPA 1KN4L 2FX9H 3IMRA 1LO0H 1BMGA 5D2NB 1TO4A 4LL9A 2BSCA 2P4AB 3RVVC 3UTSA 4A2GA 1IBGL 3ZHFA 3BZ4A 3OX8B 4RWHA 4Y19E 4QEGA 3I3EA 3EYOA 3QQ4B 2NTWA 3W56A 1GPOH 2EIMB 4AK1A 2C9SA 2IDQA 3GQFA 4NRXB 1NCDL 5F7LB 3MV9B 4HLZH 4WTZA 1A1NB 2ICCA 3KBEA 3T8XA 4KFZC 1E67A 4NKMA 4YUEL 4FQXC 4G9DB 1IBHA 4JE0A 1BEYL 1IC5L 4F5CE 5AVXB 2OBGA 3EADA 3DXAA 2YKLH 1DVFC 3ECBB 4G42B 4HSQA 3GLAA 1K8DB 1NAMA 1RZJC 2VXQL 3GI8H 5E8EA 2IOOA 4CU6A 5A6LA 5JIQA 2X0UA 3DHPA 1S9XB 3V5DB 2XTJD 3ABKB 3BPCA 3WLWD 3RWDB 4HOMA 3NCBB 2YSSB 2OMNA 4KO6A 1ETZB 4AYEC 1G1CA 2VM3A 4U1KA 3QFJE 2UZXA 4H88H 1ZVHA 4B95C 1TZIA 4TVPH 1NINA 5EC2B 2ZZUT 4G8AC 5IMOA 1OP3K 1ND0A 5T3XL 2Q76A 1MLCB 2QV2A 2OMVB 2NY2D 5HJ3B 5FECB 2IC2A 4NBYB 1S7RA 4UTBH 1AS8A 4UIMB 3HR6A 3MUGA 4A2MA 1U6AL 2CHDA 1XF3A 3ZL4L 3AWEA 4G8GD 3IMBA 3GSNA 3INUL 1NTDA 4LMQE 3MCLL 5J0BA 3RVWD 2VN4A 4NZ8A 5EEVA 3COCA 1Z0NA 4JEGB 4PRPB 5EOCJ 3V2YA 1G43A 4GG8A 2PPDA 3U36B 4M6MH 1OSPL 3LS5L 5LKNA 4JHWL 3WTXA 3ISWA 4FPDA 1X7QB 4A7GA 4NYLA 2PWDA 1ZXKA 1KIQA 1WRFA 4MMXB 4I85A 3EJZC 3OKMA 2XYCA 1OARL 2FJFA 3NESA 4M8RA 4PJIA 5C0AE 4MXQD 3SB3A 2J72A 5IBTL 2YD8A 2FNWA 5GGRA 3A22A 3KVDD 4LNRA 3V2AR 4L1SA 1F3DJ 1FGNH 2LLNA 1FHGA 1MCEA 2E7MA 4CU8A 3KG5A 3VRJB 1S8LA 3WEMA 3UDWC 1PFCA 1VA9A 4IKLA 4WAVA 4KO9A 5L4FA 2X2IA 1VERA 3SSGA 4S11A 1EQWA 5E08L 1BVNT 2FB4L 1PD0A 4KK9D 1HILA 1D2OA 4XI5D 5CJQH 2VO5A 2R0ZL 4YO0B 4G7QB 4ONFL 3LY6A 3TM6A 1QABA 4TTGA 1WTLA 2EIBA 5EWIH 5HPMA 3EO9H 1OKEA 2IBZX 4G8GA 4GFTB 3PNRB 1Q9OB 3GRWL 1JNNL 2FSEA 1J1XL 4OGQC 1LE9B 5SV4A 4RMVA 2E8ZA 5C0DB 4XAWH 4X6EA 1Q9WB 3ARFD 1KGUA 4YUEH 5T3ZL 1A7QL 4ZMLA 3PWVB 4P5MA 1C5DA 5JHAA 4CC4C 2K6YA 1AP9A 3BXNB 2X89D 1T3FA 2VXTL 3FNKA 3FAWA 1FLRL 3S35L 5FGCE 4XPGH 2W88A 4PJ7B 1QFPA 2G4EA 1C5BH 4P46C 2IGTA 4DJMA 4KFMA 5HBBA 2KYIA 5H2OA 2PR4H 3DOHA 2PO6C 5C09B 3IDIB 3RIKA 4J2XA 4JRXE 5HVHC 1Q1JL 2I60H 1ZANH 4L8SC 2WXFA 1I7RB 2FHCA 4E42A 4H88L 3QRLA 1OK8A 2C9XA 2B4CH 3VH8A 4GYBA 1M3JA 4PI0A 4TQEL 2ATPB 2YPLB 3U1QA 1M3IA 3BRFA 1ZT7B 4ANUA 3PDSA 5JZ7C 3V5KA 3VXTA 3GJEB 1DVTA 1RZGA 4YZWA 4FTDA 4MFHA 3FQTB 1HL4A 5KVDL 5T1DH 1DYZA 5IHZB 4Z8FL 3HAPA 2YC1A 5ITFA 2H3NA 2CBQA 3DRTB 4JG0L 4PJFF 4P4RB 1S54A 5IZ7A 1UXWA 2A74B 4GXVH 1BLIA 1T5XA 4M7ZB 2HA1A 4BBWA 5D1QE 3K8MA 3AS1A 1G6VK 4NT6B 3NSXA 3US1A 2CWRA 3IDGA 4NQEA 2H6UA 2H6PA 3NA4A 1HN1A 3BH9B 4L4TE 1ETA1 4P2YA 3CFTA 1THAA 3NVQA 4JKLA 1AFVH 2A1WL 1P0SE 4ZAKC 4ZFFB 4ZMTA 1HQ4A 1V27A 1OARH 5FFOA 4JZOA 2DZEA 4JO4H 1ESOA 3Q7JA 3MBEC 2IDUA 4B97A 1JVOA 1UKSA 3GMPA 4NPJA 4R2GC 4N2NA 4Y2OB 3W39A 2JAFA 3ZTDC 4LCIL 2OXGB 4RSYA 3QIBD 1NLBH 1SQ2N 1AXSA 1IIIA 2R4SL 2XHNA 4N3TA 5DS8A 4P23C 5DMIL 2VZVA 3L9RA 3QARA 2NUTA 1HL9A 2E7LC 1QKZH 1ZLVH 2YPLD 5KSUA 3KBPA 2XWBA 2R0ZH 2BP0A 2HJKB 4P2OD 1BPVA 4X4XB 1DVFD 1I8LA 2HLAA 4OCSL 3S36L 3EJRA 5E24E 1BQSA 2PTTB 5E8OB 4G3YL 2F53A 4BK8A 3QUMB 4YHOH 3WHE1 5A2BA 2YD6A 1R3IH 5JQHC 1HCYA 3AB0B 5D8JH 2LT9A 2QMKA 4KK8D 1UZ6E 2CUHA 4WHTA 2FJHA 3U4KA 1T83A 3UTTE 1JYXA 5CEZD 4PJAF 4D3CL 1M7UA 1S8DB 4JDZA 4HCRL 3GINA 2AZUA 4CGUB 4I0PD 2ZSWB 4QAWA 2NXYD 2UWEA 3S37H 2UXTA 3EYQD 4YWGH 1S7TA 3RX8A 2VC2L 3O6FC 4LLMA 4X1HA 1X5KA 3UAEA 2YPLE 4KOCA 2ZP0T 3JTTA 1KTRL 1KCVH 2H0FA 3CFDA 3FQXB 5FHBL 2NRDA 3L4TA 2MCAA 4NQQA 1Y1UA 4F7PA 4BH7A 4DP8X 1TNNA 3AYNA 4FG0A 1N18A 2V2XB 2F61A 1SDYA 1GU8A 1T22A 1A4KA 4MJJA 1QRKA 3WE6B 2R4SA 2XA3A 3AT0A 5DMGC 5JOFB 2J43A 4HBCL 3ME0A 5E6IC 4KUCD 3OE6A 4CVXB 1GL4B 1UGNA 3T6QC 4Q6IB 1FLTX 4PGDA 4J6RL 3TTSA 3MRNB 3V0VA 1J9SA 1CXEA 2Q8AH 4KKCD 1NDMA 3IE4A 3VD5A 2IALA 1ZSDB 2BNUB 2WSDA 4LF3B 3RWEA 4JPVH 5D1ZA 3FRPB 1G9NL 2CO6A 5L4JA 3EXJA 3CD4A 1M0KA 3HG4A 4G7RB 1DBKL 3OAYK 4XTOA 2CMRH 1NCWL 3L3KA 3LHPL 4OGAD 2W5PA 2JE8A 3BWZA 2IH3A 4IIQC 5D7KE 2HAZA 3DO7A 4Z7OF 1UD4A 1X5MA 2VLKE 4M00A 5IHLB 1ZKAA 4KZ0A 1DLHA 1RK1A 5DWUL 3MU3A 2V5YA 3RVXC 3O2VH 2B1HL 5DRNA 4PH8A 5I82A 2HFGH 4QOKD 5TDNA 4N0CC 4L23A 3DIDA 2L0DA 1X7TA 1IM9D 5HJBA 2JTDA 3RYMA 3ZRFC 4ZS6C 2PXYA 1ACYH 4NP9A 1OGAA 4R8WL 2HFFB 4HYJA 3SIKA 3NCMA 5T5NF 3M45A 5AYQA 1CU4H 1XR8A 4JN2A 2RA1A 3BEVB 4XBMA 3ZKND 2CA4A 4DFHA 1EHLH 4B7LA 3V6OC 5FYJD 2X4OB 1LK3H 1TOXA 2NY0D 3OB0K 3VQ1C 1QLEH 3BO8B 1KYOK 2WGNB 3C6LD 1Q9LB 2UXFA 3LVEA 2DJUA 4BQBA 3X1BA 3E6HB 3TXAA 3BESR 4RGOL 1J0HA 4K3JL 1K5WA 2PW2B 1ODUA 3HNVH 5IREA 2AQ2A 2YIHA 2VQUA 1MFVA 3GXDA 1WBZB 2NZ9D 4AEHH 1FNGA 4J3UA 4WFFE 4CN4A 1V10A 5C08E 3SBQA 5TGZA 3FQUB 2R7EB 4NQCA 4L4VD 4NQCD 4HWZB 4N87A 1N26A 4OZHE 3BVNA 4Z7QB 1W80A 2WTPA 2XZCL 4NN7C 4WU7A 2X4TB 5EF1A 1LWRA 2YAFA 5CD3B 5D93C 3DETC 4JJ5A 2YBRA 2ZOLB 3NFPB 3O6FD 4BSWA 1CBVL 3PAVA 2HXAA 4OLVH 3SDXE 2PP8A 1C08B 2V2WA 3D39B 3UBXA 4N1CA 1OPOA 5C0AD 4GPOA 2NYZA 3J07A 1FZOB 1JCKA 1LTXA 1P6AB 1XWVA 2GBAA 3BEVA 3FQYA 1AO7A 3WKMH 1T2QH 4TQHA 3VXRD 4BRJA 4D9LL 4GP8B 4WUKL 2HJLB 1AYRA 1TZHA 4GKSB 5DHHA 4JPVL 1BM1A 3TO2B 4JHWH 1CYWA 2WWKT 4KKNA 4ODHH 4X5LA 3SGKA 4D0DB 4U1LB 4JO3H 3NCYS 2L7UA 2XKUA 4Q0XL 1RD6A 1AR1C 4LCCA 3ZZ1A 3ARQA 4X0KA 4MNQA 4GIOA 3KYAA 1OP5K 1R24A 4PSRA 5GGVH 2Z4QB 4L3FA 1AS6A 5DI8B 3GIZH 1KEGL 4AW4A 3PWPA 5JW3H 3FCSB 5B7EA 5B7FA 1IGCL 3ZPDA 1NWPA 3RDTC 4C4BA 5EC1A 1BW8A 1MJJA 1MIMH 1TTFA 1V3JA 2LTQC 5DHVB 4HS6B 4FJYA 1NGZB 4U0QB 3MTXA 5B6WA 1NJ9B 2VLLA 4I88A 2FB4H 2ZPKH 4UTCA 4AV5A 3F7VB 3P9WB 3S96B 4ZMYA 1TU2A 2VXVL 4B9YA 1YNKH 2GIXA 3U2SB 1LE5A 2XICA 4NS0A 4ANWA 1DUZA 3EFDL 1I8IB 1Z9SB 2L6XA 1HH9B 2NXZC 1J1XH 1I9RH 2F54D 3ARED 3MN8A 4MVBD 3ZKNC 4KJQD 1IC1A 3B34A 1I9JL 2AJYH 3HVNA 1DE4B 1OAXH 4C47A 1U8PB 2WC7A 1CG9A 3FOMA 3VFNA 4MAYC 5GGTH 3WFEH 1RZFH 1KLFA 4Q8BA 1ZCRA 3WEBA 2QKIB 3KMDA 2VDKL 4MBRA 4L4VB 2ZIYA 3H2PA 4FHKA 5F96H 2ICWA 2ADYA 4N8CH 3VRIB 4QHUB 1CE6A 2W9DH 5CCKH 3NA9L 1V7NH 1GZQA 3VVKA 1VFAA 2A6IB 1S9VB 4Q2ZB 5L2KB 5DVNA 3QJZA 2EXWC 4PJIE 3X3FH 3EOAA 2VSKB 1NLDH 2IPKB 4HWBL 4QHNA 4OZ4B 1PEZA 5FF6B 1IO4C 1SFDA 3G9AB 2YA2A 3VRJA 1Q8MA 1F4HA 5KSBF 1NMAL 4P9HC 4X8XA 2BZ7A 2CDEB 4FJZA 3VJ6A 4IW4C 3EZ8A 4N9OB 4ONGH 3MOQA 4NJ9L 4FMKA 4DO4A 2XA8L 3JXAA 4AZUA 1N0XH 3LZOA 3VD9A 5E99H 5TJWK 1T1YB 4FFWC 3REVB 3QRGL 1A5FL 5EU7E 1T7XA 3QCUH 1ONQB 1U8KA 5HYJD 5LGHL 3MODL 4PN6A 1WHOA 2CR6A 2X6MA 1ZDSA 2NY6D 2P42B 2ENPA 3OBAA 3OAXA 5FW6A 1D6VL 5E7FA 2AQ1A 2HN7A 1R47A 4ENED 4G5AA 2DWDA 2A6DA 3GEFA 4BFRA 2DEYX 1SLXA 5CGYD 5JIHA 3TCLA 2DQJL 2H3XC 3KWUA 1QFUL 2FGZA 2SODB 1HNFA 2VJ0A 3DGGB 3OXRA 3QC5X 1VPOL 4ZMNA 3VGHA 4YQXL 3AM8C 5HHOE 1EJOH 3V2WA 2JIXA 1K4DA 4JDTH 3DYOA 1OAZH 1ZHKB 3LKQA 3DXAE 3MVSA 1JK9B 1Z5LB 1MJ8L 2PCPA 4ZX4A 4JCWA 2IALB 4LF3A 3VMPA 4UNUA 3SD2A 5TE7H 1NMBH 1IKNA 3N85H 3GMRB 1YMHA 1E4KC 3REVA 4UOZA 4JREC 1KJVA 2IQAB 4APQA 1J9CT 4Q6IA 2GJZB 4Q9QL 3K1DA 1P7QA 1NANH 2CR0A 2IFGA 2W80C 3GJEA 5K9JH 4V2BA 3O45B 3OE0A 5JO5B 1XIWA 2AQSA 2O5YL 2XETA 2RFXB 1XMWA 3C5JA 5DRXB 3WXVL 4AENB 1M1XB 1PKQE 2WYZA 4FYTA 3RJDA 3SQRA 3FYEB 3V0GA 4DZBB 1IIKA 3RL1A 4K9EH 1SPDA 5AVTB 1T5KA 5E1HB 5GIRB 4JDEA 1BAFL 3FB8A 3P3TA 4Q6KA 3ZE2E 1YEFL 4F37K 2CJUH 1AJ7H 1ZA3A 2R56H 1GMIA 5TPWL 1KB5L 5A2IH 3VGAC 1RHHB 1HZHH 2JXMB 3WFCL 1WO2A 1DDTA 3HMWH 3D2TA 5DJ8B 4MQXD 3DMMB 3BXNA 4X31A 4UM9B 4WW3A 5C0AB 2Y1AA 3O11B 3V9EA 1TEFA 1P1ZA 3GO1H 3BRGC 5FUOL 5HY9A 4UQAA 4OD3H 4P5TB 4RISH 4UTAH 1W72H 1Z5HA 4GKLA 4RDQG 5J12C 3FSZA 2WJKA 1QHJA 1GGUA 2YD1A 2IANA 3KEHA 4J27A 4L37B 5CILH 5CSGA 2YSSA 4NZJA 3WFZA 1RKRA 1VFBA 1AO7D 4ZJ9A 2IAAC 2Q5BA 3IU3B 4OCWL 4YSRA 3FO2B 3O6LL 3WBDA 2Y1VA 2DQDL 3TWCL 1DL7H 4MXQC 2OMYA 3NJIA 5KVGH 5I6XB 4OCRH 4G9FE 4C59B 5IVXB 4Y2OA 4LGSB 2YRBA 4LP5A 4HVBA 3C75A 3TFKD 1DSYA 2WLLB 4FFYH 4OQTH 4ZD3H 1OEZW 1VGEL 5BPPA 3C2AL 4HH9A 4XTRC 1S2EA 1PYWA 2ERJC 1ACYL 4DH2A 1FNSL 2R1WA 1DANT 4KROB 1OF2A 1JF1A 3O11A 1HI6B 5AOJA 1DJIA 1MJ8H 5HYSA 3ULUD 1AG0A 5H2JA 5LO7A 4GKNA 4GQPH 4JQIH 4M7JL 1AI1L 1R3LA 2ZKMX 4L1DA 4ZTOH 4N2IA 4OY9A 1YZZA 1N5AA 1BFVH 1JV6A 4HSAC 4M43L 5MERB 4KRLB 2QGBA 4XO9A 1HKLH 1HEZA 2NY7L 5E9DA 2H32A 4CMMA 1F1GA 4QRQB 4DGYH 1E8ZA 3BYYA 3NQKA 2VWEE 1QSFD 5TF0A 1GHFH 1IT9L 4M5ZH 4S0TD 5JXED 2E27H 1ND0B 3V4PH 2GJRA 4FMFA 3HR5B 2KBGA 4WTXA 4WK0B 2KSYA 3BDYL 3QJTB 1KLUB 3MLSH 4XNBA 2X41A 5DHYB 1OGAD 3FQ1A 1ETZA 5KSBE 1BVZA 3E2HC 3VXPB 5EUOE 1RLWA 3H55A 4KJYA 3L7FB 1NICA 4NNXB 3LQZB 1G6RH 1I1YA 3KLKA 1YEFH 4NOBA 3JVFC 3ARZA 5E8EB 4AG4H 3O6ML 3WKNA 2FIKB 2HTKC 4CVZB 4RFEA 5FYJH 4KZDH 5T1KA 4ONHB 3APNA 5ITBH 5IQ7H 3S96A 3MNWA 2VXSL 2DTSA 5E6RB 4GKOA 3CV5A 1I1FA 3IM1A 1F90H 4EF3A 4TSAH 4U05A 5DHVA 4X6DA 1AKPA 4XRCA 4EMZA 1UXSA 2NLJA 4MNGB 1A1NA 2B59A 4X8GA 4Y1AB 3KGTA 2JCCF 3AREA 5CJOL 3N91A 5K1JA 2CNZA 1BM7A 1OCWH 4PRDA 1FAIH 3WJJA 3OF6A 4KMLB 4ZUUB 3B7UX 3GTTA 3MYJA 3QDGE 3UAJA 4WJ5A 3UJIL 4XMKL 1PAZA 4OKDA 5INCB 4DEPC 4Y4KD 4NDMA 3EG9A 4U3HA 5EOCL 1HYRC 1UYWL 4XPAL 3QXWA 3DA0A 5I6XC 4JY5L 1Y6MR 3BDBA 3VXSE 4QLWA 3QUZB 2NXYB 4FERA 2DD8H 3X14A 4F7MB 1N64L 1SLUA 2MWCA 3ARFA 4DQOH 5SWQA 4ALAC 2ZCLL 1KELL 3TBSB 3C5SA 2FIRT 1X6LA 4F7MA 1TZGL 1RUKL 2CPUA 5D7SL 2RCSL 4ZDHA 1X9QA 3BP6A 2ZUXA 3I74A 4O2CA 1P53A 3B7YA 1CIUA 2PWGA 1RXLA 2WWMC 1JXGA 1MAJA 4Z7IA 2AXHA 2B1OA 4LLWB 2E9WA 4LVEA 1OW0C 4P2OC 2AJSH 2FATH 4PJDE 1NC2A 3FT2A 1C5CL 2AK1L 1GGBH 3QJFB 1T6VN 1U8LA 3EOAB 5L8LB 1DBAH 3CZLA 1N4XL 5FUCC 1ZIAA 3IRZA 3N1FC 4KVCL 4AY0A 3H85A 5A2FA 5ANHA 4JFFA 2D7NA 4HLJA 1VACA 1SUJA 2H47C 2WXPA 3H9HB 5HP5A 3HB3C 5DR5L 4N8VG 5F7EL 4X6FB 4R90H 5CEYB 1Q9KA 1RULL 3G08B 3CZUB 4OAWB 3WUWB 4JG5A 4ATWA 5KG9A 3K71A 1NKGA 2CO7A 1F1AA 4PJFB 3WY4A 2F7PA 1RP9A 3H54A 3L3OA 2D2OA 4ZRGA 3SKOB 3VI4A 1U8PA 3FOMB 2XJLA 2J88L 1N8OE 1D5ZA 3FBKA 5T5FH 3QH3A 4XCNB 1GR7A 1CLOH 1CDJA 1HFUA 2X6UA 1GGCH 4EXKA 5FB8B 3SJVA 1IM9B 1FVEA 4L5FL 4NZTH 3RNQB 2W9DL 3SBPA 4E9LA 4FQIL 5CEZE 3HW7A 1V7NL 4WWNA 4HCFA 4OF7A 4ZTPL 2CR3A 4KNTA 4OZHF 3MROA 3UTPE 3R06B 4M29A 5G36A 3FT4A 1E4XH 3EHBD 4W9ZA 1HOCA 2AKRA 1WD9A 1MFEL 5LBGA 4F20A 2B16A 3C5ZA 3W9EA 5J1AB 3ARPA 5SX5K 3MLPA 4P5KB 2VSCA 1RUAH 5EC1B 2QADB 2VKXA 3DX6B 1A14L 5I66A 3PXLA 5FA4B 1MDAA 1I8KA 2AEIT 3N43F 5GS3A 1I8LC 4HK0B 5FV1L 2NR6C 1IQWH 3FB6B 4J3VA 4W9LC 3QJQB 3C60A 3RQ3A 4E5XA 2TSBA 4HKXA 5HHVL 3OGOE 2DWEA 5IQ9B 1HXYA 1H68A 3VFTB 3QO1B 4ACTA 4YFLF 4EIBA 2VABA 2WIIB 4UILL 1AZZC 3NACL 3TN0D 2NNFA 2CH8A 5DD6A 2Y6TE 3ALXA 5EUOB 3PP3H 2AEPL 5EO0A 2X72A 4H8QA 4AH2A 4M6OL 4XPTH 5D7KD 1H3TA 3LIUA 4JRLA 4ZFGH 3W2DH 3NFNB 3KEDA 3NRPA 4QTHA 2IGFH 3TBCA 3LDBB 4OCLC 3WE6A 3FSOA 4JFQB 5CMAA 4ZMWA 5DUPL 3REYA 1CI5A 4XXCC 3TYGH 1Y6KR 3U9WA 5CZXC 4MQTB 3MI6A 1AACA 1ZLSH 4DF9A 4F9LC 2NUPB 3HBZA 4LU5H 5DVKA 4A2HA 3ZT6A 1AKJB 1YPZA 4J3TA 2IFFH 2F2HA 3TNNB 2VISA 5TE7L 1C7SA 1L0YA 1T89A 3K5RA 4L9DA 3IDGB 5TF1L 1FIGH 2VMCA 4JPIA 4LZKA 1IE5A 4P04A 4MZ2A 1M6UA 3MMEA 1OTTC 1WTGT 5EZOH 2BNRA 5GRJH 2HFEA 3V7MA 1A6WL 4E9QA 4OJDH 3OV6A 2QVFB 1FGNL 4K3DL 1UOVA 3GK8L 4NKDA 3V4PB 2E6PA 3KPSD 3RHWK 3KJ4C 1W16A 3QORC 4NERA 5C0RL 5K69A 1KJ2B 2ALAA 2J88H 2KLTA 4Z7QE 2UUDK 2V7HB 4Z5RA 4XCCH 5JORA 3G6JA 2CKBH 4KI5E 3LNDA 3OXSA 4YJZL 1KGYE 1LILA 2PYED 4HKZA 2QFRA 1BF2A 3FONB 4S1DC 4RX4A 3STZB 3MRKB 1EAOA 5A16B 2WP3T 4ZMVA 1KWKA 3GPEA 4OR1A 2XIBA 2X53A 3TVMC 3SPJA 1HIMH 1J7VR 4ZTPH 1UH4A 2IOIA 4FQLL 3RUGA 2YD3A 4M61A 5IVXA 4PW4A 4MD0B 4WIQA 3GHEH 4I7ZC 3ZYZA 1KJ3L 4WV1A 1HEZB 3H9SD 1EBAA 3GO1L 2PXYC 4QJ3B 4XPGL 5GGUB 2AABL 5LNDA 4S0HA 2VL4A 4WI6A 1HH6B 5F1SA 3MRFB 2FBOJ 5TD4A 2X2UA 4ZXBC 1ZGLA 2VE6B 1ZHKA 2F54E 2AQRA 1A21A 3LKQB 5FFLA 3E9TA 1DQMH 1C3WA 4OIBA 5DEFA 2D3VA 1CDGA 3HPJB 5CP7B 3EOBB 4XWGL 4ZFZB 5EZIL 3DO7B 1U93B 2YLKA 1CK0H 2R29A 4M1DL 2ZWNA 1EGJL 2CIKB 2WN2A 4LKXA 5C6TL 3QS2A 2ZNWA 1XF5A 3U9UA 1HQRA 1EFXB 3D07A 3HS0A 4OCRL 4XB7A 4FL4C 4GUPB