2QPDB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 36
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpdB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpdB02
1S53A 1KBWA 3X1EA 4KLYA 1PLAA 1XB8A 2EILB 3QBIA 1IW6A 2VW6A 4EF3A 5B1KA 3JTBA 4XT1A 1WA0X 1HAUA 2UXVA 4DPAX 2DWTA 4UAHA 3TASA 4DP0X 2QT6A 2QPDB 1XMEB 3AYNA 2HX7A 1SHXA 2AZUA 2QPEB 4MQSA 1NIDA 1AZCA 1PZCA 2I21A 4TL3A 5H2NA 1ZIAA 5G2DA 5AZDA 5AFAA 5G36A 2KSYA 4JQ6A 3S8GB 1F56A 3SQRA 1H68A 2QDWA 5AX1A 4YSSA 2YCYA 4EA3A 2BP8A 3QQXA 4KO9A 3FPXA 4YSUA 2I1XA 3WI9A 5A44A 1QKOA 2GI0A 1KMEA 4A2DA 3IE9A 1GY1A 3CAPA 1JZGA 1M0KA 2XU9A 3AG2B 3CVBA 1IC0A 1HFUA 4GP4B 1E65A 2BW4A 2DWSA 5H2MA 4PCYA 1BM1A 5AZUA 1H2SA 4AMIA 2XX1A 5I6KA 4DJHA 4LDLA 4NB7A 1PCSA 1OCZB 4QLWA 1KYAA 2LNLA 1A65A 2WO3B 2DYRB 5I5MA 3OD3A 2XX0A 3FU7A 2HRHA 3TBCA 2W88A 4BXVA 1MZYA 4HAKA 5G53A 2Y1AA 2Y03A 4QIDA 1TEGA 2WO2B 2IH9A 4AI7A 2RH1A 9PCYA 1XIOA 3UACA 2KSBA 3ZX1A 4BWBA 2FWLB 2X88A 4GY4A 1AS7A 1J9SA 2VW4A 4HALA 1WS7A 4BWWA 1PY6A 3SBQA 1ASQA 1KV7A 4IAQA 3QBKA 2PPFA 2BWDA 4KOCA 1CURA 5JJNA 1GS8A 4XXJA 4E9WA 2PP9A 3GDCA 3S3BB 1IBZA 1MG3C 1N70A 1JFPA 2NTUA 4X31A 2ZIYA 3NJLA 3CG8A 4GPOA 3WG7B 5AHYA 4AKOA 3H4HA 3FQ2A 2BO0A 3FSAA 5D4IA 2PP7A 3X1NA 3FU8A 3QJVB 2MTAA 2ZZLA 3OMAB 3U25A 1C3WA 1KGYE 3GXUB 3NJHA 3UAAA 2P80A 3X3CA 3OM3B 1E30A 5DHGA 1E5YA 1QHJA 3RFMA 3AM6A 1X0K1 3ABWA 4QRYA 1BRDA 4RH4A 2HRGA 2VM4A 1LN6A 2FJSA 1E12A 1URIA 4YSOA 3VG9A 3WNJA 3X1GA 4WTQA 4GRVA 3G5WA 4BWTA 1JV7A 3QAKA 4IARA 5B2NA 2FTAA 1TEFA 5A8EA 5AKRA 4DPBX 2UX7A 1AQ8A 3UTXA 2JAGA 1PXSA 4KO5A 2BRDA 1NWPA 4F2EA 2J4YA 2H47C 3MBWB 1L9HA 1VJMA 3WNIA 5TGZA 2H5UA 3NSYA 3RZEA 2IDTA 5G2CA 3FT0A 2UXFA 1X0SA 4YSAA 3V2WA 2PPCA 4BK5C 1MDAA 2YAHA 4A67A 5H2LA 4AKPA 2YAMA 6PAZA 2VMJA 3ABLB 4E9YA 2IWKA 4FBZA 2EIMB 4Q8BA 1S8JA 2I7OA 4J4QA 1IXFA 1BAWA 1WAEA 1V54B 1WA2X 4HIPA 2Z55A 3AG1B 4G71B 5BR2A 1P8HA 1P8IA 1GSKA 1AAJA 3DKHA 1L9OA 4DP2X 1IW9A 1OE1A 3ABGA 3TBBA 1SDDA 1SFHA 4GP5B 2XV2A 1PZAA 5C1MA 3CODA 4LDEA 1BXAA 4DP9X 1W6WA 2R4RA 1RZQA 2Z73A 5G2AA 3ZEVA 1NICA 3ZDWA 4GYCA 4CSZA 5AX0A 1V55B 2XV3A 2I20A 1TN0A 5EN0A 2QDVA 3FS9A 1BRXA 3PBLA 1WS8A 1NIEA 1L9QA 2R7EB 2GC7C 2XXGA 3ERXA 5I6MA 2PCFA 1BXUA 2E86A 6PCYA 1NDTA 1RCYA 2FQGA 4DP6X 3MBVA 3HASA 3PAVA 5TK2A 4UG2A 3VW7A 1M57B 4MD2A 3DIVA 1JXFA 1T5KA 5BR5A 2CCWA 3D12B 2HPYA 3ZBMA 2XVBA 2I85A 2CUAA 1AT9A 2HLEB 4GYBA 4XTOA 2YQBA 4CSPA 2Y02A 4BEZA 3NY8A 3OE9A 1OCCB 1A3ZA 1ILSA 3FSWA 3OMNB 3QJTB 2ZFEA 2KSAA 1RKRA 2P80D 2YCWA 2AZAA 1JXGA 1ETJA 1AG0A 3OE8A 1JERA 3UABA 3H56A 2J55A 5JJJA 1NPNA 1CUOA 1PY0A 4KNFA 2ZXWB 3HAPA 1BQRA 2BP0A 2BZ7A 4YL4A 2JKWA 4UF7C 2IWFA 2YCZA 1JGJA 2GB2A 4W9ZA 4A2EA 1NIAA 1L9TA 3VI0A 2EINB 2NTWA 4W1TA 4DP7X 3ABKB 5A7EA 4QI1A 1XB6A 1KG8A 4E9VA 2PEDA 1PLBA 1AZNA 2IDSA 2NRDA 4LDOA 3QJRB 2DY2A 4KOBA 4FPDA 3ASNB 3KW8A 4BDVB 3BVDB 1JZEA 1FBBA 1AZBA 2BP8B 2L6XA 3C75A 4PAZA 2AFNA 3NSFA 4MFHA 4F2FA 5DYSA 5D4JA 8PAZA 3X3BA 3OQRA 4N8UA 2GHZA 3PXLA 3IN0A 1WA1X 2XWZA 1GU8A 4EIYA 2UXGA 2HX9A 2B3IA 1W8EA 5B1JC 3EH3B 1SHWA 2N0MA 4JKNA 3FU7B 3X1BA 5I26A 1ILUA 1AP9A 3T45A 1MGYA 3QJUB 1L9SA 3DQBA 2F93A 4N4WA 3OE6A 5TK4A 1R84A 4L35A 1I53A 5PCYA 4AMJA 1KDIA 4NAJA 3IN2A 2JAFA 4JKVA 5FJGA 2H3XC 2OV0A 2Q5BA 1KCBA 1BYOA 3FQYA 4BXSV 2PPEA 4Y9HA 1GS7A 4UHRA 1TU2A 2FNWA 1FA4A 1AZUA 3C9MA 2PPDA 4BV0A 2RACA 2YDOA 1ET7A 5B6VA 3AW5A 3QDCA 2YDVA 2HZHA 1F88A 2ZONA 2ZWNA 1X0I1 3VGAA 2XLLA 1F4ZA 3PCYA 4A66A 1S52A 4DP4X 1S54A 2TSBA 2CJ3A 1A8ZA 1CWQA 1AZRA 4WKXA 4DAJA 1JZJA 3EH4B 4Q89A 2GSMB 1OCRB 1ZIBA 2HX8A 1GW0A 3EHBB 4E9RA 1NWOA 4JR8A 3NJJA 1BQKA 1KDJA 4XT3A 3T71A 1SJMA 5F7BA 2FT8A 3VVKA 1SF5A 5B6YA 4X4KA 1XB3A 4YVNA 1GZMA 4HWLA 4F7KA 3NSBA 1UATA 1GUEA 4DPCX 2YAFA 2YXVA 4KNSA 1PAZA 2G87A 5B6XA 1R2NA 3QPKA 2YCXA 2Y00A 1HAWA 2VT4A 5B6WA 3D4SA 2WJKA 1OE3A 2VSKB 7PAZA 5IY5B 1A4AA 1CC3A 1ID2A 5B7FA 2CAKA 2X87A 2EIKB 3FU9A 5F7AA 4YSPA 5I6OA 3ZPQA 3NJFA 2I35A 3PAUA 1TN5A 1AOZA 2OCCB 5J7AA 3NY9A 2BW5A 1PXRA 4E9XA 4YSEA 3FSVA 1X9UA 2OJ1A 3AY2A 5H2PA 1MZZA 3NYKA 3UADA 1QHQA 4BWUA 4BUOA 1JVLA 4HZ1A 5H2OA 1BEXA 3FYIB 3PAZA 4UANA 1IKOP 2IDQA 4E9QA 3NJIA 1OF0A 4K5YA 2VN3A 5B0WA 3N2JA 3EF4A 1W6LA 2PPAA 3OAXA 2J57A 3N55A 1ASPA 3CVDA 1M0MA 1J9TA 4A2GA 5EHFA 1QM8A 5B7EA 4IB4A 3NSDA 1BXVA 5I6PA 4AKQA 2J5WA 5A45A 5I5IA 4A4MA 2KS9A 1SDDB 1JV6A 3A7KA 4WAVA 5H2IA 2UXTA 3T6XA 1C8SA 5LWEA 1A4CA 2MRYA 3AZUA 1NIBA 4WW3A 3UZCA 1M9WA 2VSMB 3CVCA 2HXAA 3ZPRA 3FSZA 2TSAA 4YVUA 3RYMA 1MG2C 5D4HA 4G7RB 3SN6R 1OOWA 2JXMA 5ANHA 5E9NA 3C9LA 4PXKA 3QAPA 5B6ZA 2Q9OA 3QJQB 4A2FA 1AACA 1NTDA 4DP1X 2FQDA 3HAOA 1ASOA 1BQ5A 3NP3A 1QLEB 5ITEA 4HYXA 1HZXA 1P8UA 3CDZB 1CYWA 1DZ0A 3NP4A 3PDSA 1X9RA 3IEAA 1L9RA 3QBGA 3AG4B 3PLYA 3V9CA 4KO6A 4HCFA 1ET8A 3COCA 1JOIA 1QNIA 1XJIA 4YSRA 4N4YB 1PNCA 3ZIYA 1J5CA 1A4BA 1EHKB 1J5DA 1NZRA 5JJEA 4YSTA 1Q5JA 5B1BB 4DKLA 1J9RA 3HAQA 2IWEA 2ZOOA 4NERA 3PWHA 1NINA 1Q5IA 1AANA 3TA4D 1CYXA 2EI4A 1PNDA 4KNUA 1BRRA 5H2JA 5ETZA 3V2YA 2IAAC 1GY2A 3WQJA 4E9TA 5AHZA 2R4SA 4HHWA 4FA7B 3PQRA 1OE2A 2J56A 4G70B 4N6HA 1FBKA 5F8UA 2YAEA 4L6RA 1FWXA 2BWIA 1FFTB 1KCWA 4HCIA 2F95A 3S3DB 3L45A 2BP0B 2Y01A 1ADWA 4BDVA 1TKWA 5H2KA 3NS0A 4MBSA 1RZPA 2YAPA 3UONA 3CZUB 3JT2A 3PXOA 5H2HA 2PCYA 1O0AA 4GXFA 1JXDA 3REYA 1ZDQA 5I28A 1ET5A 1F50A 4MD1A 3T6WA 2B08A 4A68A 1GYCA 5B3SB 1EZLA 2FQFA 3EH5B 4GP8B 4KO7A 4QKTA 3T6ZA 3WIAA 1NPJA 5B7MA 2YAQA 2AANA 4BVNA 4DP5X 1J9QA 1ZV2A 2XXFA 1JVOA 1KG9A 3ODUA 3NJKA 1IUZA 1PZBA 5B1JA 1JZFA 2AVFA 5B1AB 2M3GA 3H4FA 3DDLA 2X72A 3UZAA 4OV0A 2UX6A 1E5ZA 1VLXA 3MX0B 1AIZA 4P5SA 7PCYA 1NIFA 3OMIB 5G28A 2FT6A 2IDFA 3GYRA 3HB3B 3HEIB 3T6VA 4E9SA 3S8FB 3UG9A 1UAZA 3ASOB 1SF3A 2JFCA 2Y69B 4A2HA 4KNTA 4L0PB 1AS6A 2PLTA 4HYJA 2CALA 1DZEA 5I6NA 1BYPA 5ITCA 2GC4C 3BQVA 3UAEA 3FQ1A 3QBLA 3HARA 3PPSA 4MQTA 3OE0A 5I6LA 3P0GA 2LLNA 5AWZA 1GS6X 2IH8A 2CBPA 3UTWA 2WSDA 5DHHA 3VHZA 3NJNA 4M3HA 5FC9A 1KBVA 1VGOA 3SBPA 2AT9A 3V9EA 1M56B 1U19A 1YLBB 1DYZA 2IDUA 5I5JA 3FYEB 2VW7A 3NT0A 3NYAA 3QJSB 4G7QB 2A3TA 1R1CA 4ZK8A 3TU6A 3EMLA 1PLCA 1ZPUA 1S51A 1SFDA 4M4RB 1S8LA 3AYMA 1E67A 1JZIA 3UTYA 1KGBA 1L9PA 2GIMA 4JHVA 4X32A 4AZUA 4TXVB 2I7SA 1AS8A 4YSQA 4YSCA 4GBRA 5B35A 3FPYA 1L0MA 4NC3A 1OV8A 1ZDSA 1V10A 2PP8A 3KJ6A 4JHUA 3KW7A 3ABMB 2DYSB 1JZHA 2XUWA 1B3IA 3T9WA 1N68A 4G7SB 3X1FA 4AX3A 3SBRA 2GBAA 5G54A 5B34A 3X2QB 2FT7A 2DV6A 4X1HA 3UTVA 1IBYA 2BHFA 3NSCA 2YAOA 4HHGA 3HANA 4ENZA 2BZCA 2WJLA 1M0LA 2Y04A 4K9JA 3DTUB 3IBOA 5KKHA 2R7EA 2W8CA 2FQEA 2XV0A 1AG6A 3UGEA 2XYBA 4BEYA 4YSDA 4G72B 2YARA 5PAZA 1GR7A 4DP8X 1C8RA 1SNRA 3NJMA 4EJ4A 4P5RA 3WKQA 2EIJB 4XTLA 1UCQA 2YXWA 4XTNA 4PXFA 5LDUA 3WKPA 1QKPA 3S3CB 1OCOB 4HCGA 1E0PA 1PMYA 2VM3A 3CDZA 4FAAB 1PF3A 1AR1B 3AG3B 3NJGA
chains in the Genus database with same CATH superfamily
4Y1AD 2QLYA 1FZKB 1SLVA 2YD6A 1D5ZB 2VC2L 1G7IA 1ND0A 1RUKH 5KS9E 4S0HA 3JTBA 4JFWA 4AY0A 2C9XA 4MJIE 5MEPB 1U8HA 2ZSWA 3KXFD 1E8XA 1IC5L 3C6LA 1FLRH 4GRLC 1UGNA 1IB5A 2F8IA 2CHNA 2NYZA 4HV8B 5E2UH 4EDXA 4DKAA 3QJOA 1LM8V 5G36A 4JB9H 2K78A 4KZEL 2YUXA 3MRFB 3GI8H 3PQYD 3O0LA 2XA3A 3ZJAA 2X4NB 3TIEB 3EKCA 1WFMA 2DWSA 3OJ2C 5E8DH 3GMMB 3TURA 2NNAB 3KM2A 4P2AA 2D4DA 3DX3A 4C56B 2UWEB 2VITB 4DJHA 2W65B 1KY7A 2VXTL 4F15C 4PSPA 3D50A 4QRUA 1KYAA 3F7QA 5HGHA 3UC0H 4AOFA 1LEIA 2FWOB 3CFJB 1UEMA 2WUBL 2X4RA 2ZKYA 4QRPE 2VQ1A 1MZYA 2F1BA 3MODL 2Y7NA 4RGNB 1CMOA 1T3FA 3G6JE 1KXTA 3IWVA 3B2UC 1Q9KB 2B16A 2FJGA 3RIAK 4F57H 4H8VA 5EZJA 3AM8A 4Y89A 4F9LC 3TNNB 2HT3C 2JIXB 2YOAA 5F9AC 5KBLA 2E9IA 1KACB 1P7KA 2BVPA 1MG3C 3PWPE 3LH8A 3O3AA 1ZK5A 3X3GL 5I19H 3HUJF 2V2WB 3F7YB 5DHDA 3JYCA 3ME0B 3HFMH 4MB3A 4JPSA 1BD2D 1KB5A 4GAJH 4N68A 1RK0A 4H1LB 3T0WA 2E7LA 1HSBA 2HCZX 2FBOJ 1TZOA 3D2UA 1QHJA 4TM9A 1CTOA 1I4FA 1THAA 3L9EA 3MSPA 2ZOLB 1LNUA 3OKMB 4K9EC 3BZ4B 4ZS6D 1OP5K 4ODTH 3X1GA 5JDSA 1BZ7B 1FF5A 3RL2B 3WL9A 5D6CB 4WSGA 4FZEH 2OTWA 1K5NA 2X09A 3IKCA 1OZUA 2KZ1B 1DQJA 1P4BL 1X5FA 1R3IL 2B9AA 4L4TB 2X5PA 5E1HB 2H47C 4FI8A 3OWRA 2HH0H 5JPNA 2UYLA 4IRSA 1J1PL 3FT0A 4FP8H 2YFOA 1BEYL 1CK0H 1MCBA 4NCDA 4QRTB 4NAMA 3ILEA 3EYQD 3RNQA 4IKIA 1KTKE 4OW6A 1FAIL 3DI3B 4DFHA 3L1EA 5I0ZA 1RERA 1P84K 2AEQL 3MGTA 4WI3A 1IXFA 3ZKNC 2W81C 3LQAL 4D0CA 1S5IH 3QHZH 1SYVA 1YEHH 2AEOA 4GUQA 4FNUA 3WJLC 3WMPA 4QRFA 1KBGH 2VZ1A 1AAJA 3CMGA 3EOTH 1F11A 3L3OB 1G9NL 1UH3A 1NAKH 1SJHB 4YBQD 5CSZA 1ZVHA 3H9HB 2XY2A 5D1XE 3HRPA 1Z9LA 5DQJA 3VFVA 3VFTA 4PRPD 1RZQA 2ZYHA 1KXHA 3D08A 4RMTA 5DMIH 4MBOA 3RJQB 4JO3L 1UVQB 2GC7C 3WIHA 1NMBL 1KY6A 4J3OH 1AQKL 2DD8H 4IMLB 1NLBH 5FYKD 3U0TB 1MFCH 2ZF9A 5ISZA 4JGNA 5A2KH 5GQBA 4DNLA 2EUVA 1S7RB 2GBVA 4LLMB 4YL9A 1QG3A 3AWEA 5T8IA 3ZUNC 3TF4A 1KB9K 1YCSA 3O9WD 3QVAA 3GXMA 4M43L 4UV7L 2X1WL 3JWNG 5EIIG 3RRQA 9CGTA 4AL8C 4N8VG 4AVHA 5ESVB 4D9LH 4DGIH 1W8NA 1HILB 1WISA 2BSSB 2E0PA 3MRJB 4PYHA 4CMMB 1M9SA 2C3VB 3J27A 4TQIA 2E7MA 5JORB 2P24A 3A21A 1N3NB 1ZY9A 3LPWA 4S0SD 4UAOC 3GMNB 4HCRL 4X6CE 1EZSA 1KEML 3LRHA 1Z6JT 1MJ8H 4FEMA 3HAPA 2JKWA 1B4RA 1H19A 2P4AB 3B2DC 5EIQA 1C7TA 4XPHH 4Q9QL 2NNAA 3K4DA 4C56A 5CFHA 4FABH 1U8CB 1WT5C 1J48A 2VITA 2NRDA 3CU7A 3RGHA 1XGYL 4I1NB 5C09B 5JZ7C 4FPDA 1XGTB 3BCDA 5FGCB 15C8H 1IQWL 2ZXEB 4CW1A 4IIQB 2SODB 4AUYA 4Z7UE 3D3VD 3RIKA 2R9HD 5F8QC 3T0AA 1IRAY 2A74C 3D52A 3BPNB 4F8TA 5HD8C 3DURA 2BX5A 4W6XB 5F9OH 5F0PB 5BUGA 1XIWA 1WA1X 2XWZA 3WD5H 4GKSB 2K4WA 1OKEA 2B3IA 5C0AA 2N0MA 4B95C 1Q9WB 3K4AA 3PWVB 4HJGA 3O6LH 4OCYH 3GSWA 3WNLA 1DLHB 5E2VL 3JXAA 2XN9E 3QWRA 2V6HA 1KPRB 3IDIA 4L8CA 3FO2B 2KLRA 4N90D 4CGUB 3F7YA 4G9DA 4MWFA 3S35X 2EDDA 1QRKA 1PZDA 1AGCA 1KIQA 1LQBC 4FNRA 3HC4H 5L2JA 1TU2A 3TCXA 3QIWC 5HHME 2Z0BA 4O02L 4M6OL 4Y1AB 2YDOA 3NAAL 1UASA 3E8UL 3OHMB 5AOMA 3VGAA 4A66A 5AVZB 4YHYC 2BNUB 3KXFB 5HHXL 2JKTM 4HD5A 3QCTL 2R2EB 1OT2A 2COVD 3DUUB 4OVVA 4X6DF 4ELKA 2KDGA 3RL2A 1I1AA 1FPTH 2G4GA 5IB2A 3RNKB 4XXDB 4XT3A 2BHZA 2ZUWA 4N1EA 2YA0A 2R1YB 3LKQA 1FZOB 3CZLA 4GJTB 4J39A 3PQYB 4JKKA 4LARH 4G80B 1C5DB 1KULA 4EKJA 2ORBL 4KNSA 5IGXH 2G87A 2DAVA 4FHBD 4ZW8A 4I18B 4QRTA 2W94A 1LGVA 2C7UA 3HR5A 5HY9B 2ERJB 1A9BB 1N5AB 2E6PA 1NAML 4LCCC 3NIFE 3UTTB 3F7RA 3MLUH 3V79C 4XMLL 3FUJA 3R19A 1G9NC 4J2XA 1RULH 4ONFL 3VNYA 2OJ1A 3ALPA 1KPUB 3UADA 4HS6B 4JJ5B 1ADQH 5H2OA 3FB8A 4ZSOB 3FYIB 2KZKA 3NRQA 1KLUB 4RMVA 3UZVB 5IJKC 5BV7B 1ETZB 5IQOA 4X50A 2JB5H 2YA1A 4TMPA 2VIRA 3FB7A 5BJTA 2CBMA 4BFFA 3SE3A 3MJ7B 1XGPB 1NSNL 2DF3A 3OLDA 5D7KE 4K8RL 4IMLA 2H1LM 3U0TA 4AEFA 1DANU 3LKNB 1S7RA 1UH2A 1X4ZA 4BCYA 1BD2B 3MJWA 3AXHA 1K8DB 3EDEA 3ESOA 4IKJA 5D1QA 1Z3RA 2DQDH 3EJQA 3N1QC 1QLRA 2PCFB 4JFXA 4PJEE 3W0WA 5SWSE 4IU3B 4PJHF 3IU3B 3CHSA 4JL2A 1SY6A 3VXPB 4XT1C 3VI4A 12E8H 3AVEA 3NP4A 4FL4C 3GO1L 3PE9A 4X6EA 5F7KC 2XZQH 4OJYA 4CMMA 2H0EA 3V9CA 2CK2A 2E7HA 3COCA 4N4YB 1T1WA 3C6EA 3GMNA 2Z92B 2ZOOA 5DHVH 5C8JA 1WHPA 5KS9A 3FUEA 2VL5A 4HK3N 4E9TA 5DK0B 4MJIA 5DC4B 4CU8A 3SGDI 4ZT1A 4ZQKB 4IKLA 4XC1H 4Z8FL 2FZ3A 2YD1A 1U8CA 4H1LG 1XH3B 1MDTA 2NYYC 3S3DB 2X28A 3F12B 5HGBA 1TPXC 3WKYA 5E6IC 1ZLUH 1WZAA 4UCFA 1K9TA 3U2IA 4L1TA 5EF1A 2BSRB 1DBKL 4AV5A 4PG9B 3O81A 2KC0A 4MXWL 4XNYL 3ES6B 1UZ6E 1JD9A 3FQWB 3LN4B 4KMTH 3RG1C 1HZHL 1I9JL 1WBXA 4BEIA 4PRIA 1OP4A 3GSOB 4KO7A 1JPGB 4PRPB 5CN2A 5DXWA 4R9HA 5F1KC 3NEEA 1SEQH 4HIXH 4IBYA 3U1QA 3NH7L 1IM9A 1JVOA 1AD0B 4OV6F 4U2YA 1DQIA 1KPRA 3BSGA 4G6AC 1DUZB 4IOIB 2H32A 4RMWA 3A6CL 5IMKB 2NR6D 1VZHA 3G6JA 1XH2A 2P47B 1A6WH 1U6AH 2VMCA 3M1OA 2R0LL 3GJFH 3OMIB 2IDFA 3SGKC 3BC9A 5EU6D 2R23A 3OSKA 4I8DA 2CCLA 2OMUB 3O9WB 1SF3A 2CO6A 3CPLA 1GSMA 5BOJA 1GGCH 5T5FA 4HEME 4X6DB 1M4KA 4FFZL 2J8UF 4OR1A 3PWPA 2I32A 1I82A 4FGMA 4CVXA 4PTTB 3ZUCA 4LEXH 3H42L 5C71A 2E27H 4MQTA 2LLNA 5GRVK 5B3JE 3CSBA 1M05A 3MRIB 4HWBL 1F4WL 5GGTL 2OQJA 2VDKH 1CXKA 4Z3TA 2IDUA 1MRCH 1FNSH 3F84A 3SQBA 3VTTA 5AAWA 3LOWA 3RI5K 3PQYA 1F8TH 2VLRD 3I6GB 1IGFH 3K72B 2YHGA 4WNQB 5D7IE 1XH0A 2A9AA 2NDFA 1YY9D 3HCVA 5D1ZI 5EN2A 3ZKMD 4JHVA 5E8EB 1WJ3A 3L4ZA 1YEKH 2CR3A 1A9BA 1S7VB 4G8EA 3IS1X 4Q74A 1SVBA 2EEBA 4BGDA 4OZ4A 1CLOL 1J8HD 3BQUB 3D3VB 3LEYH 5IK3B 3X1FA 5TQ0L 4G7SB 4AX3A 5K9JH 1Q9OA 1A6AB 1BF8A 1H9DA 3S5YA 5GZOC 1K85A 3QJFA 4Y88A 2Y23A 5KSUB 3I85A 1SXAA 1HHJB 1HEJC 1SOSA 3KVPA 3IBOA 3GHPA 1MHPL 4HH8A 2BSTA 4HLJA 3QEGH 1OTSC 1DVXA 1FBIH 1EO8L 3QUMB 4K8RC 1UEYA 3X3FL 5T1JA 3S37X 3UO1H 5DZJA 4MS8D 4YBLC 1N6QL 3QXAB 4PJHB 4L3EE 1SNRA 3MNWA 3Q0HA 2VB5A 3WKQA 2EIJB 2YZ8A 4APQB 5F0MB 3HR6A 3JV6A 1MCWM 3P30L 1WUNT 2VLRE 1AXTH 1P53A 5HI3D 1AD9B 2IVFC 4XVJL 1QA9B 3VXPA 5DSCB 3T2LA 2VXVL 3CZFB 4YHMH 2WQAA 1NDGA 1ZRUA 4OD3L 4XWOD 5FX3A 1VFAA 2DQCH 4PUBL 2LTQC 2DM4A 2Z92A 4Z7OF 5GRUL 5C6TH 4NO5B 3P4MB 5E9DD 1J8HE 4GRWF 4A38A 2V7NA 2FBJL 4P4RB 1XMEB 4ZMLA 1Q0YL 2NQDA 1GMEA 5J11B 5AG8A 4E68A 4WI4A 4ZW5A 3VD9A 1PD6A 1SLUA 3S36L 3R06A 1TF4A 5D9SB 1XH3A 2I27N 3EH1A 3FPXA 1FFOB 3ARFD 4QXUH 4A2DA 4X6CA 4M7LL 1ZLSH 2F58H 3TA3D 1JZGA 3LDBC 1Q0EA 3JBG7 4LNRA 1JPSL 5JA8B 4AQ8A 2C7FA 3EJSA 4OSUH 5DJYB 1BM1A 5SWZE 3WTWA 1ED3A 4NWUL 3LRSB 5DK2A 4OZFA 3WS6C 2VC2H 1OCZB 1FN4A 4MJHA 3FQWA 4R97C 3KWXA 4P4KD 1QASA 3CHOA 4HFWB 5F21B 1IC5H 1FO0L 1TEGA 4PRPA 2EKSA 3DGDA 1JPGA 5GHWH 4BWBA 3TYFB 1QBML 3W3BA 4CRPA 4Z7UA 4BWWA 3L1OL 2QBWA 1VERA 4KZEH 4LIQH 2WV3A 1XF3A 1DUZA 3U2SB 2AITA 3G5XB 4PTUA 3OC8A 5ID1B 3IMVA 2J8UB 5FA4A 3EO0B 2YSSA 3PL6B 4ANUA 2NTUA 1E4XI 3QARA 4DEWA 3CG8A 1MFBH 4GPOA 5E9DE 3UBXB 2VXTH 2BIQA 2CBQA 4G11A 2VISA 1CBJA 2MTAA 2JH2A 3SBWC 2AMGA 4HLEA 1C3WA 3NJHA 4N8CL 4POUB 1O0VA 1T5WB 2APWA 3GZPA 3L2NA 4I0PB 5DRXB 1NGPH 4CNIB 4WWKA 3LNEA 4GAYA 2EIBA 3M1BB 4PRAA 3ZTNL 1KV3A 2PW1B 4R8WL 2CR6A 2H2PC 4Y2LA 4JANB 3K72A 5K9KB 1BMGA 1HKLH 2J6WA 3X3GH 2BRDA 1Q8MA 1NWPA 3E9TA 5E1GA 1SMOA 1XZ0A 2WTOA 5G2CA 1MCHA 3IJYA 2O6EA 4MXQC 3IGKA 1A6VH 1H3VA 4FKHA 3O8XD 3D3VA 5IK3A 2C1PB 1ZKAA 3D0VB 3O2DL 3OWEA 3VQ1C 2H1PL 2VH5L 5I75B 3H55A 4JY4B 4AQEB 2I69A 3S3JA 4S1RL 4P0DA 4WEEA 2K4AA 3TH2T 2Z31D 4LPYA 4BHUA 5KW9L 1P4BH 3ZEVA 3MOQA 1FGVH 2XV3A 3HLAB 4L0YA 1CDIA 4PRBA 5DZLA 3HIZA 2J73A 5EZOH 2R7EB 1BEYH 5EU6B 2QTVA 2WXLA 4P5TB 4DP6X 3SCMB 3QZOA 3U0PA 3MUJA 3QZBA 2MQ3A 2AXGA 2AEQH 2E56A 3I6KB 3S36X 1NDMA 1AD9A 1RHFA 3BX7C 1I9RH 3LQAH 5DZNA 4ZX5A 4FA6A 5EEVA 2HPYA 1KPVB 3LEVH 2VWEC 3T0EB 1ZJAA 2EEXA 2EACA 4HBCH 2VN6A 1A3ZA 2UUDH 2OMYB 5DJZA 1EGJA 3P4MA 5B38A 1Z9NA 1PSKL 5IROD 4PJEA 3VVWA 2DEWX 3ARDA 5HDBF 4YFLI 5SWSA 4GSRA 4JO3H 3WO4B 3FW6A 5BUAA 4P99A 4G5AA 5JOFA 1NMBH 3DGCR 1MJJB 1AQKH 1ECYA 1RPKA 2BMKA 4B97A 5IFHL 1KNOA 3D4YA 5IW6B 4Z1PA 5JIQA 2DMCA 4GW4A 3TM6A 5M95B 2J5LC 1J5IA 5DJYA 4M43H 3ZQXA 5I74C 1BMZA 4IBQA 3IXAA 4YLCA 4ADGA 3BHBB 2XWJB 2JJUA 3A4FA 1XSJA 1FCGA 4LGSB 4U6YA 2BP8B 3VXOB 3SPHA 1AKJD 3QR2A 4R2GD 5CM1A 5EORH 1H6FA 1E3XA 5DYSA 4ONOA 4KXZH 3UTQB 1FIGL 1GYVA 1MUJA 3CH1B 1YHPA 3WKMH 1NFIB 4GMTH 2ADJB 1TMCB 1YN6B 1SHWA 2X1XR 4UM9D 3X1BA 2ZSVB 3QRLA 1A22B 3SSGA 4QPEA 3U6XA 4U31A 3QUXD 3R1GH 2F93A 1P4IL 5KTEL 1FNGA 4L29A 3WEOA 4BKLB 1I53A 2CR0A 2C9VA 1WWWX 2G3MA 5KSVA 1JI1A 3ELQA 4IBSA 1ZVSB 1HYSD 1KOAA 3HPLA 5FW7A 4JPIB 2IGTA 4W81A 4UB0L 2R8SL 4Y9HA 4GKLA 5AW0B 1YMHB 3F2LA 4RRPA 1KB5L 4RGMC 5B6VA 2EYRB 1T5WA 2N3JA 3NFNA 4JQVC 5CU5A 5D7SL 5T3ZD 1R3KA 3PHAA 3KWWB 3M1BA 2V2TA 1T20B 5EBLA 4CMHB 1F6AB 1KJMA 5JIIA 1XR9A 3BE1L 3FXIC 3KYOB 4FTDA 5AZ2L 4X4XB 4GUPA 5A2CA 4Z7NB 4ZMNA 3KGUA 1JGUL 3ARFB 4AYBA 1AE6L 3TA3B 5F7HA 2FIKB 2OM5A 4JFTA 4O02H 5I1LB 3LRLA 2C1PA 2N0KA 2K9UA 2NPLX 3NAAH 1NBVL 7PAZA 3D0VA 2NY5L 4U2ZA 2KI6A 3OMZA 4ES9A 4PREA 5D7IA 3RIFF 2L8AA 4PRHD 4YSPA 3ULVF 5CSBA 3NPSB 1GMIA 1MAML 1PY9A 3MRPB 1WTGT 4JY4A 4J7RA 2I35A 3QIBC 5CO1A 5HHXH 2GTWB 3QCTH 4U0RB 4Z77B 2IPKB 1TTUA 4WEBH 2EE0A 1JIBA 3NY9A 3O4LB 1EVUA 2EO9A 2AP2A 1MJ7L 1NC4A 3D30A 3HHSA 3CN3A 5EUKB 4FLOA 3BSZL 2QQNL 1YMMD 1L9NA 2R29L 2NR6A 5E5MA 1V27A 1N0XH 1JZ8A 4L9LB 4ZOEA 2VO5A 4KMLB 2JQAA 3MVSA 1BXVA 2PTTA 1G7PA 4L8SC 5A45A 5EU6A 43CAB 3GTTA 1P0SE 4RQQB 1IBHA 4DKDC 1NCAL 4HPHA 1AVAA 2KPWA 4N0FA 1NAMH 2ATPB 4OCRL 3I6KA 1MG2C 1V3MA 2X9YA 2KZWA 1T89A 4DKTA 4HMCA 2Q9OA 4A2FA 3JV0A 2CGZA 1IGMH 3ARSA 1NC2A 1KTDA 2LVEA 5HDBB 1BX2A 2BSED 5CGTA 3LSOA 3VDBA 1AFVL 1GCFA 4UQ2B 3SY0A 1U8PA 4ZXBB 4G6JL 1BZ8A 3P4NB 3QUZB 4X9YA 2VLRA 3D06A 3AU1A 5EZIL 4YSRA 1TXKA 1XJIA 2FEEI 1H3GA 4G59C 4K23H 1A14L 6FABL 2A6DA 4IQHA 1NSNH 2FH8A 4AIZA 1MWAA 1DUYB 3TEYA 3UBXG 3GSNB 4WJ5B 2ZZUT 5C9JB 3FRPA 4QJ5B 3ZGHA 1J8HA 5CU9A 1F18A 3FT3B 2FJFA 1UCBL 1GC1L 3UJTL 3G6AA 3C8KA 4WDIA 2BOBB 3NS0A 1BVZA 1A5FL 4LPTA 3S4SB 3QUHA 1TO4A 1NBYB 2EDRA 3VNZA 5IVXF 4FG6D 3UTQA 2I9LB 1LTXA 4UT6A 1PBYA 5LG6A 2NXYC 2Z31B 1NFIA 1YN6A 4LASH 1B6DA 1ORQA 2AKRA 3AM8C 3RWEB 3MLZL 4PJBE 5IJVB 3QYMA 4J5VA 1LWJA 1CJYA 5F3FA 1QOKA 2P3YA 3FQNA 2YD2A 4GKZA 2GITA 2QVIA 4HQQL 4WHCA 4S11A 5DUPL 4JPIA 3RUGF 2A77H 2SEBA 3WE6A 1DBKH 3L95B 2E7LC 3ASOB 3STLB 3U7YH 1R5WB 1DBAL 4NI6A 4XNYH 1WHOA 5TE6L 2ZKMX 1C1EL 3L17A 5INCA 5ITCA 3KWWA 4JRXB 4UOW1 4ZZFA 5E9DA 2WPGA 2EJ1A 5HYJE 4X5QA 4YAQB 4HIJA 5JQIB 2CBPA 3IVKA 5GS1A 1J11A 2LQRA 4WU7A 1M56B 4GSUA 3MRDB 35C8H 2ICEB 1AGDA 2HRLA 1QNZH 2X41A 1BFSA 4H20L 3A6CH 3Q2VA 5BMFH 4FXKA 3BZEA 3O0RH 5CLYA 3BPCA 4HOXA 1NM4A 3TA3A 5JPNC 4LSUH 1C7SA 3UCQA 4LCIL 5I1LA 2NY5C 1RH8A 2WCPA 4E0RB 5B35A 3Q9PA 4PPTA 1I8IA 4FFZH 4MCYA 4NO3B 2HJKA 4X7FC 3KJ6A 1HI6B 1KIRB 3A3YB 4L37B 4P4KA 5F0JB 4R2GB 2ALWA 2XUWA 2BIOA 4LLVA 4W6WB 4B7LA 3DRQB 2IPKA 2I9TA 3OLEA 4TNFA 3RTQD 3GSVB 2FT7A 4L1HA 2V5TA 4A7SA 1BZ9A 4HWBH 1INEL 5L8KB 1F4WH 5GGTH 5I1GL 3UTVA 1VENA 3NSCA 1J87A 3V0GA 3HANA 4HXBH 4BD4A 4UM9B 1QR1A 2P43B 2WVSA 3DTUB 2BOCB 2W8CA 3MNVA 3NUKA 3QUXB 3C5SB 2A4EA 4M8RA 4GW1A 43CAA 1DVFD 3FRPG 4FQLL 1CYGA 1H6TA 1JGEA 1O7DC 4OLEA 2IDCA 2HWZL 1NOFA 5GGUB 1R75A 1LEGA 3GK8H 1IV8A 5CEZL 3V6ZB 1CLOH 4L2YA 1EUTA 1PJWA 1Y7VA 4XVSH 3S96A 5TQ0H 1M1SA 1S7XA 1GGIL 2MNWA 4TNVK 3SB3A 3MV8E 5I1EL 4HCGA 2JCCF 1DDHB 3EBAA 1JPEA 3WTYA 3O3EB 5IEKB 2NUPA 1OOAA 2IC2A 1AP2A 2E7DA 3W56A 1GYUA 3QBIA 1THCA 1MHPH 1N8ZA 5F7UA 1F00I 2DQ6A 4M7KH 4DCQA 1EO8H 1KGXA 1TITA 3BVNB 2X38A 3KPPA 1ETB1 2Q8BL 1M6UA 3EYSL 3S0PA 4CVZA 2MNUA 5JIMA 3INUH 4M93B 2P49B 4ACPA 2IF7A 5ESAB 3EO9L 1P1VA 1KJ3L 2JV6A 2X6BA 4F9PA 5HXMA 5J4MA 4A7QA 1KZYA 3O8XA 4KK5C 3WGUB 5IVXB 4CVUA 4HW6A 3HE6D 1T1ZB 4PRHB 1TJXA 3ZT5A 4GP4B 3TT3L 2A0LC 3CHPA 4GQPH 5AZUA 4AT6A 4AGOA 4FQQB 3WSQL 1UWYA 3DOHA 5EEWA 3FB6A 4PUBH 2VTFA 5GRUH 1XIWC 3HW7A 3FO9B 2Z31A 3N85L 1KN4L 1JHTA 5DDHA 4NENA 1YMMB 2VR7A 3PFQA 1KCRL 3RUGB 4I3RL 3BDYH 1QRND 1F90H 3OXSA 3S36H 2UZIL 1L6XA 2PPFA 1EXHA 2Y06L 1U2CA 4PIRF 1G87A 4DHLA 3MXWH 3NCYP 3OPZL 3CHQA 4FFWD 5CMAA 5T3XD 3KPTA 3PNWA 3O6MH 5IHZA 4NWUH 1I8MB 1R5WA 3TBWB 4PJAE 3DMMD 2BWQA 5FA3B 4N0CD 5ACZB 4BFBD 1EJFA 5GSRB 2ZWZA 3CX2A 3VGAC 2WXFA 3U25A 3ZE2F 1RJYB 2OMTB 2ZICA 2YD0A 4JCLA 3VFNB 1PLGL 5F3BB 1FO0H 1AQDB 3O45A 5IROA 1X6NA 4YAQA 3BWUC 2QLVB 4CKQA 4RISL 3KLHD 3IGAA 5KYYB 1N4XL 1QBMH 1I1AC 3L1OH 2HRGA 4KJQC 4UQDA 4XNBA 2FJSA 3OB0K 5EO1A 1Z5HA 2CD0A 4PS7A 3ISYA 4ICXA 4TVPD 3BFWA 4PJCF 5I6XB 3K71B 2OZ4H 3QXVA 4PYGA 3PGFL 4XMPL 1NCWL 4M03A 2Y1VA 3KPOA 5DWUL 5JOPD 1R4XA 3VXUD 2VDOL 3RWIA 2AJZB 2J4YA 1ZWIB 2ADGA 5FB8B 1RUQL 2XWTB 4IK6A 4W9KC 3M8OH 3QJHA 4XBMA 4DTGH 4NQDB 3HNTH 4N8CH 1AKJA 1UWXK 4OLZL 4JL1A 1I8UA 3V8OA 2WIIB 1A9EB 1AHWA 2ZXAA 3JTSB 4G6FB 1J5OH 3VDCA 5DD0L 5JHDD 3WS3B 2WLIB 1TTRA 3ZTNH 4P5MB 2DQUL 1S2EA 4WK0B 2HT2D 4R8WH 3B9EA 3LZFL 4Y5VA 1SJEA 4YFEA 2C3GA 1S9WB 3ABGA 1MF2L 3I74A 3DETD 5DT1L 3SE3C 2YSTA 1BXAA 1SJVA 3IWUA 2R2BB 2PR4H 4NYLA 1V55B 4QY8B 4PJDF 1PKOA 1TYJA 2JCCB 1WWBX 2K45A 3V6ZA 3F7PC 5D1QC 2RMNA 5TF0A 5C08D 4PR5B 3S4SG 3BAJA 3O2DH 3VW7A 2GIYA 4PD4J 4QOKD 4RBPK 1BP3B 3E8VA 3Q8CA 3OTTA 2VH5H 1VGKB 5D70L 3NGBB 2G5UA 3O3EA 3VMNA 2B59A 4BQ9A 3SO3B 4S1RH 5CBEB 5AD0B 4XO4A 5J6HB 5IOKA 4Z23A 2UWEE 4KGJA 2VDQB 1JZ4A 1Z2KA 5KW9H 4KI5C 4LU5H 5DEGB 2Z93A 3FNKA 1JXGA 3EOBB 1OM3H 1ETJA 3F7KA 4RVBA 1KCLA 3SE4A 3U4AA 2FGWL 1MREL 3QBTB 2BP5M 4LAQH 4UQEA 5JJJA 2N7SA 1WPCA 2CKBB 2GYSA 2QADB 1FH5H 1U95A 1T1ZA 3TBSA 5H4ZA 5ICYB 4DP7X 3WLBB 5FW8A 5BQ7B 1JAEA 5FGBA 1XB6A 3QQDB 4BE5A 4FQQA 5HI5C 4GG6E 2CUHA 3NACH 3RTQB 5CGBA 2BIPA 3HAEB 3KW8A 1AKPA 3FO9A 3CMOL 1M2OA 1D3CA 1PSKH 4OGQC 5AVRB 1DP0A 1NGXB 1QABA 2ZCKL 3JZ7A 4QRQA 2W07A 4KV5F 2H45A 4DN3H 5K9QI 1U8QA 4PY7B 4WKZA 5J6GB 3TL5A 1DVFB 1NKRA 3OG4B 4UIKL 3BAIA 2TAAA 4F7TB 1G4MA 3IDGA 5IFHH 4FG4A 1XXFC 4LRNL 1YYLH 1KDIA 4LLDB 1EWHA 4GAGL 3FUHA 1M42A 1CGXA 3ECWA 1BYOA 2BSEA 4LSVL 3MRLB 5ACZA 4UHRA 5GSRA 5F7DA 1KT2A 2AABH 5ICUA 3VFNA 4B6ZA 2W9LA 4H8PA 2PW2A 4RWYH 1FIGH 2ROXA 2XHNA 4GRMA 4IBTA 4NXKA 3CFBB 3PWUB 4NP4L 3MLXH 1ZLDA 2ARJQ 3BVXA 1CWQA 2I07A 4WKXA 5AAWC 3ECUA 2GSMB 4WWID 2QKIA 1W80A 2ZWYA 1P4IH 5KTEH 3EHBB 1R0AH 3HJEA 3RVVD 3G04B 5EULV 1EFXA 3OHXA 4KRNA 4X5LA 5LXVA 3K5RA 3ASWA 3L48A 1J12A 3DPBA 3EGXA 4UM8A 2R8SH 2O61B 3SDYL 4F7KA 1DVUA 1YPZF 4L5FH 1E3ZA 2EDKA 1UOLA 3MV9B 4P06A 4KKCD 3N5AA 3LQZA 4WNSA 4UI2A 1KB5H 1A9EA 4OV5A 1UZGA 5D7SH 4WFFE 1ECZA 2ZOKB 3KS0J 2XJKA 2G5BB 5B7FA 1ZT1A 2P5ED 3PJNA 3VXTA 2Z7ZA 5H4YA 4U3CA 3LIZA 1J0HA 2Y6SD 4XX1G 1RJZB 3BD5A 2AEIT 1QRNB 1S9WA 1MZZA 3AB0C 4R4FL 1QPXA 2XTJD 3BE1H 4NGHL 1S46A 5AZ2H 2GG1A 2YMTA 3G6DH 1I7ZA 2VN3A 1U36A 2R2BA 1JGUH 1MCLA 2NTFA 1AE6H 1P7HL 3N55A 2X53A 1QM8A 1FZJA 4IB4A 1YEGH 3CXHJ 4KK6C 4LBAA 4RDBA 5IMMB 4XPGL 1JV6A 2WK2A 1C8SA 1NBVH 2X6AA 3F7VA 3DMMB 1GZPA 2TSAA 1F6FB 2CXKA 2OI9B 3TJEH 2CLZA 2YUVA 3SZKC 4ZS6C 1SGKA 3APDA 4DW2L 2W0LA 4RLDA 1AACA 2OMWB 2VLME 4FFYA 4XTRC 5AD0A 2IFGA 2VLKB 3GRWA 1MJ7H 2CWRA 1KGUA 3P73B 4XMKH 3B7SA 4HYXA 4D9RE 1T21B 3BSZH 1NFDE 1EGJL 2MWCA 1CFNB 4HISA 4WO0A 4M5SA 2PYFB 1D5XB 2P26A 2R29H 3PLYA 4JKLA 4MMXB 3VH8B 1PD1A 1JOIA 1KFAH 4ICWA 3PUUA 1IIKA 3I75A 4R3SB 4CBZA 4CDHA 5KANG 4FQXD 3EYQC 1NCAH 1LP9F 3IDJA 4YQXL 3RWDA 3OB8A 3DSNB 3HG4A 3HUJE 1ZE3H 4HHWA 4QT5A 1OE2A 2EKJA 2R27A 2ZG2A 3QEUB 5BQ7A 4AQ8C 2WNXA 1FBKA 3QRBA 3QQDA 1FWXA 1OAXL 3LRGA 5H37A 4YDKL 3DJ9A 3RTQA 2J1YA 2B1HL 1TKWA 3QAZB 3NN8A 4XOCA 4YBQC 1AFVH 5C2BL 5GRWA 3OR7A 3WJMB 1BLNB 1TR7A 3HBZA 4G6JH 1LQSR 4E5XB 1P2CA 4N25A 2UY7A 5EZIH 4KC3B 4JCWA 1IKNA 4LCUA 2QHRL 3J7HA 4FQHA 4PCTA 1MOEA 2XIDA 6FABH 4DVBA 1OK8A 3P2BA 4HKJB 2BH0A 3K6IA 3HZYA 1DVFA 2R0KL 3L5XH 2A5UA 5IG7A 4F7TA 1MQKL 2YAQA 4FTVD 4BVNA 5BZXA 4HJUA 1OF2A 3ODUA 4IDLA 5C0GB 3E6HB 1UCBH 1GC1H 3L3HA 5C08B 3O6FD 2M3GA 3L9RA 3P9WB 1A6ZA 3UJTH 4A7GA 2Y1YA 3THML 4A37A 2DH3A 2YA2A 1A5FH 1SDYA 3GYRA 3HB3B 4LVHC 3DROA 3V0EA 4CC4C 5HVHC 5ETUA 4M6ML 3AT8A 1QBLL 3I6LD 1DVQA 5IT2L 4H7VA 3MZTA 5AW1B 2LFGA 4TVUA 3AFLA 4EIGB 3IAQA 4Z76A 4WWKC 1YQ2A 5I6NA 3PWUA 2IH3B 2EH8L 4PJ5D 1KTCA 3UTTE 1ITCA 3VFRB 3MLZH 3RKPA 2P9RA 2X6UA 4ISVA 4K55A 1VGOA 1YPZB 5CJOL 4TL5A 1NCBL 4GSDL 1O6VA 3TEXA 3B1TA 3HMWL 2C4FU 3H2QA 4G7QB 3S48A 5F3HB 1COBA 1IO4C 5DUPH 1LO0L 1OCWH 5E4AA 4E36A 2O61A 1QZNA 3TC9A 3HE6A 5IB3B 1BG1A 1QSED 2IWGA 3RQ3A 1ESOA 3Q48A 3DVIA 3QUYD 2BNQD 4OZIA 2R9HC 3DX8B 1J0IA 2I7SA 4N5ED 3SKOB 4YO0B 2G5BA 3VFWA 1C1EH 1HTYA 1RZIB 3L7FA 1AGBB 5CLZA 2NTSP 5LO7A 3ZRSA 3DTXA 4JQIA 2CLVA 1B3IA 4FQIH 4HS8H 1RJZA 1X5XA 4BZ2L 4O4YH 3UPCA 4ZMWA 3RPIB 3DECA 3MFGB 1P6FA 4H20H 4X80L 2DM3A 1LK2B 4X5WB 5DQDL 2E9BA 3ZT7A 5J8OA 1BXXA 2X3AA 5C6PB 5FWQA 1EV2E 4LCIH 4XPBH 4DUVA 5EBWA 4ADJA 4BUGA 2FHCA 3HPJA 4LEOB 5CWSA 5KZCB 4PGEA 5H37G 1RP9A 1C8RA 2VXQL 3HAEG 2DKMA 5EV7A 2IFFL 4MHHG 4N0UB 3HG3A 3MPCA 3IDNA 5CBAA 3V4UL 3GEWB 4YC2B 2BOLA 4GXUM 1INEH 3K80A 3TO2B 4XCEB 5L0QC 3K0YA 5I1GH 1HOEA 4HK3J 1PF3A 1AR1B 3AG3B 4RWHA 3ULUF 1DFBL 1ZMYA 1CFNA 3BFOA 1GYWA 3N0AA 1D5XA 4MMXA 1LP9B 3ARDC 1E2WA 3KYMB 4GIOA 5GS2H 2AJ3A 1MH5A 4WV1A 4R3SA 1CICD 2ZE0A 2DWDB 3FFDA 4FEIA 3E3QE 1A6UL 3PP3K 4J12A 3WN6A 5DHMC 1E4WL 2XN2A 4FQLH 2NW3B 3IBEA 3VXUA 4YLQT 1DFXA 1BHGA 4N2MA 5CEZH 3TYGL 1X7SA 3QEUA 4NRXB 4ELMB 5M94B 4G8FA 1GGIH 2WKLA 3ARVA 2QGEA 5I1EH 2OL3B 1IIIA 4QGTA 1PZ5A 3IE9A 3LX9A 5GZND 5JHDA 2P5EB 4NNXA 4GMSL 1U8KB 1E6JL 3PV7A 1S5HA 4DVRL 3T4AB 2Y4SA 4WUUE 2FUQA 3T0VA 1G1KA 3C8HA 3TFBA 1R24B 3DK2A 3RTLA 4U6XA 1U8IB 1T03L 2XTJB 4OFPA 2G3ZA 4U33A 4X6DE 4HKJA 1WAAF 2W88A 1WBZA 3BH8A 4J4PD 5FFGA 5G53A 4OM1L 2Q8BH 4GG6A 3EYSH 4AJ0A 3SKNB 4OJFL 2ARWA 1TCRB 5T1LA 1UADC 2VR4A 4JM2F 1RUPL 3U9UB 4KQ0A 1KJ3H 5FYJE 2IPTL 5I73C 2JCWA 2F1AA 2DYPD 5C0GA 3E6HA 5LGHL 5C08A 1E9PA 3C09B 1JF1A 2IMMA 3AABA 5ELIA 4QOKA 2WAHA 4MAYD 1SHSA 2PXYD 3ECQA 3TT3H 3QFGA 4OGAC 4NSKA 1KENH 4XNXL 5AHYA 4JO1L 4N8PA 2IOOA 3EYVB 3FSAA 1K8IB 4N2KA 1R17A 3BN3B 1ORSA 4OB5H 1QUNA 2MOVA 4ODUA 2IH3A 4ZFZB 4FJ6A 1KN4H 4GAFB 3GMPB 3W38A 2B9BA 3B6SA 3GT6A 2F8XC 3GNMH 3RVUD 5J3HD 4OCXL 2UZIH 1URIA 4FQXB 2J3SA 3P2DA 1G7QB 1XF4A 1FL3B 2H3KA 2XN1A 3OX8B 3S8WA 2OLDA 4GRVA 3G5WA 4NN7B 4KHTL 1P5VA 4B9ZA 4HUUB 3IJEA 3ROLB 2JF1A 4OI9A 2VDLH 4Y4HD 5DS8A 4AMWA 1CDBA 4JGUA 1ZHNA 2H26A 1UB6B 4Z7WE 1B0IA 4BH7A 3NJVA 3RVXD 1BYNA 2Q87A 1RZIA 5TTRA 1X44A 4CADB 1SRDA 1FORH 3HZKA 1PLGH 4PJHE 4YE0A 3KJ6L 1KFGA 3BW9A 4GS7C 5I9QB 4C83A 5LBSL 3MOAL 2WCGA 3VH8G 5EPMB 3DV6B 1D7CA 5E8NB 4ZUVB 5AVXB 5I82A 3VM7A 1BAWA 2DQTH 1WA2X 2GY7B 3MRCB 2BJMH 5C7XL 1OEZW 1GSKA 1WG3A 1LK2A 2CLRB 5AW9B 5E9AA 5J0BA 1K4DA 2NR6C 4FTVB 3GM8A 3BJ91 4GP5B 4OFDA 3PGFH 4WHTB 4XMPH 3CDGB 4GW5A 5E6UB 1W6WA 3O6FB 4WCYH 3N40F 3EXJA 3MV7D 1RUQH 3LB6D 2QDVA 5FLUA 4BK8A 2OKMA 5F0LB 4AK2A 4OLZH 5IUCA 1T89C 1FC2D 1ZA6A 2FLBT 5FKAA 4PW9A 4NQCD 5E99L 2D9QB 4KXDA 2ID5A 5DD0H 4E5XG 4W9HC 4G42B 2ED9A 4KX7A 2PO6D 3TO2A 4XCEA 4U1GB 1U42A 1Y0LB 2XNAA 4PJ5B 2DQUH 3DO7A 3MACL 5KSAD 4MB4A 4O2CB 2XXCB 2FO8A 4X7TA 4ZUUB 2WBJD 4IK7A 3BMWA 1OCCB 3WO4C 1MF2H 4XP6H 5A3ID 1QKZL 3ZKMC 3QJTB 1SBSH 2WXKA 3L4UA 5AWNH 2NW3A 2BVQA 3VMPA 3SGJA 2B5IB 4XN8A 4QYOA 1P4UA 3VSQA 3EYUL 5DYOB 1FHGA 5ALBL 4HS3A 2O4EA 1NFDA 1EDYA 1CUOA 4OUUA 4ZPVA 4ELMA 2Q3ZA 1UWEL 2BNQB 3DYMA 4BUQA 4HFUH 1IU1A 4KKAC 4FKKA 5D70H 3L16A 5KANI 3TV3L 2P5EA 1KCKA 2J8UE 1KG8A 5FOBA 3SKJH 4OLVL 3T4AA 3U6XS 5C07B 5CCJA 1OL0A 5GGRB 3VRLE 4APXA 2AQPA 8FABA 1R24A 1ZEAL 3HUJA 4JM2B 2PYEE 5F9JB 2EIZA 3DJTA 2COQA 1YZZA 3VWJD 4X98A 2IGLA 4KY1H 1YEEL 1UT2A 4JVPA 1E27B 4BZ1A 1TCRA 5KSBA 1X5HA 2DQIH 4JO4L 3Q8EA 2FGWH 4QRSB 1LL1A 3IN0A 4F5CA 1JCKA 1EO7A 2NW2A 1A7PH 2HX9A 5BZWB 2IANB 2QVMA 1QHPA 2WXPA 4QHKI 1CFVL 1J18A 2GCYB 4WW1B 4PB9L 5I71B 4W9EC 4L4VD 4ENED 3D69A 3DOSB 3OKOB 1U93B 4R5TA 4W9JC 5FJGA 4PJFE 4AMKH 1K8IA 2GBTA 4XWOC 4TOYL 4OT1L 5E5LA 4H26B 4PLKD 5HHOE 1LDSA 4ZFZA 2APTA 1KIPB 1I8KA 2Y7QB 3HZMA 1K2DB 4YGAB 1CG9B 3SE9H 1LD9B 2EO7A 3DX6A 2CJTA 4X7DC 5GS1C 1CICB 3PCYA 1UXWA 5KN5B 5AVTB 2AQ1A 1P5UA 3I3BA 4XCYB 4DH2A 5F6HI 1JF6A 1FL3A 1UG9A 3BKCL 4MJ5B 4J1UB 3AQZA 4FXKC 3WYRA 4A1RA 2W0PA 3TA3C 1GW0A 1JZ5A 3ROLA 4LRNH 2EC8A 2JKXA 3CU1A 1KJ2L 1UM5L 4N2EA 2IPUK 1VIWA 4GXUN 3RX5A 4YVNA 5DC9B 3Q6GL 1PYWB 1EA9C 5DUML 1GUEA 2ZKXA 3PP4L 3PUCA 4CADA 5CF3A 2P44B 4P4KC 2ZX5A 3MKKA 3WN5B 4JFHD 2X4QB 1DVSA 2W1NA 4HWUA 1S9YA 3F65A 5T5NG 3DV6A 4Y9BA 3FU9A 4N9GB 4L4VE 4NT6A 4F3FA 4Z7OE 3G5VA 3GXDA 2Y5TB 3CPUA 4FNLL 2ZNWA 2CLRA 3B7YA 3T0EE 1CDYA 4KQ3H 2A73A 4DESA 1HHIB 1T1XB 1BWWA 1QI4A 4GRWE 3RB5A 3D85A 5DFWH 3UP6A 3PIQB 2DYPB 4IEFB 3QI9A 2DLFH 3N2JA 5B0WA 3O6FA 1UURA 2ENJA 4FJYA 1YY8B 4HLZG 4RMBA 5FAAA 2OA9A 3SDYH 3T2NL 4NKIL 2J1WA 1QSFD 1ASPA 5D2NB 2F8OA 1S9VB 1V05A 2PXYB 4YDJA 1YQVL 4C8XA 1UUSA 1KXVA 1MLCB 2GAZA 4QRRD 4WW3A 3O6KL 4WQOA 4MJ6B 3FSZA 1A1OA 1QLEL 3ECBA 3C9NB 2VSDA 4FHKA 4G8GD 2X0WA 1S9XA 4HUKB 4X5PA 3B9AA 4PCSA 3VSVA 1PX3A 4JRYB 1MW1A 4PJ5A 4R4BB 4ALAL 5F71A 2GBUA 1KLFB 2VABA 1UFUA 2LE9A 1SBBA 2FB4L 4MSWB 4R4FH 4NGHH 4P5KB 4TNWF 3PJSB 3N0PB 3BUYB 2EDHA 2BIIA 2CKNA 5EU3B 2DJSA 2LLLA 1L9RA 3AG4B 4IHOA 3Q06A 2UVFA 5K5YA 5DHYB 3AU0A 4QLRA 3QQ9C 1X5MA 3ATAA 1QSEA 1NZRA 1UKQA 3QDGB 4YSTA 4F9PC 4XPGH 2AV7A 3QUYA 1BBJB 3PWHA 3O8XC 2HT4D 2GIXA 1MW2A 4KDWA 4KNUA 4GKOA 1BRRA 5ENWB 3SYOA 4YX2H 4MLSA 5I1JL 5J7CC 1C16B 5K33A 3LPFA 4FLRA 4X4YB 2JKSA 4JPQA 4LFHD 2C34A 5DS2A 1MCPL 3DYPA 1BFOB 1WGVA 4JDVB 1ADWA 4MDJA 2J7LA 2CDFB 3QEHA 2WYIA 5BRPA 3JT2A 5D93B 3PXOA 2R69L 1CGSH 4QRRE 4RFEA 4GXFA 4JAMA 3TVMD 1KYFA 2A7BA 3QJXA 1KIUA 3SPJA 4G8GE 5BZWA 5E95B 2HVBA 4WUUA 1ACYL 3JQOB 2VDRL 2OMVB 3LZQA 1XWVA 4J3OD 3TWCH 1XGRA 3IAPA 3MV7B 4NWTL 3QB7C 4YQXH 4IRZL 1SZNA 5GS3A 5HVWA 1ZV2A 2FYYB 3DXAD 1IUZA 2Q76B 5C0DB 3OKOA 4NQCB 1U93A 4CSSA 2WJ7A 5IZ7A 2BSDA 1Q9LB 2EDOA 3UZAA 1UWGL 3QWOB 4N0YL 2L3BA 2PO6B 5C2BH 4H26A 2X2UA 4X9FA 3FQRB 4QRBA 1D5MB 5KJ7E 4YDIH 1BW8A 1DHKA 1YA5A 3WHE0 5KSAB 5IROC 3KPSB 3VB8A 1GRWA 1ZT4B 1G9MH 1XMWA 2VLLB 5F7NC 1AS6A 2WBJB 2QHRH 1UKSA 4XB8A 5DCCA 4JFVA 1CICA 1DZEA 1GGUA 3SHSA 4XCYA 1TQBB 3VD7A 1MQKH 4J1UA 2VQTA 3R7QA 4FYQA 5DHHA 4RZCB 2AV1A 4WW2B 2ENYA 3WHXB 3CVHH 3MBWA 1S7WB 3TU6A 1R1CA 3AXLB 5DLMH 4AW4A 3THMH 1PYWA 1RZKL 3FO1A 1O7VA 1KCVH 4G8IB 5GZNA 3FQTB 2GIMA 3UTYA 3WN5A 3RZWA 4M6MH 2BXYA 1AHWC 2NY3D 2X3CA 3CLEL 4Y1SA 5IT2H 5IFAL 3WUWA 4A7TA 1UFGA 4N9GA 3H6JA 4Q4IA 4J4PA 2VDML 3VWJB 2HLFD 1WWCA 4Z7WA 1JZHA 2Y5TA 3UZQB 1DSYA 4UZUA 3DUHA 2MHAB 3LIZL 4Y5VC 1HXMB 2GEEA 1HHIA 1U91A 5CJOH 1AIFB 1NCBH 4OFKA 4GSDH 1XCTB 2GY5A 3EG9B 1PJ9A 1UD6A 3Q6FA 3HMWH 4ENZA 1HYSC 1K3ZA 1IGCL 1LO0H 1MIEL 1RZGB 3D39D 1U3JA 4MAYA 3SDAB 1FRGH 4W93A 4XP9H 2PXYA 4M1DL 2DI9A 1FNEB 3FUFA 5ECGA 5C1MB 5GGVL 3L4WA 4C54A 1MLCA 1A25A 1II4E 1JUFB 1NCGA 3DDFA 4Z0XA 4DP8X 5J06A 3C9NA 3HMXL 4NJAH 4LNVA 4FQ1L 4R4BA 2E59A 3R4DA 1KLFA 4BZ2H 5LDUA 3B37A 2N4IA 1QKPA 5DJ8A 2E74C 4FFYL 3CIAA 1NEZB 4U1JB 3UAJD 2FR4B 3N3EA 3PJSA 2AEWA 4AI7A 2ZIDA 4X80H 2EILB 4MQ7A 5JPMB 1ETA1 5DQDH 4MMZB 1BA9A 5TQ2L 2HJLA 4AIOA 3SE4C 1XZWA 3FCSA 3VGHA 5ITBL 1WA0X 2UXVA 4Y4HA 2LHAA 1U30A 3PWLA 4UAHA 4YXLL 2CGYA 4U49A 2AZUA 2QPEB 2VXQH 3HNSL 2JLLA 4ANKA 5H2NA 1PPIA 4DGUA 2RALA 2IFFH 5FGBC 1HINL 1KG0A 3MREA 4J3UA 4XPAH 3V4UH 2KYIA 2J44A 3GLEA 3IFOA 4E42A 2XU9A 1KN2L 3AG2B 4MGXA 2D7PA 5BCAA 1XO8A 1JP5A 3UFIA 2N1KA 1DFBH 2VJ0A 1DBJL 3AGWA 3NCYS 4WU5B 1A6UH 2ICCA 4PD4K 1N0LB 1F02I 3KPQA 1UYWL 2IH9A 1EJ6A 4JRXE 1E7VA 1JL8A 1PAMA 1YEDB 3CQFA 3DNKA 2PYEA 3MV7A 5B22A 3S88L 1X7QB 1QSFB 3TYGH 5F9WC 1AHKA 3ARBD 1KV7A 4IAQA 5C0DA 3FOMA 3UBFA 4DZBB 4A7VA 1Q9LA 1RVFL 1CL7I 4IMKA 2PO6A 1LK3L 3GDCA 1E6JH 2OW6A 3FQRA 1J05A 5I1DB 1D5MA 1N70A 3NJLA 4DVRH 2YEZA 1KCSH 1MSPA 1ZT4A 4G9FB 4JW3A 2WLKA 3UTZB 2WBJA 4HK0B 1T03H 4A55A 1BPLB 3OMAB 4R96B 1ERNA 4H8UA 4J27A 4OM1H 4QAWA 2IXQB 3P3SA 1E30A 2WLLA 4OJFH 1CGVA 1VPOL 2BC4A 4PJFA 3COOA 2QKIC 1E4XL 2F9BT 4RZCA 5CCHE 5I6XC 1FYTE 5HHOA 3GTNA 4BKSC 3HBPA 1FG9C 1LN6A 1E12A 1K4CB 1OARL 3OHXC 4M29A 4R83A 4RMUA 3QHTC 3WFZA 3BP5A 2X89A 2Y72A 1IZJA 3RVWD 4MXVF 4JLRB 3LPGA 3NPZB 1JV7A 4JPKL 4LSTH 5DS1A 4HUVB 3UTXA 4F80A 4TQPA 4JO1H 4KO5A 1LO5A 5AB9A 4F2EA 3QQ4B 4HGMA 1RAMA 1ES0A 4FG6C 4C4KT 2WYTA 1USZA 2ZKWA 4ZUSB 1G94A 3ZXAC 3RZEA 2E7CA 2YKLL 3GBLA 4ODHL 3VWJA 3V2WA 1QBBA 5E6RB 5D1ZC 1F0LA 4A67A 2V7HA 2YMOA 1HNGA 2Y2TA 3TVMB 1I7TB 3FN3A 2MHAA 2KH2B 3GUTB 1Q38A 1JRHH 2IWKA 3CFMA 4FBZA 4Q8BA 3VU1A 4GRLD 2NLJB 1HHHB 1PZ2A 1UH4A 5F88A 2P46B 3EG9A 3MJ8B 1NCTA 3FDWA 4GFXA 4NUJA 1DBBL 1MCNA 3N1FC 3JUZA 2NY0B 4HX1B 3VFMB 3GD1C 5MI0B 3J8F7 3DXAB 4L4VA 3MRNB 2JKNA 5C1MA 1ZSHA 3CODA 5E0QA 4YXKL 3LN5B 5IMOA 2JTYA 2I20A 5J13B 3CN0A 2QQKH 2CHDA 3PBLA 3C5ZD 4WAFA 2AI0L 5DTFB 4OTXL 5LBSH 2AK4E 5AL8A 3HASA 3DIVA 3HLKA 2WB1A 3MUZ1 1NLDL 5IVXE 4LSPL 3LV3A 3D12B 2FR4A 1WCBB 2DLTA 5I8EA 3S2AA 4GYBA 4CSPA 5C7XH 3ARYA 2OMBA 2Y02A 3B3BA 3FAWA 4XX5A 1ACCA 3CZKA 3CTTA 5GGVY 4PVMA 4J3WA 1RURL 1G43A 3RIAF 2IADA 2P80D 5GRJH 3ZE1E 4TLKA 4Z5RB 4DUXA 1E40A 4M5TA 3QYCA 2FSEA 5G2NA 3QS2A 1PDKB 4MX7A 4F33B 3P69A 2OP4L 1EMTH 3SDXF 1TNMA 2BFVH 4AMXA 1WFNA 3QC6X 3VXNA 2NY3B 3MUGA 3RTQC 3B2PA 4HPYL 4BSWB 5L9DH 3T04D 1DL7L 2ZG1A 4K0OA 5F7FA 2HSIA 2KDYA 5TH2A 3MACH 1S6NA 1CFBA 1RU9L 4HD9A 1RZ8B 1N2RA 3QJRB 1X5ZA 1IKNC 4WU5A 4GUOA 1JZEA 1XF1A 2ITDB 3U83A 4I9WD 1N0LA 2AFNA 3NSFA 1DVFC 3VFOA 1OSYA 2EDEA 3CXDL 1SMDA 1FNFA 2NZ1A 3D39B 1M71B 1CWVA 5ALBH 4NZRL 2P8PA 5ITFB 4H25A 4FJZA 3D0LB 4PJ8D 1UWEH 3AACA 3VXMB 3EGDB 4QRRA 4DZBA 3QQ3B 3TJHD 4EUPH 2D73A 1DBMH 3BXNB 3WEXB 3TV3H 4AEIL 3RWJB 4G8GA 4N2LA 5E1QA 5BNXD 4EBQH 4OLVH 3TN0D 3X17A 1OAYL 3D05A 1DN0B 5E1IA 1ZEAH 1IGJB 5GGSA 3NK3A 5EFIB 1A3QA 3IMBA 5EZLB 2QZQA 5D2LF 5EU5A 1NUFA 2C1OB 4UBDD 1YEEH 2WBKA 4AQAA 3PREA 4NQDE 4EDWH 1EEUA 4HGKC 3W1ZA 2GT9B 4JO4H 4OZGF 2ED6A 1F88A 5JXED 3F83A 4LSSH 2X2HA 1KZQA 4Z95L 3V4PH 1FCCA 2WM0A 4Y0GA 4PBWD 2YOCA 1CFVH 3HC3L 4PB9H 3HE6C 2XKUA 4FQ2H 5FYLE 3ZL4L 1BQKA 3EJZC 4B9GA 1UOVA 5F7BA 4I9WE 1L0QA 3ARGC 1WWAX 4AW7A 1LO3H 3AS2A 4TOYH 4OT1H 3VB9A 2WUCL 2HPOA 5KAQF 5AW8B 3VD0A 1NEZG 4A63A 3UJIL 1CD8A 3BUBA 1A7OL 1QR4A 4YUEL 2G3XA 4IBZA 4KFZC 4Z7VF 3ZDYF 1HESA 3GLAA 3VU2A 1HHHA 2PETA 3C87A 1XR8B 4QXGL 2WIMA 4JFZL 3MJ8A 2L4OA 3CLFL 3HZVA 2DS4A 1LE9B 4JPWL 5J7AA 4HX1A 2BW5A 1LWHA 3RILA 4TQEH 2OSLB 1W72B 3BDXA 3DXAA 5BS0D 1MRFH 4FFWC 3ARBB 1KJ2H 1UM5H 3CBKB 5E00A 2IDQA 4B60A 3VGFA 3G5ZB 1FH2A 3VE0B 4K3DL 3MUHL 3Q6GH 4KDTA 1AGEB 1N59A 5DUMH 4K94L 4N0CC 4JZJA 1QACA 4XO9A 4AKQA 3PP4H 2E76C 2OI9C 5I5IA 1RL1A 5JZ7D 2EEDA 4UDUB 2OK0L 4Z7QF 3KLAB 3EYOA 3L3KA 4MA3A 5L2KD 3KLHC 5D4HA 2DMKA 3ZTJH 2J72A 1TQWA 2JXMA 5ANHA 3F58H 5E9NA 5I1AA 4FNLH 4JFYA 3TEUA 3QDME 4F7EA 2GFBB 1NTDA 5B3NA 1BLIA 3FTGA 3W9DB 1BQ5A 5TE4H 4WV1C 5ITEA 1OAUH 5IB5B 3ARZA 1HT6A 3PHSA 4WEMB 3ZYZA 2G2PA 3QSKB 1U58A 4ETQA 1NL0H 2CQVA 2MPVA 1UQSA 2O5YH 3QUGA 4PLNC 2FECI 1SM3L 5LWYL 4NKIH 4P2RE 1RHHB 1BMWA 4JFPA 1AQHA 2XQYA 1YQVH 1YJDL 3SPCA 5HHNB 3LMJL 4LIQE 1TZ8A 2B2XH 2IAAC 1QLEH 2W0KA 2FHBA 4XBGB 3EUUA 1JVKA 2EADA 3MFFB 2FEEL 2IO5A 3U48A 3P0VL 4ALAH 4PM1A 2HT2C 3ZE2E 1AY1L 3L45A 1YNTA 2FB4H 1BOGB 4GRLB 1BVLB 5DFTA 3TTSA 1BIHA 2DLHA 2ITDA 3WEBA 3DETC 2PCYA 1A1MB 1G7LA 4GUCA 4ODBD 3ZHFA 1XT5A 3MA7A 4BZ1L 1G7HA 2NXZD 4OD2A 5ITFA 3CZEA 4PJCE 2ZG3A 3I50L 1IAKA 4NIKB 3W81A 1Z7JA 3DX7B 3FB5A 4A6YH 3MRBB 3QQ3A 3L13A 4LFHG 3TT1L 4CGTA 5EUOF 2AANA 5I1JH 1B3JA 1RIVL 4A2MA 1F42A 3B2VL 3ECVA 4MKMA 4X6FB 5D2LB 3SDCC 4PV1C 4RSVA 5J9PA 1DN0A 5TGBA 2UX6A 2B15A 4OZGB 3Q2LA 2YZ1A 4W4OA 2EUWA 3UAJA 3RBSA 2CUIA 2FT6A 4NQSB 2VDKB 3MV9E 2DMHA 3V6BR 2R69H 1SN2A 4GSXA 3SGDH 4E2OA 1PGRB 1NOAA 2FEDD 2BNRE 2XG5B 4J3OG 4X8JA 2LOEA 3P9LA 2AK1L 4J3BA 5CSGA 3OXRB 1ACYH 3PPSA 1X4XA 4JFDD 4I48B 4NWTH 4PJGF 1JZ3A 4IRZH 3VHZA 5IV2B 1TVBB 3NCJH 4PJDE 4S2SB 4AGMA 3NT0A 3NYAA 3EO1A 3NESA 3QH3A 4QO1B 2F19H 3G3LA 2WANA 3EMLA 5C0BB 3KCWA 1FYTA 3ZDYB 3OKKB 2XPGB 1ADQA 1YC8A 2IOMA 4Y19D 4YLBA 1O5DT 2WNGA 5FUOH 2N7BA 2YXFA 2C9SA 5LAXB 5SX4I 2DN7A 1RFDL 1XR8A 2VMFA 3II2A 4M61B 3QFDB 3K6OA 4ABVA 2X70A 1U92B 2BVOB 3KS0H 4KJWD 4HXAH 4ZTPH 2OSLA 3KYAA 1S7QB 1DQQB 1HXYB 4PJ8B 1R46A 4QEGA 2UZXA 1JFHA 2XQYG 3LD8C 3G5ZA 5DJAB 2Y04A 4K94C 4BRVA 1RZKH 5DFVD 2OTUB 2X6VA 1TDQA 1AG6A 2DJMA 1WV7T 4GQ9L 5E6ID 3CLEH 4HEPA 3NRFA 2WLJA 4UYPA 1H15B 4NHCL 5EEYA 2FX8L 4QRAA 5L4IA 1B4JL 4RMQA 3KBPA 3VI3B 2H41A 5MEOB 3L3GA 3VUAA 2VDMH 3NQIA 4P5RA 3ZYIA 4B50A 4UU9A 4ZI8A 5DHVA 5MHSE 1H8NA 1U41A 2WLNA 3PG2A 5T1MA 4KV5E 3RVVC 2WVTA 2AK4A 2CDEB 5I1CL 1PLAA 1IFHL 1IGCH 1NM9A 1DCLA 1MIEH 4QCIA 5FDWB 3SGJC 1AQMA 2WSPA 5HP5A 3TEZA 3AT0A 4BYHA 4C4BA 3IDXH 4G3YL 5GGVH 3V52H 4C4KO 5DMKB 4MNHA 5KVDE 2VC2B 4QUOA 3WNPA 3KPRE 1NIDA 4TL3A 3PABB 4L2LA 1Q72H 3HMXH 5AOLA 1M3IA 4ZFFB 4FQ1H 3P3YA 2Y6SC 3T4AC 3FKUS 3GGWB 4G1MA 1BF2A 2YD4A 4YSUA 5IB1B 4WVRA 3ISRA 1D2OA 1KYOJ 2DI7A 4OLXH 3WI9A 1ZS8B 2PCXA 4PHXA 1DJXA 5AG9A 1GY1A 1BVLA 3LRMA 2E6QA 2XTJC 4PJXF 4U3SB 4UAOB 4Z7IA 2KS0A 4P49A 1IZKA 1UXSA 5DZPA 4Y8DC 3TNMB 5EUOB 4WTZG 2CA4A 3TBYA 4P3DA 5I5MA 1CI5A 4YHIA 5BS0B 3GJFA 3RI5F 4JPVL 1WZLA 3DX7A 1XFPA 3SPVA 4U7SA 4AEHL 3MRBA 4WO4A 4YXLH 1DANT 2XG4A 2FRGP 2FWLB 3HNSH 5FYJU 1J9SA 1OTUC 3NTCL 2PWGA 3C5ZA 2H3NB 3T3PF 3K6SA 3ZE0F 1ASQA 1HINH 3QCUL 3IF1B 1EEYA 4OM0L 5D71H 3EOAA 2MCG1 5ACMA 4G5ZH 4XXJA 4PJ7F 5ADPL 1KN2H 3JWNH 1CIUA 2GI7A 5FYJL 4X31A 4FYRA 1L5GB 2ESVB 3DRTA 1LDPL 3CFDB 5GZOD 4Z78A 4CU6A 4PJGB 4HHAA 2WKOA 4CKVX 2EDMA 3PHOA 3GXUB 4JY6B 1P5UC 2P80A 1NCHA 3PU7A 3V0WL 1UYWH 5IQ7L 3RU8L 4I48A 3U36B 4K8RD 3S88H 1XTMA 5A6MA 4PS3A 3IFNL 4OH2A 1EAJA 4LZKA 4P04A 1I1YA 5TPWL 4CVWA 1TVBA 3NIDF 4S2SA 4KROD 4NQXA 4ZRGA 2BK8A 1HWWA 4QO1A 1R3JB 2EZ0D 5ESQB 4BFNA 3UYRL 3M46A 3Q2WA 4M1GL 1IM3A 3P0GB 4DPBX 5A8EA 1E3FA 1HX0A 3NEOA 4UINH 4XC3L 2DIJA 1KYUA 4OQTL 4YHYB 5HHQA 4ZMTA 3HI5L 1DSWA 5ABZA 1Z5YD 3NCFB 3H3PL 1VPOH 6PAZA 3QE5A 2BVOA 3UIYA 1E4XH 3KR3L 5AYQA 1FJ1A 4I2XB 1S7QA 4B27A 2J2ZA 1DQQA 2M83A 2ZUSA 4PJ8A 5IW3A 4B0MB 1OARH 3ZDZF 2F54D 3QI9C 3O6FC 2Q86A 1IW9A 1MVYA 2OTUA 5F6HJ 1RXLA 4JPKH 2IQ9L 4LCCB 2NQ3A 3TN0A 1KXVC 1U2YA 3ZMNA 2Z73A 1YYCA 3ZDWA 3FH8A 3MTXA 4HUWA 3OAYK 2Z8VC 4HYTB 4OBSA 1Q4NX 5ERWB 4F7MB 4QXTB 4ZAKD 4ODHH 3CCHB 2G30A 3PFUA 1Q94A 3S5LA 6PCYA 2I26N 3IFLL 2X05A 1CLYL 2WCSA 4DZ8A 2Z0UA 3PAVA 1JXFA 4P23D 3TBTA 2CDGA 5JXEA 5LXGL 3K81A 1MCQA 5EEXA 2HLEB 1DBBH 2B0SL 1TLKA 4O51B 3DHMA 4BEZA 2DL2A 2G9KA 4JFDB 5CJ8A 4YWGH 4C58B 2GK0A 3FSWA 3O4OC 3MHZA 5I15L 2DQHH 3MKGA 3QUYC 3UGUA 2YN5A 3V6FA 4N5EC 5IIEB 3GB7B 4LOFA 3MR9B 1R3LA 4IJ3C 4ORGB 4TUOB 4B9PA 5KG9A 3PABA 4M9PA 1NPNA 4JHBA 3GRBA 4Y19B 2AI0H 1U3HD 2PNDA 2LU7A 2BZ7A 3CSYA 5ALCH 3REVB 4FL4B 4W9ZA 5AKVA 1NLDH 2NY4C 5D5ME 1SJXA 4RRPM 1SXSA 1A7BA 3CN1A 2GQHA 3GIVB 3GSQB 3L4CA 3KDMB 2WBWB 3TNMA 1NGWB 2KLTA 5JXAL 2V5MA 3I6SA 1H9VA 1RURH 2J8HA 1UD8A 2H2PD 1AZBA 3C75A 3DIFB 4PY8I 2QPSA 4V1DE 3T3PB 4DUWA 1D6EB 1JWUB 1T4KB 3ETBF 5KAQG 4DQOL 3EBIA 2W60B 3FOLB 3OQRA 4M7ZC 4PJ7B 2GHZA 1JZ2A 2OP4H 3G7TA 1TPXB 3JV4A 1NANI 5E6IB 4QXVA 3IF1A 4MXQD 3MX0A 1B6UA 2X7LA 5F70A 2HN7B 4MASA 2DEYX 3U9PL 3JUYA 5L2KA 2XFXB 2QSQA 1YAIA 4PJCA 3ZOAA 1L5GA 3LXBA 3KH4A 1T0NB 2H3XC 1MFEH 1UC6A 3P77A 4XHQA 2WQSA 1UWFA 1OGAB 1PCXA 4Y9CA 1CICC 3FT4B 3VA2C 3CXDH 3NZ8A 5D55A 2QJDA 4WENB 4M7LT 3U36A 2ZWLT 3SE8L 3FT1A 1HSAA 5H35B 1JPST 4NZRH 4KVPA 5JIHA 1R34A 2FE0A 2VN4A 1OGTA 3MRKB 4JDEB 3ULSA 6TAAA 2AQSA 4KX8A 5CGYC 2C8NA 1VFUA 4H1LH 4AEIH 5GZNC 1MJUL 1NWOA 3CZJA 4ILDA 5KUKA 1HQRB 5B6YA 1OAYH 1XB3A 4UQCA 3QRGL 4I0CC 4NKDA 2BY0A 4JFEB 4NP9A 5C0CB 1NJ9B 4LGPB 1DSFL 3G9AB 1KC5H 1JWSB 4HWNA 3WFHB 3NCCB 1BZQK 4NBZB 3CK0H 4J4PC 3ZDZB 2VT4A 4XH2A 2VR9A 3ULUE 4X2UA 4XNZC 4I2XA 3AMKA 2QR0A 2QSVA 4Z95H 4BK5A 3D7PA 1T0MB 4FRWA 5TE7H 4QI3A 3VFUB 4DOHB 4UTAH 1JNNL 2IIJA 5F1OB 4MAYC 2DQEH 1DR9A 4L05A 4WFED 2PXYC 3ZL4H 1XHHA 5BRZD 3H3BC 1PL3A 4K5YA 2QQLL 3T4YB 1OIOA 3TCLB 4IYKA 3VFPB 3PGCB 3H6AA 5ERWA 5DMYA 1JPTL 2WUCH 3QR1A 4F7MA 3CCHA 4AYMC 5JW5A 3WE1A 1Q0XL 3UJIH 4W70A 1KGCD 1A7OH 2VQ4A 1BCIA 2GK2A 3BEWB 5H94B 3RVUC 3QDJB 4ZNEA 3D25B 5J3HC 4QXGH 2K8QA 2P7TA 3RJDA 4MVBD 5JW3L 1WAAE 4JPWH 4O58H 5DD3L 5BZDB 5C07E 4AUJA 1XTLA 4DAGL 1HZXA 1T22B 3DHJA 2WXHA 1VF5C 4Y4HC 4YBLB 3PF2A 2BDNL 4NO0D 1FFNA 3UTSE 1DEEB 3WTTA 3GB7A 1I7RA 4K94H 3VA6A 3F5WB 2M26A 1J1XL 3VGBA 3G08B 4TUOA 2B4CC 4ZMZA 3UC0L 2H8PB 4LLQB 5DJ0A 5F97E 2OK0H 1Q5IA 4OZHA 1V3JA 1ZHKA 2IANE 4R26H 1HCYA 3CN4A 4X0KA 3ET9F 3OC5A 4WK2B 2BM3A 3U46A 5AENA 2WTRA 3VRJA 3ZO0A 1A02N 4AM0A 2LTQB 5GIRB 3GSQA 3KDMA 2N59A 4XMXA 4HCIA 4HSQA 3KPRA 1KXQA 3RY5A 4NZDA 5B1CA 2YAPA 3DIFA 3MA9L 1GW6A 1CLCA 4N6RA 5FIEA 1D6EA 1JWUA 4HWEH 2F54B 2MQ0A 3BZ5A 1JG9A 1DQKA 3FOLA 1L0XA 3REYA 3LB6C 4HJSA 5I19L 5IF0A 4KRMB 5D7HA 3B7TA 1YJDH 3TJPA 5L8LB 4GSQA 3LDBB 4YGVA 3T3MB 4AQ1B 5D8JH 3LMJH 2HN7A 4FNQA 3TPUB 5B7MA 5DJDB 5HDLA 3FMGL 4IMKC 2PO6C 1LEKB 1OAKL 3D9AL 4ZAKB 4M6AA 1SOQA 4YHLL 1WH0A 1BFVL 1T04A 2FCBA 3P0VH 4G43A 4R97B 4X83A 1T0NA 3VDAA 5JNYB 2VR8A 2X72A 3Q13A 2XETA 3QIBD 1X5IA 2WBJC 4P23B 4FDWA 4ODTL 3L9YA 2IBZX 1E5UI 5A3IC 2ICWI 3QEQE 4MRBA 1UAZA 2Z8SA 1M7UA 1B0GA 4NPYA 4FZEL 5C97A 1CFTA 3GTVA 4A2HA 4L0PB 2W9EL 4XPFH 5DI8B 3DX0A 3RWHA 3I50H 3ZSTA 4O02A 4JDEA 1AO7D 1IGIH 1WIUA 5C0IB 4Q6YA 5FC9A 2LFEA 2DBLL 3UP1A 1PKQB 1VEPA 1AYRA 3B2VH 4HZAA 4NLAA 5DJXA 1P6AB 2EXSA 1U3HB 1HQRA 4IS6B 4P57B 4S1SL 1S5IL 4WFHE 4E41D 1RJLB 2H1XA 1NJ9A 4YFDB 5C0CA 2XKNB 4UTBH 5DGRA 3WFHA 3QUKB 5D2NE 4WGVB 3VWJC 4AZUA 1NAKL 1WEJL 4D9QD 3VXSD 4F2ME 1TIUA 4ZUTB 2VUYA 1G7JA 2Y25A 3VRIA 3EW3B 1ZDSA 2O6PA 2C3XA 3C08L 2AK1H 3FU0A 5CKAA 3GJEA 4JZOA 1MCDA 4OKVA 2BIHA 1IEBB 2WLHA 2IBZY 1NAMA 2HJFA 2ZX6A 2DD8L 1MVUA 1NLBL 5EBGA 1Z5LB 4ENEC 4P2OA 3LNFA 2R4RL 2EABA 1KELL 1AR2A 3A4DA 4LHJB 4QTHA 3X12B 1QFOA 4PLKC 4BEYA 2CBTA 1DQTA 5MERB 2APFA 3GM0A 3W39B 4D9LL 1NGYB 2GJPA 3Q5YA 4AZ8A 1P7BA 3L4XA 4XBEL 2WHVA 3D25A 4EJ4A 1CDJA 5CJQL 3ZY7A 1HDMB 1IAOA 3O11A 2LT9A 4OAWB 1MJ8L 1OCOB 5BZDA 1HNFA 4WTWA 2XFGB 4KTEH 3WY3A 4ZMYA 4OCSL