2QPDB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 36
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpdB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpdB02
2H5UA 5JJEA 4HYJA 4G7QB 1ZPUA 1NDTA 2J4YA 2PPAA 3AYMA 4E9RA 2XV2A 4K9JA 3D4SA 4HHWA 3AW5A 2OV0A 5KKHA 5B6YA 4TL3A 3HEIB 1H68A 1OCRB 1E5ZA 4CSZA 5LWEA 2R7EB 3NJLA 4X1HA 4DP9X 4MBSA 2HXAA 2Y02A 2Y04A 4JQ6A 1TN0A 1MZZA 3AG4B 3NJFA 1L9PA 3TBCA 4AKPA 1QKOA 3HASA 1KV7A 2X87A 3KW8A 3HARA 3SN6R 1J9RA 1L9RA 3RZEA 4HIPA 1J9QA 1BM1A 1ILUA 5D4HA 1P8HA 3X1NA 1BYPA 1KCBA 2FQEA 4GP5B 2UXGA 3PAVA 1VLXA 4UAHA 1PZBA 2WO3B 3CVDA 2DY2A 1WS8A 1PLBA 1SF5A 2GSMB 3FPYA 4DP4X 3S3DB 1QM8A 4QLWA 1Q5IA 1GS8A 4TXVB 3QJTB 3NSYA 1NICA 4WTQA 5DHGA 2XWZA 4XT3A 1ADWA 3EH5B 4PCYA 1NWPA 1S8JA 4M4RB 5B7EA 4DP6X 2PPDA 1M56B 5I5JA 5AX1A 1BXUA 1YLBB 1AIZA 3CDZA 2PP7A 3IE9A 2IWFA 3UGEA 5I6PA 2RH1A 2M3GA 2ZIYA 2HX8A 3FSZA 2PP9A 2G87A 2AFNA 3S8FB 2JAGA 2HX7A 1CYXA 5A45A 2IDQA 1AZCA 1GZMA 1IBYA 1KDJA 1X0I1 3QBKA 1XB6A 2EIKB 4KO5A 1AZBA 4M3HA 3GXUB 7PAZA 3UG9A 1JZIA 2GB2A 2N0MA 2Y01A 2YXWA 2YAOA 3A7KA 5D4IA 3TA4D 4E9TA 1GU8A 2VM4A 4YSSA 4A2GA 4EJ4A 2BZCA 1GYCA 5H2MA 3NJMA 5G53A 1JZGA 4IB4A 2XXFA 1BRDA 3OE8A 2YARA 5DHHA 3NJIA 1NWOA 5PCYA 4YSQA 7PCYA 1ET8A 1QNIA 4QKTA 3FU8A 2YDOA 5TGZA 1KBWA 2PCYA 3WI9A 5B35A 1JV6A 2JAFA 3UAAA 4Y9HA 5I6LA 3N55A 1HZXA 1J5CA 1AP9A 3FYIB 5B34A 2IDUA 4NC3A 2FTAA 2BP0B 2VM3A 3HB3B 2EIJB 3SBPA 6PCYA 4FPDA 4L0PB 2UX7A 4A2DA 2ZFEA 5B1BB 2AZAA 3NJGA 1AQ8A 4J4QA 1SDDA 2YCWA 2FQFA 2VT4A 1SF3A 1OF0A 1X9RA 4DP5X 4XT1A 1NIAA 1ASQA 4JR8A 4E9WA 2J5WA 4GXFA 1J9SA 4YSEA 5H2LA 1AANA 1GY1A 1S54A 1SHXA 4YSAA 2XVBA 2KSBA 4YSCA 1NIBA 1PY0A 1ZDQA 2HLEB 3NJNA 4UANA 1FBBA 3MX0B 1CC3A 2BWIA 4UG2A 3L45A 1M9WA 1E12A 1J9TA 1C3WA 2MTAA 5TK4A 2NTUA 1WAEA 5DYSA 4LDLA 5TK2A 2TSBA 2YXVA 4YSUA 4PXFA 3NY9A 1PCSA 4BVNA 4FAAB 2J57A 1L9QA 3QJSB 1L9OA 1PLAA 1M0LA 1ZDSA 4XTLA 1DZEA 3UTYA 3ASNB 4CSPA 2QPEB 2ZZLA 3EH4B 1RKRA 2IH8A 5ANHA 3FU7B 4KNFA 3ABWA 1RZPA 4Q89A 1JGJA 5ITEA 5H2NA 1A3ZA 3HANA 2GBAA 3UZCA 1OCOB 4X4KA 3DTUB 1PY6A 2I1XA 1GY2A 1O0AA 2X88A 3REYA 3NYAA 3JTBA 3CZUB 5J7AA 1IKOP 5B0WA 4GY4A 3C9MA 4XXJA 5F7AA 4PXKA 1PAZA 3FT0A 1C8RA 2QDWA 1AS7A 3FYEB 1BRXA 2LNLA 4EIYA 2WO2B 4BDVA 1SHWA 3UTWA 4BK5C 3ZIYA 4A68A 4FA7B 1R2NA 1KG9A 1XJIA 1PLCA 2P80D 3PBLA 2DV6A 5B6WA 5I6KA 1AZNA 1PF3A 1ASOA 1NIFA 5IY5B 1CUOA 2QDVA 2OCCB 1F50A 3ABLB 3FQ2A 1MGYA 3X1FA 1NIEA 2AANA 2XUWA 1KYAA 2DWSA 5D4JA 5A7EA 4KOBA 3OM3B 1E67A 1OE3A 4QRYA 3ASOB 1NINA 1NTDA 4DP7X 3PXOA 2BO0A 2BP8A 2QPDB 2BHFA 4HAKA 1TKWA 3KJ6A 1XB3A 5B1KA 3NSCA 4IARA 1F4ZA 1V10A 2NRDA 5AKRA 3NT0A 3UAEA 2YDVA 2KSAA 1AG0A 5H2KA 1BAWA 3AY2A 3SBQA 3ZDWA 3NSBA 1SNRA 2BW4A 3QAKA 1GW0A 5LDUA 1E30A 3BVDB 4AMJA 1HFUA 1NIDA 1AOZA 2Z73A 1WA0X 2JXMA 3VI0A 2YAEA 3QJUB 5E9NA 1MG2C 2HPYA 1OCCB 2BRDA 4N4WA 2JFCA 4A2EA 3BQVA 4AX3A 2QT6A 4E9YA 2UXTA 1KBVA 1JERA 5F7BA 4KLYA 3PQRA 1BEXA 4G7RB 5EHFA 6PAZA 1W6WA 1XB8A 5B1JA 3ABGA 5I5IA 2F93A 4G71B 4KNTA 3PDSA 1AS6A 4GP4B 4BEZA 2HRGA 4A4MA 2FT7A 2YAPA 3CVBA 3P0GA 5PAZA 4GRVA 1F88A 3WKQA 4A66A 4DPBX 3UZAA 4F2EA 1AZRA 1AZUA 3FPXA 4OV0A 4YSOA 1N70A 2CUAA 3FU9A 5B7FA 1PNCA 5AX0A 3C9LA 3S8GB 2KSYA 3OE0A 4MD2A 2VN3A 4HCFA 4KOCA 2UXFA 1KMEA 1BQ5A 4W1TA 2R4RA 3X2QB 3UTVA 2L6XA 1V54B 2WJKA 1CYWA 3TU6A 4HZ1A 1AACA 1OCZB 4E9QA 3T6ZA 3N2JA 2FWLB 1WA2X 4A2HA 4YVUA 3MBWB 4AKQA 3ZPQA 3ZBMA 2I21A 1H2SA 2PCFA 5BR2A 3T6XA 5G36A 4DPCX 1BQRA 1GSKA 1AT9A 1UATA 3PCYA 1E5YA 5I28A 1FFTB 2YCXA 2X72A 2ZXWB 3X3CA 3EHBB 5A44A 3QJQB 3T45A 1ZIBA 2CALA 3CVCA 3UACA 3V9EA 4WW3A 1JZEA 3WKPA 1F56A 5A8EA 1HAWA 4YL4A 4DP1X 1IW6A 3T6VA 5G28A 3VVKA 3OMIB 2HRHA 2XX0A 4X31A 2DWTA 2YAHA 5H2PA 5B6ZA 1DYZA 3VG9A 3ABKB 3QQXA 4HHGA 4EF3A 2IDTA 5BR5A 3CG8A 4NERA 1X0K1 2B08A 2AZUA 2Q9OA 3HAQA 3VW7A 1VJMA 1KGBA 4YSTA 2MRYA 3X3BA 1IBZA 1A4AA 1C8SA 4BWTA 2WSDA 2BP0A 5I6NA 3OE6A 1PNDA 1EZLA 4F7KA 1Q5JA 3QDCA 2VW7A 2R4SA 1A4CA 3PXLA 3ERXA 5H2IA 3ZPRA 1GS6X 3TBBA 2FQGA 2VSKB 2BW5A 2DYRB 4QIDA 2UXVA 4AKOA 1VGOA 1JVOA 5FJGA 2P80A 4A67A 2AVFA 5H2HA 4MQTA 5AHZA 2VMJA 3NP4A 1AG6A 1PZAA 1KCWA 3AZUA 1OE2A 1GR7A 5FC9A 1XIOA 5AHYA 1W8EA 1WA1X 3IN2A 1U19A 3KW7A 4NB7A 3ABMB 3EMLA 3RFMA 2GC7C 3RYMA 3NJJA 3PWHA 1FBKA 1M0MA 3QBLA 3NJHA 5I6OA 4K5YA 1NPNA 1JXGA 2XYBA 4YVNA 1M0KA 4E9SA 4DKLA 2GHZA 3FSWA 5I5MA 2BZ7A 3AG2B 1EHKB 4KNUA 1ET7A 4UF7C 2WJLA 3S3CB 2FJSA 3ZX1A 1NZRA 1RZQA 1N68A 1W6LA 2H3XC 2J56A 1FWXA 2W8CA 3NJKA 4FBZA 1GUEA 2GI0A 3GYRA 1TN5A 5G2AA 2GIMA 3NYKA 3WNIA 1NPJA 4X32A 1DZ0A 2XV0A 4F2FA 2OJ1A 2Q5BA 1JXDA 3NP3A 4DP8X 1XMEB 1RCYA 3JT2A 4JHUA 3S3BB 1MZYA 3IBOA 3SBRA 2I35A 3HAOA 4WKXA 1S53A 4UHRA 4DP2X 1TEFA 3DQBA 2PLTA 2VW4A 3CDZB 3VGAA 1A8ZA 4MQSA 5H2JA 1AAJA 3UADA 4RH4A 2EIMB 2Y69B 5B6XA 2IH9A 2JKWA 5AWZA 1P8UA 2NTWA 3EF4A 1TU2A 1MG3C 3DIVA 4MFHA 1GS7A 3WG7B 5F8UA 1UAZA 4L6RA 2YQBA 5JJJA 4HYXA 1QLEB 3FSAA 3V9CA 3OAXA 1TEGA 1QHJA 4G7SB 1PZCA 3OD3A 4N8UA 3OE9A 3ODUA 2EILB 2IDFA 5G2CA 2R7EA 4YSRA 3D12B 5AFAA 4LDEA 3FQ1A 4KO7A 2XXGA 4BEYA 4BUOA 1LN6A 1P8IA 1AS8A 1UCQA 1ZIAA 3NSFA 4KO9A 1BYOA 3AM6A 1A4BA 1T5KA 8PAZA 5I26A 2EI4A 1ETJA 3DDLA 1JFPA 3CODA 4G72B 3NY8A 1WS7A 2CBPA 2ZWNA 3C75A 1ZV2A 2IWEA 5G2DA 1OOWA 4HCGA 4JHVA 4YSPA 3PPSA 2CJ3A 3IN0A 4IAQA 4P5RA 3TASA 2PP8A 4HCIA 1KDIA 2J55A 5ITCA 3V2WA 1E65A 2IDSA 2VW6A 3G5WA 5I6MA 3H4FA 3QJRB 4DAJA 3X1BA 4BXVA 3QBGA 1SDDB 3H56A 2Y00A 4ZK8A 4E9XA 1A65A 1ID2A 3FQYA 4G70B 2PEDA 1JZHA 3QJVB 3UONA 2LLNA 2I7OA 1L0MA 4N4YB 4DPAX 1SFHA 3T6WA 1IW9A 2EINB 2I85A 2UX6A 4KNSA 2I7SA 1PMYA 4Q8BA 4GPOA 5G54A 3AG1B 2ZONA 4ENZA 4BWBA 3OQRA 3V2YA 2YCZA 4AZUA 1R1CA 2IAAC 1FA4A 1L9SA 2W88A 2XLLA 2XU9A 1R84A 3AG3B 4DJHA 4BXSV 1SFDA 3PAUA 5B3SB 1JVLA 3CAPA 2PPCA 4P5SA 2I20A 1X9UA 1BRRA 4PAZA 4JKVA 3QAPA 3VHZA 1CWQA 3IEAA 2FNWA 2ZOOA 4HALA 3U25A 1ET5A 2KS9A 4NAJA 4BV0A 3QBIA 4KO6A 2IWKA 1S51A 1X0SA 3EH3B 3UTXA 3PLYA 4GYBA 1QHQA 5B6VA 3X1GA 3COCA 1PXRA 1JZFA 2YAFA 3FSVA 4HWLA 4MD1A 4E9VA 2XV3A 1JZJA 1JXFA 3WQJA 5EN0A 5C1MA 4WAVA 2FT6A 2YAMA 2RACA 5ETZA 1PXSA 3PAZA 4YSDA 4GBRA 4EA3A 4AMIA 4N6HA 1J5DA 1L9TA 2Y1AA 2YAQA 1M57B 2PPEA 1AR1B 3WIAA 1JV7A 1BXAA 5B1AB 4XTNA 2FQDA 2FT8A 3ZEVA 2HZHA 2BWDA 1OV8A 5AZUA 1BQKA 5B1JC 1URIA 1ASPA 2PPFA 4BDVB 2HX9A 1IXFA 3H4HA 1JOIA 2H47C 2Z55A 4QI1A 1B3IA 2B3IA 5B7MA 3SQRA 3HAPA 1IUZA 1HAUA 3X1EA 1IC0A 4L35A 4BWWA 2F95A 2XX1A 3UABA 1L9HA 2A3TA 2DYSB 1MDAA 1S8LA 1I53A 1V55B 3DKHA 3MBVA 1KGYE 3NS0A 4GP8B 1SJMA 4LDOA 3GDCA 1ILSA 3FU7A 2CCWA 4XTOA 3WNJA 2BP8B 4A2FA 3NSDA 3FS9A 2TSAA 4BWUA 2VSMB 2Y03A 5B2NA 4JKNA 4W9ZA 3T71A 9PCYA 2E86A 5JJNA 1E0PA 2GC4C 5AZDA 4AI7A 2YCYA 3T9WA 2AT9A 4DP0X 1KG8A 4GYCA 2CAKA 3AYNA 5H2OA 1OE1A 1S52A 1CURA 1QKPA 1BXVA 3QPKA 3OMNB 3OMAB
chains in the Genus database with same CATH superfamily
4BSVB 1YC7A 3KWTA 2I5YH 5FKAA 5AW7B 3WNNA 5H35A 1OSPL 4GIOA 4NNYB 2ED6A 3TCLB 2X4PA 1X7QB 2EZ0C 4B7LA 2Y0SA 1MCPL 3G6DH 1ZTXE 1T0MB 2NT0A 3AW5A 1U8OB 3WL9B 2EUWA 1A9VA 5DJZB 1DVFB 1OF2A 3HEIB 3L1OH 2MH4A 4X4ZA 2X0WA 2DJUA 1B0IA 1FPTH 2YA0A 3QO1B 4LDEB 4DP9X 4JQ6A 4BK8A 4DP5X 4IKLA 4ZFFB 3WEMA 3GKWH 4JO1H 3SJVB 1U4EA 4GS7C 5I66A 3UTSD 1MF2H 3L7EA 2ZX9A 5KZCB 4KROB 3H3PH 2LV4A 3HE6D 4PCKA 1FHNA 4HJIA 4MNGE 4PTTB 4WWPA 3GZQA 3NCFB 4HISA 3QJTB 1E90A 5FF6B 5DYFA 1QQDB 4OZIB 3LXCA 4DZ8A 1ORSA 1WHPA 2EE6A 3EBHA 4YO0B 1EMTH 2PPDA 4IIQC 4B96A 1KIQB 4KHTH 1AQKL 1QKZL 2IAMD 4IDLA 1TJHL 1NMCB 4HIXL 2ADGA 3RUGE 1OXYA 2EIKB 3OAZK 3W56A 4K3DH 4MZ3A 3VD4A 1IGFH 4MAUH 5JLZB 1JZIA 1NLDL 3VW3H 3OHXC 4M8UA 4ZX6A 2VM4A 5DURB 4QXUH 2UWEA 3ZSSA 1ACZA 5FM5O 2EDKA 4B0MM 1CDIA 1AGDA 2JCCF 3AQXA 1XCQA 4HXAH 2XXFA 3NJIA 4OGAD 4XI5C 1UVQA 3QULA 3IDGB 4FI6A 4S1SL 4NWTL 1Q0YH 2OL3A 3P11L 1GZHC 1I9RH 1DSFH 4NC3A 3E6FB 3W9DA 2WJ5A 1Q9WB 2UZXB 1EWHA 1WF5A 4KU1A 2PYEB 3LIZL 2OCJA 4RA3A 1NFKA 4Z7QF 2WKGA 3GRBA 5DHDA 1SDDA 2XZQH 5DVOA 1G7LA 5I2IA 1BLIA 1KPUA 3K3QA 1UCBH 3MRHA 5DJYA 5F7YC 5KSUA 2FBJH 3UBXG 2J5WA 4YDKL 4GXFA 4PJEE 1RSFA 5DHEA 4NO3B 3CN0A 3HG1A 3HFML 4LLUA 2Y6TE 4KVCL 2HLEB 1VFUA 5DJ2A 3TOPA 1AGCB 4OBRA 5CMAA 3ARBC 2OBGA 4UZSA 3VWJC 4JPWH 4M7KL 5MENA 1NJ9A 5FUOH 4NRXB 2GY7B 2X12A 4GEJA 4NM8H 2B39A 4FQLL 4XTLA 1NGWA 5DR5L 1NMBH 1MAMH 5J89A 1T21A 2NNAB 4UV4H 1BF5A 1RFDH 4GRLA 4P5KB 4QCIA 3ABWA 3TBTB 2VITB 1JGJA 3NIGE 4PBXA 4HK0B 5ENWB 1ZTXH 1ZWIB 3BH9B 1P69B 5SWZE 4TQIA 5T5FL 1YJDC 5AB0A 1YEHL 4K5NA 1GHFH 1L5GB 3RI5K 4F7EB 3RWCB 1URZA 5JXAL 1GCFA 3CD4A 5T33H 1IKOP 2GFBB 3ELAT 5KBMA 3RG1C 3BDYL 3P3RA 5EEVA 2HVJB 4JJOA 4KK6C 5IBLD 1OQXA 1ZT1B 5JYMA 4KKNA 1PJWA 3PV6B 3WS6C 4YIQB 3WAKA 4OAWA 4XNUH 2EEAA 3S36X 3I85A 5B3JF 4GUOA 3AXIA 4HJGA 5D7KD 2YPLD 5GXBB 5D1ZD 3VXMA 1BCIA 2BNRB 3LEVL 2JQZA 1K5WA 2AJ3B 4YGVB 5ESVB 1JYNA 4EN3C 4XN5A 4P2QE 4OVUA 3ABLB 1VKXB 4P5MA 2YS4A 2J20A 2DWEA 5HYFA 2ZKYA 3QZLA 1OT4A 3NH7H 4R7NA 1NEZG 4LSTH 3ZE1E 3B2UD 3F84A 3M17A 5I15H 4N68A 4PRBB 2I9TA 3HNTL 5TD4A 2OMZB 2OMNA 3PXOA 1RZ7H 5CXPA 2BHFA 3ISYA 4YDNA 2K7PA 4JRXA 3GHBH 1JHKL 1A47A 5TPWH 3V5HB 1LE5A 2BVEA 2CPCA 3MA9H 5D70L 1PKQB 4W9IC 3ML9A 4X7SH 1OGAA 2W0FA 4AIOA 5LXGL 1H19A 4QNPE 1K6QL 1SNRA 1NBCA 3BE1L 2VQUA 5K9OB 5JW4R 4AOFA 1RZ8B 5K59E 1QLEH 5C0AB 4ZG1A 4BSJA 4HBCH 2BVPA 4AC4A 4Q6IA 2QT6A 4HIEA 3HZKA 5AB1A 1KBVA 3MRPA 3PL6B 1J0IA 4DEUA 4KLYA 5HYSB 4Z76B 3BKJL 4OSUH 2JI2A 1YMHB 3L9RA 2BS71 3FQTB 5BS0E 4GSDH 1JK8B 3TVMD 3CQQA 2GEQA 5E2UH 2CK0H 4MJ6A 3OC5A 3EJCA 5CLTA 2CUAA 4PGJA 3FFDA 2DJSA 3O9WD 3AU1A 4JM2B 3C9LA 1PDKA 1EAJA 3MRKB 4KMTH 2Y7NA 5TDPA 4Z77A 1KJVB 1YEIH 4P5TA 4W1TA 1PEWA 2IALB 5E9DD 1ICTA 1LD9A 1D6VH 1WBZA 2BHZA 2IWGA 3EG9A 3UP6A 1I4FB 4KWUA 4W9JC 4ZDHB 4OLVL 1H3XA 1EFQA 3TV3L 4P48A 3GJFA 5G36A 3VM5A 3CFDA 3FUJA 4PVBA 1Z5LA 3X3CA 1B90A 2HLAA 4R26L 2Z92A 5TDNB 1HWWA 4X6BA 4JZJC 2Q6WA 1T3FB 1HSAA 1HINH 2WXRA 4JG9A 3VGEA 3EOBB 5F89A 4F33B 2QKIA 3DX8B 2XQBL 5INCB 3VFVA 2WYTA 3CPLA 4MVBC 3QEQA 3ARXA 1I1FB 2LLGA 1EDYA 4HUUA 2PCPB 4PFEA 5AOJA 1JPSH 2Q7AA 3V0VB 4N9GB 5I8EB 3VW7A 3U0WH 3DROA 4OD1L 3VRJB 3X3BA 1N18A 3BZ5A 3RDTD 2SEBA 4PJGE 1C8SA 3TL5A 4P23D 2IIJA 4NP4H 2DW5A 1Q9LA 2EH7L 1QO3B 3MJ9A 3PGDA 4GW5B 3V4PA 1PZSA 3RAJH 1HI6B 4HIIA 6FABH 3QQ3B 5J13C 4EVNB 4OKDA 1CFNA 2AV1A 2R2EA 3H3KA 2WQVA 2EZ0D 3VXNA 1EGJL 4Z0XA 1BM3L 1E5UI 2A6IB 4KDWA 4CC1A 1JZ3A 3KH4A 5GGVL 3O6FB 4RMBA 4R7DB 2K7QA 1KJ2H 2ZTBA 4KRNA 3OKOB 1K8DA 3KHOA 4NHCL 4PRPB 3D18B 4GXUN 4N2LA 5BQ7A 1KPRB 1J11A 3UL4A 2GC7C 1G7JA 2Z7ZA 4A6YL 5MERB 5I6OA 3MLYL 4HIJB 4AIZB 2Z7YA 1YRKA 1EAPA 2V2TB 2CHWA 1IFRA 1AMYA 3T4YA 1ED3A 2I24N 1TETL 2FGZA 3RUGF 1AGEB 1LILA 3R06B 5ITBL 3M88A 4PJBF 3QWRD 4WO4D 1SUHA 2XFXB 3KWVA 1S9XB 3SYCA 2KQNA 2PKDA 3UYOD 3DXAD 1N0LA 1R4XA 1T83C 3BPNB 3RX7A 2Q5BA 2WC7A 1JXDA 1JGIA 2Z93B 1NC2B 1NKGA 4I4WA 4DCQA 4Y8DC 4EUPG 3TNMA 2Y7LA 4PS7A 4JE4B 5FCUH 3IBOA 1ZXKA 3SE9H 4O2CB 2VW4A 4PJFE 1FFPA 3QG7L 3GIZL 3NZUA 3KLKA 1OP4A 2A9BA 1SLVA 5T5NG 2DQDH 1M2OA 1DL7L 4U1HA 2CR3A 1H6TA 2ZUXA 4XI5D 3PHSA 1ACCA 3Q9QA 3CVIH 4YHLH 5A2CA 2KL6A 5E1HB 3RB5A 2OMVB 4PJEF 5IFAL 3T1FB 1E28B 4NCDA 1A6ZA 1I1AA 3DGCR 4I77L 2BNUA 2VLLB 1OT1A 1FFNA 3SPGA 5IQOA 2C26A 3GK8H 3ZDXE 1JV5A 3HLAA 1BAFL 4KUCD 2C9RA 1FO0A 4L4TA 7FABL 1AR1C 4U1NA 2PR4L 1Q1JH 5L2KB 2YMXH 4NKMB 1MWAA 2Y00A 3ARBD 4PJXF 4PUBL 5EEYA 2OTWB 5GGQH 3ULSA 4Y2NA 3VWJD 2IV9A 2E6QA 3Q5OA 2ITDB 2P5EB 4LFHD 1KLUA 3CFQA 2YIHA 4RNRA 5F1NB 3OAUH 2VN4A 4N6RB 1RZKL 1KNOA 2B5IB 1MLCB 1FA4A 4R2GC 4J8QA 3W0WB 3IRCA 4L8CA 4Z7OB 4U6YA 1RUPH 2BNQA 4BK5A 3L3JA 3EJUA 3BMWA 2Y5EA 4LMQE 1RAMA 1JGVH 1ZE3C 4UNUA 1KLFB 4U31A 5EFIB 1XH1A 2FD6L 2VISB 5HGHA 4X8JB 2B9BA 3NIDB 2F5AL 1NDGA 5KYYA 5FYKE 1S5IL 3FUKA 3VU2A 3A24A 4RMUA 1G9NH 3QPXH 3IDYC 1TG8A 2HVBA 3HS0B 4F24A 3IDNA 1WIOA 3S35H 3HN8A 3RIFK 1JNJA 3FK3A 3CZJA 5DC4B 2H6OA 1AI1L 2YAMA 5SWSE 2RH0A 1HKFA 4DN4L 1J1XL 1J5OH 5HHNA 3ARVA 1KY7A 3BYYA 1HXKA 3UIZA 3ZE1F 4K07A 1BREA 2PPEA 4Y1AB 3WIAA 4KX9A 1JCKA 2WWOA 2NUTA 2ZCKL 4U6TA 1XF5B 3FO1B 4PRHA 1LDPL 1BD2E 3HZMA 4MMYB 4EN3D 5B38B 1G94A 2C7UA 3OKNB 2KLRA 4X9IA 2V5RA 4MAYC 5JHDB 2VR3A 4DGUA 3QBTB 2YN5A 4PJ8B 1WPCA 2WY3B 4L1TA 4QNPF 4MXWH 2DLEA 4L5FH 4YHKL 3Q8BA 4WENB 4CSSA 1MRCL 3BQUA 1A6TA 3VGDA 5DMGC 4JRYE 5K59F 1TFPA 1P5VB 3OPZH 3DKHA 4KQ3H 4QTHA 1PSKH 1OAXH 3JVGC 3GSQA 3TCTA 1UEMA 5TE6H 5IB3A 1HCFX 1EHLH 3ECVA 3CFCL 4HKZA 2HUEA 2GHWB 2WQRA 4M8QB 3MUGB 1XIWB 5SWZD 5BMFL 2BSTA 1CICC 3O4OC 4DGYL 1UASA 2N7SA 4WNJA 4OZGB 5I8KL 2BCKA 4LRNH 2EUXA 2V7HA 3SDDB 3V79C 4EDWH 2BY0A 2Y5TB 1U6AL 3M45A 4L37B 4AQ1A 4P4KA 4XNQB 4PS4H 3IF1B 2CK2A 1U8MA 4GAYA 4PH8A 4QLRA 3ZKQD 5E8OB 4PREB 3FW6A 1MEXL 2R7EB 4L4JA 4H8VA 4WSJA 4OCSL 1R3JB 2EYRB 1DQLH 2MOGA 3CSYA 4P2QD 3WMQA 5FA4A 2QSVA 4G7YH 1XH3B 3ZRCC 2XWCA 1ONQA 4LEOA 4GP5B 4GOSA 4L4VB 2OSLB 2ORBL 2VLKE 4PG9B 1BLNA 1RVFL 5D7LB 2X44D 1IKFL 2D7PA 3IPFA 2HG5A 1C5BH 3BW9B 3U83A 5KN5B 3B5TA 1PX8A 3F5WB 3BSZL 3TH2T 4PJGF 3VGBA 1VFMA 1KF9B 2HX8A 3IWVA 5IQ7L 4M1GH 5KJ4A 3QXAA 4PD4J 2F7OA 4MCYA 4MVBD 3CMGA 5FYLL 4TUKL 4XMLL 3PG2A 5FYKH 1M3IA 1F4XL 4HUMB 4JAMB 4NT6A 5I1DA 3GXUB 5DUPH 3DHUA 3UG9A 2KDYA 2BVOA 4L1LA 4KUZL 4QHLA 1D2PA 2JLLA 2AEPH 1QI5A 5F3HB 1KXHA 2OSYA 1CGVA 1TQBB 3NFNA 3OE8A 4N8VG 5BS0D 2ITEA 1QNIA 3AREB 1V8HA 2AJZB 2Z8SA 2Y7QB 3F85A 4FKKA 5BZZA 1FIEA 4UOW1 4BFGA 2OMWA 2QFRA 3U79A 4KJQC 4F7MB 4HWBH 4XX5A 1YAIA 5AB2A 3VXPB 5GS0C 4FYSA 5C1MB 3U36A 2CQVA 1P5UC 3NJGA 4JY4A 5EBGA 5BZDA 2VT4A 3WIHH 3V0HA 2WINB 4JKWA 3GJEA 1ASQA 4JR8A 2QGBA 4N0CD 5L8KB 3QHZH 1MFAH 3HHSB 4YSEA 2GJZB 5J0BA 2W92A 5AZ2L 4LVEA 4YSCA 3GI9L 5F1OB 3ZMRA 4HGKC 3MX0B 3TIEB 1RIVH 4TSBH 3V0EA 1YNKL 5IB1B 4LKCA 4X7TA 4NZRL 2Q20A 4RSYA 4WVRA 5BOPA 4LASL 4UQ2B 1PLAA 1OAUL 5IBTH 3VRLE 3FQXA 4HPYH 3UTYA 1EO7A 1JPST 3F64A 4F8PA 5I1EL 5I1HH 5IB2B 5E94B 3ZJAA 2ROYA 4WKZB 5FX3A 3S5LA 1N6QL 4K5PA 3HANA 2FWSA 4OLZL 3UZCA 1JD9A 1OCOB 4Q2ZB 4RFEB 3ULUL 1Q9KA 3NIDE 5FYKU 1FVEB 1G0DA 3EBGA 1EXHA 1RK0B 3QFDB 1F6AB 3CZUB 3O11A 4XPBH 3R4RA 5F0JB 2RMNA 1DBBH 3ZDXF 4K15A 3MRLA 4MRCA 3C5ZB 4W4NA 4Q9RH 1OSZB 4FC3E 3MYJA 1HHHA 4HP5A 5AKVA 1C08A 2PNDA 2XN9B 4A68A 4AT6B 4IRJB 4FA7B 4LCWE 1KG9A 1A6AB 3HE6A 1IAIH 1NQBA 2X9YA 2D2OA 1NCAL 2VXQL 3ZTCC 2P80D 3T2NL 1NCWH 4F5CE 5HYIA 2Z1KA 4KKRA 4KQ4H 3L1FA 1HDMA 1FNSH 3ROLA 2VCOA 4Y9CA 1S7TA 2BZDA 1RP9A 3PDGA 3WN5A 4JFFA 4EQ2A 3ECBB 1AR1D 5CN2A 5SX4I 2IQ9H 1KULA 4KOBA 1T1ZB 5EPMB 5DC2A 3II3A 4DN3L 5E2TL 3E0GA 4WTWA 4MJJA 3HBGA 1J12A 2FSDA 5EO0B 4U1SA 5C0GA 3EFDL 2MQGA 1KGUA 3MLRH 2ZCZA 4JVPA 5DZNA 1HHIA 1B0RB 4XP9L 4NOBA 4ODVH 2DQGL 4DK5A 4WLCA 1CFBA 1G9MH 1HL9A 1YEFL 3VFTA 4P3DA 2FCBA 3ZMNA 2X4OA 2BCMA 4R2GD 2AAAA 2L3BA 3ZQWA 4OF8A 4NX0A 2A74B 2Z73A 1VESA 4J28A 2YAEA 3CFEB 5E9NA 1OCCB 4RVBA 1L7TL 1YMMB 3H0TB 4MMZB 3Q8AA 4WFHD 3CPUA 1BFOB 4QHMB 1T89C 4L9LB 4G7RB 3TYGL 1BECA 3UTZA 4JKKA 2NY2B 2JIXA 4ZW3A 1H3PH 2E6JA 3CVHA 2ZUQB 4PHXA 2YAPA 2VYRE 4XR8C 4A66A 2XOTA 3UBXI 4OV0A 3CHPA 3IGAB 5HGDB 3MO1A 5E5RB 2VOTA 3RWEA 4GAGH 3EUDA 2OP4H 3Q8CA 3TNNA 2KSYA 2VN3A 1A9EA 2V33A 4JDEB 1KMEA 1CD9B 1U93A 4ZW8A 2IH1A 5BRZE 2VXUL 5EMYA 4MB4A 3RGVA 1MOEA 5D8JL 3GZPA 3WS3A 2FWLB 1Q38A 4WI3A 2AJYL 1J7VR 1EBAA 3ZE2E 4DPCX 2KPNA 2X72A 2LFGA 2E7LC 4EKXA 4HFWA 2CALA 3S37X 1I8MA 1RK1A 2NTFA 1IM9D 1XGZA 5A8EA 1F8TL 3H9YA 4GUPB 1TZHB 2WLKA 4TNEA 5DMGD 3G5XA 2K4AA 3CC5B 1MHPL 3T0VA 4GO9A 5I0XA 2KERA 3ARDA 4K9EH 1PYWB 3S36L 4NQQA 5ESQA 1OB1B 4QHPA 3ZO9A 3U6XS 2D0HA 2CDGA 2DM4A 2G60H 2Q9OA 2BHUA 4O02B 1KWKA 1JGEB 1NGPL 2WBJA 4UTAL 3WOVA 5DRZA 4BFNA 1T1YA 3W39A 3V0AC 5CWSA 1NAMB 1S6NA 4AUJA 2JCCA 3S98A 3S88H 3FO9B 2I26N 4G42B 3CAFA 2C34A 5FLUA 4ZOEA 2VIRB 2IANE 2YSSB 2O6PA 5C0DB 2Z31B 2AVFA 1BP3B 4UT6A 2R56H 5SWSD 1LEKB 2V6HA 4FQHA 4U4BA 3O2VH 3NJVA 5CCKL 3DHPA 3FQUB 1BD2D 1QBLL 2BHYA 3QJHB 3UJJH 5EB9A 5GRUL 1N59B 4OZFB 5CINL 5HHXL 5FFLA 2Y2TA 1JXGA 2N59A 1HHKB 4DKLA 4LVHC 4H40A 4N2EA 2B0SL 5CEYA 1JUFB 5MEPA 2IOMA 5E08L 2R69A 5KVGH 4JLRA 5EBMB 4JFZL 4LLWA 2W8CA 2JTYA 3HAEB 4JRYD 1DJSA 3WFBH 4LZKA 4ZQKB 1TVHB 4XT1C 4X32A 3MGOA 1DZ0A 4F2FA 2OTUA 4LSUL 1KJMB 5FCSH 2DQUL 1JPTH 4MXVE 1ZK9A 5CSBA 1A1NB 1QR1A 3GWJA 3ZTNL 2VH5H 5JNYB 2PW2B 3BC9A 3G5VA 5J12C 1A6VH 3PNRB 1BXXA 2X3BA 1LO2H 3TVMA 1A1MB 3KPPA 4RH4A 2HKHH 3SCMC 1XCTA 3OB0H 4KXCA 2R2CA 3CE1A 3QXDB 4LP8A 3DBXB 2X0VA 5C2BH 5IEHB 3I75A 4Y4HB 5TGBA 2K4WA 1Q9OB 1WT5A 3IKCB 2H0JA 4FFYH 3BYTA 3OD3A 4KJQD 5TE7L 5I75B 5DD6B 3ULVE 3ODUA 5GRYA 2BM3A 5C0NC 5GS0D 4BUOA 1HTYA 2YGVA 4ZAKC 4IBVA 4Y4KC 2FLMA 2ZUSA 2AF2A 2B2XH 2NSMA 2XBZA 1K5NB 4H2AA 2R4RH 4LSVH 4TKWA 4EN2A 2CDFB 5F3BA 3NY8A 5A3IC 2KBGA 5AAWA 1MCRA 4LNVA 5DTFB 1CXIA 2CJ3A 3N91A 4LDCA 4AV4A 1TQCC 2J12B 5DJ6A 5ISZE 4FNLH 4FTVE 1ML0A 2VLKD 3VRLF 4GG6E 1PKOA 4KXZI 4BFOA 3QBGA 1C8PA 3WXWL 2E74C 1NC4B 1KWGA 3II1A 1IW9A 1E4WH 2B4CH 5I30H 2HLFC 1CGSH 5M7QA 3NIDF 4RIRA 5IGXL 2J2ZB 2J88H 1ULVA 4LSSL 3RDTA 3G04A 1ODUA 2DQTL 2XTJB 3F04A 5EC1A 2VDPL 1G6VK 2W88A 5E00A 3G7TA 3VXRE 4AIEA 3D0VA 1SFDA 1JYXA 4MA3A 1I7TA 2DD8H 3GEWB 4RAUB 3X12A 3UDWC 1VPOL 2I20A 1KIUA 2WQAA 5AVXB 1NDMB 4LIQH 2O93L 1QRNE 4IKKA 4AMKH 2EUVA 4HXBL 3EGSA 4EIGB 1ZLDA 4U1IB 3WY3A 4WWKA 4AZ8A 3KLLA 1QTYT 3UZQB 2WB7A 3GSOB 1YNLL 4DGIH 5C9JA 1L6ZA 4XVSL 5D2NE 3BKYH 1FN4A 3UTXA 3BUIA 3QG6B 4FLOA 3DGGA 4X5WA 3A67L 2CGZA 4QRPE 4HWLA 3WFDH 2WTRB 2F5BL 4J6RL 2D3VA 3DRTB 4O58L 3V0WL 1MNUL 3BH8B 4OZHB 3ZVVA 2I07B 1Y6KR 1MJJB 1XD0A 5JPNB 2WAHA 4RMRA 4EI6B 2YEVB 1ZHKA 5DJCB 4F7TA 1CE1L 1ECZA 3N85L 3BP7A 5IQMA 2JJWA 4G1MA 4CMMA 3QWRA 4WO4A 3LRMA 1EO8L 2CIIA 1LO3L 3T3MB 4BGLA 4DVBB 3BVNB 4D94A 5AAPA 3QWOB 4BFJA 4AUUA 1UJ3A 4CVXB 4G6FB 3FFCB 1MDAA 1H15B 4C56E 4X8GA 3ESVF 4PEEA 2DEYX 4X6CE 2VMDA 3NS0A 3ETBF 3P73A 3KBPA 2F54E 3GMRA 5E4EB 3DVGB 3JWNH 2VN5A 1FZKB 4EI5A 4MZ2A 4XPTL 4ZTPH 2Y03A 5F3FA 4B3EA 5IVOA 3VSQA 1QPKA 4GXUM 4ABVA 5JJNA 3K5SA 3WY1A 4CDHA 1RIUL 3ZU8A 1BVKA 3C12A 4MQSB 3ULVH 1MI5A 5A6LA 5D2NC 4XCCH 3RPIA 4HQQH 1YQ2A 1NDTA 1N19A 4TNWF 3FO0H 2PPAA 2YXMA 3QP3A 1LE9B 2NY5H 3NFPB 4XVUC 5ACZB 3E3QE 4RMWA 1NGXA 3BIAX 5DEZA 5CKAA 3MQIA 5G4MA 4LCWD 2B3RA 1U3HC 3TBCA 1GGIL 4MNGA 5EUOB 1ZOXA 1MCIA 3QEHA 1L9PA 1U2YA 2DLHA 1QKOA 4F8OA 3ZE2F 5EIIA 3X13A 2JJUA 4KVPA 2Y07H 2FZ3B 5DZVA 5DK0A 2VDKL 5KS9B 4KGJA 3VJ6B 4C4UA 3BAJA 3VD1A 5GHWH 4OF3A 3BPOC 3FPYA 5IBUB 3GNMH 2G9HA 4ANKA 3FULA 3V4VB 4X83A 4G43B 1A14L 3RUGA 4NQEB 1AXSA 4LOVA 3BKMH 4PJBA 3VXUE 4M93B 3TXAA 1TTGA 3MBEB 2IWFA 3NGBB 3N41F 4PYHA 3I3EA 4Z7VB 2RH1A 5IW6A 4JMNA 5FA3A 3MOBH 2HX7A 3NESA 1CDCA 4GRWE 3RTQA 1QFWI 1Z9MA 1GZMA 5KBDA 1OARL 3OKDB 1ZS2A 2HUHA 4GAAA 4YNYA 5IF0A 7PAZA 3GSUB 5AQ0A 3LZFL 5T1KA 1IGMH 1X4XA 3ZIMA 2FBOJ 3ZTDC 4A2GA 4QRRE 3VFSA 3P4OA 3EOYG 5H2MA 2H1XA 5BV7C 1DEEA 3Q43A 3MGAA 4QKTA 1FFQA 3WI9A 1RHHB 1J5CA 3QIUA 5EZLA 3BUQA 2EO9A 4C83A 3HB3B 1DBKL 1Z6JT 3LH8A 4PJEA 5EZOH 2XXMB 4EN3A 1MFBL 4JPIB 3WUWB 2N7BA 3OXSA 1L6PA 4AY0A 1IEAA 5DFWH 1AKPA 4HJJH 1YY9C 5BUAA 4OFYD 4OGQC 3L5IA 5AVZB 3BEVA 4MCZB 4QRAA 5BRZD 3NRQA 2YC1B 3WFCL 1UOKA 1S54A 3P30L 3LQMA 1OQOA 3MCLH 2FO8A 3MNMA 1DQTA 2BWIA 3DVNA 3NZSA 4N1HB 4NIKB 1XH2A 3RLSA 3THML 3KVPA 2CGRH 3DO7A 2O6CA 3CN3A 3JV6B 4MXVF 4PJXA 2WIMA 4O02H 4BQ9A 3RWJA 3D85D 1FL5A 1HN1A 1DCEA 2H4EA 4GQPH 4XHJC 2J57A 1I3VA 2XV6B 3IGFA 4IBTA 1NAMH 3SBWC 3HBZA 1CFSA 1QPXA 1BPVA 5C0CE 5H2BA 3E80A 4ALAC 2MJWA 1KIRA 3QFJE 2CLZB 5KSAB 3IJEB 3QRGL 3PNWB 5E5MB 3KPMB 2A1WH 3PREA 3B34A 1T04B 1UM4H 4MXQC 1T6BX 3ZGIA 3ULVF 2P8MA 2F19L 4R8WH 4HUWB 4EOWL 3SCMD 3F6JA 4HH9B 2DRUA 3L1GA 4GI9A 3K72A 2IAND 4RLDA 5BRQA 2FSEA 3WFZA 1UD8A 1KT2B 3LRHA 2CKBL 4OZFH 4OTXL 3OR7A 1EAQA 4MJ5B 3SODB 3D39B 4NUGL 1BRXA 4P2QA 5HHMD 4C47A 4W9CC 4Y19B 4K94C 1IEBA 3RJQB 5C0ND 2YPKA 4KX7A 4GG6F 1KCSH 1KJ2A 4ZAKD 4Y4KD 1NOAA 4KXDA 3HAEH 1BZOA 3FOLA 4M43H 4ETQB 1LL1A 1KFAH 4PJ5B 3H2PA 4RFOH 2GITB 3WD5H 1NIEA 2HJFB 1KYAA 5A3ID 1JGLL 5F44A 4B9YA 2A2QT 4QHNA 3BP5A 3T3ME 35C8H 3QI9A 2PTVA 1CDGA 2XJLA 4JZJA 4BFBD 1D5BA 1QTPA 2V9TA 2AEQH 4GRWH 4UCFA 3DRQA 3M1BB 1RQ5A 4WW2C 2HVKB 3NABL 4JJ5B 4KVNH 3FFCE 3B56A 4L8BB 2H2SC 4FYRA 4S1QH 4WUUE 4X99B 5C2UB 4RDBA 3EUUA 4N5UA 1E9QA 3L4XA 1HH6A 3D87B 5F71A 3SPVA 2HRPH 2HLFD 4Y5YC 5DZJA 3ESPA 1FG9C 2J25A 1CL7L 1BAWA 2APVA 3IWUA 4BSVA 4J6IA 3SBQA 1L6XA 1AHWB 4P2RB 2HT4C 4JG5A 4NNYA 3BVDB 1HFUA 1NIDA 3TCLA 2YPVH 5JW5A 2DM3A 1T0MA 3WL9A 3E8UH 3N40F 2BRDA 1S9VB 4R97B 2EACA 4CKQA 3QO1A 5I0WA 4K23L 3PQRA 2CIKB 4ZFFA 4X8XA 3SJVA 2VE6B 4N0YL 3GS7A 3I2CL 1J8HE 2Z1PA 4IBWA 4LQFL 4W9LC 5BVPH 1EK3A 2H6PB 3ARRA 3FB5A 4GRVA 5B4MC 5GSRB 5B7FA 1H6EA 4QRUA 3IDMB 3OKMB 3MVSA 1CF8L 4R5VA 5CU5A 4MD2A 2JB6B 2DQMA 4U3HA 1ZLSH 1T0NB 4Z78B 5ISZD 2DBLL 4FTVD 1UOWA 5FKPB 1OCZB 1BMWA 1JRHI 5FIEA 3BLPX 4FQXB 2LTQB 1RSYA 3MRFB 4X6CF 3X17A 2EXYC 1W72L 3PWNB 4XRCA 4UYPA 1E5YA 1JVKA 2X5PA 5MEOB 3QZMA 3T2QA 3EHBB 4ABUA 3S5YA 4XX1G 2L7EA 1U3YA 5C9KA 2OTPA 2CBMA 1YCSA 2EDJA 5JLZA 1LK2A 2DLIA 2AMUA 5LNEA 1JN6A 1H9DA 4GQZA 25C8L 2XZCL 4TVPE 1QNZL 5F93C 1KLGB 5I5RA 1WZLA 4PJGA 1CIUA 3VXRD 3CG8A 1YEEH 3D09A 3T2PA 1WEJH 3HMXH 4PLKC 3TA3C 1WK0A 2WO4A 4W9HC 4GG8B 1QRND 1BQLH 3BAXA 3E6FA 4HWZB 4MNHA 3LEXA 1Q9WA 1EERB 3FFOA 5IVXB 4DAGL 1PNDA 2PYEA 3QDJE 5B8CB 4CMHB 5DUBA 4GMTH 3FMGL 3QCTH 3OKLB 3WNLA 2WSKA 1PG7H 3EOAA 4QRPD 2P80A 2HKFL 1J86A 4XVUD 2DBJA 4FP8L 1IAKB 3BUBA 4HHAA 4IYKA 1UEYA 3D3VE 4HMEA 2PWEA 3AZUA 2WQXA 1M4KA 3CIAA 1U3HD 2P5WB 1XBRA 4OF0A 4OLWL 3LPWA 2IOIA 2QZQA 3MOQA 4YWGL 3DOSB 1B4TA 1A7QH 1D7BA 3NJJA 5DUML 2GAZA 3T08A 2BX5A 5DT1L 4F58H 3FN0L 2ICEC 2C3GA 5DWUH 3LIUA 4V2BA 3KYMB 3JV4A 4GBXC 2NNAA 4GRWF 1MCWW 2XTLA 4P5KA 4AXWA 4Q6YA 1AQDB 5ALBL 4HS3B 3KJ6H 4C56D 3D1MC 2BERA 1TKWB 2WZ0A 1ZWIA 4K8RH 1EAOA 3ATBA 2WCSA 2Y6SC 3BH9A 4Z95L 4NNPH 4XO5A 2F54D 5DI8B 1X5YA 4M1DL 4F7EA 5BUGA 4F9LA 1DUZA 4WHDA 2GBVA 3JT2A 2GFBA 3AY4C 4JHUA 5DD1L 4DUXA 4OFPA 4Q0XH 2ARJB 4TPRH 1SYSB 1NAKL 3OJDA 4AENB 4JY5H 2PLTA 4KMQA 3VGAA 2QVKA 3CDYA 4UB0H 2EIMB 4IDJL 4TL5A 5I19L 4I2XE 4NZUL 4WI8A 1DVZA 4OFIA 3AMLA 3RX9A 4XPGL 3H6JA 4P3CL 1SOSA 2EYTA 2E59A 5EOTA 3I3BA 3LEYL 2Y23A 3V5DB 1TJIH 4HGWB 3QDGB 1VKXA 1PZCA 2C3HA 2E46A 2DQFB 5T1LB 5E2VL 5CGYC 5E51A 3ZSTA 3HS8A 5LGJA 2B1AH 3V4VH 1L7IL 4D8PB 4PRBA 1YY9D 1J8KA 2DICA 1D7DA 2D31A 2DWXA 2OMZA 3RILA 3WUZA 4XNDA 3II2A 2GSGA 3GMNA 3QUKB 3EFOB 5AW4B 3UPAA 2XN0A 3TF4A 5I8OH 4RAHA 2DN7A 1KZQA 2O5YH 4I8DA 4FHKA 1CLZH 1MJ7H 2XWJA 3FT4B 3VXUD 2WBXA 5JXEC 3JVGA 2AS5M 3DSNB 1RZ8A 3RVTC 2UX6A 2BRQA 4XPHH 3SKJL 1BEYL 2NXYD 4ZO9A 5E8EB 3SZ6A 4LHUD 1A21A 2NQDA 3WMPA 5L6YL 3IJ9A 5F9OH 4ZMYA 2AQTA 5HYSA 1L9SA 5J4MA 1H0DA 4E5XB 3L4WA 4JDZA 4HUVA 5F7DA 5GS1A 3JUZA 3COOA 3EJSA 3MREA 2CBOA 1WQVT 4EDXB 2ZKWA 4QRRD 3HNVL 4PAZA 1BRRA 3EOTL 1H8SA 4MXQD 2DTSA 3F65A 4OM0H 3ZGHA 4B50A 1NGQH 3V95A 5T3XE 3D7PA 1R3LB 2Q3XA 4PY7B 3H9HB 5SWSA 4PRNB 1WFJA 2WUBH 3MXVL 4KTDH 4WHTA 4X50A 2YD3A 2HCZX 1JYVA 1RUQH 5AL0A 1TVBB 3C5JB 4N8CH 4R96B 2JJTA 1ZEAH 4BZ2A 1BD2A 1DTUA 3ABZA 1ES0A 4LGSB 4HWBA 1ADQH 1YY8B 2MPAH 4WAVA 1I4FA 2FT6A 4ZDHA 3MXWL 3SGEH 1NL0H 1VHPA 3T3MF 3RFRA 1KTLA 3LS5H 3Q1SL 3TBYB 2AK4E 4XXCC 4DVRH 1FVCB 3IFPA 1HEHC 2HSIA 2NX5E 3SE4A 1SOXA 3LQAH 3OC8A 3EOBA 4C54A 5K9JL 2FR4B 3DX8A 3I6KB 4AC2A 1XTMA 4H25B 4WZ9A 3OSKA 3N1GC 1JK9B 4XNMB 4M5SA 3CFBB 4CL7A 5JHLL 3BRFA 3FB8B 3L7FB 1OOAA 1DBMH 1I1FA 4TQPA 3RU8H 3Q6FB 4WV1B 3HAPA 2PCPA 5IHZB 2YMOA 3HI6H 1OM9A 3WV0A 4FDWA 2H2SD 3VRJA 1C5CH 2VQ1B 2YUXA 2XKUA 5C0CD 4WTXA 1IFHL 2L8AA 4WI0B 5T1DH 1K8IB 3QFJD 4GW5A 4OM1L 3U6RB 3UO1L 3Q6GH 3QQ3A 4EVNA 3V0FA 2X09A 1X5GA 2HT4D 4FZ8H 2RFXB 4YE4L 2JK5A 5KVFE 4PJ9C 1CB4A 1H3GA 1KCUH 3LPPA 3MCKA 1KG8A 3C87A 3O6FA 3L3HB 4Y9EA 2MKLC 3NN8B 2RJMA 1X9QA 2ED9A 3VE0B 3OKOA 3OLIA 5CLXA 4ADGA 2AI0L 1LK3H 1TZOA 2ZXAA 4LVNC 3VG9C 5IHHA 3FT1A 4R0LC 2LABA 4MJ4A 3MODH 3DJ9A 4HHWA 5F72S 3DX1A 5MERA 3HC3H 1HHJA 4IKJA 3LJ3A 3KGRA 5IBUG 1H3UA 15C8L 2IG2L 1OK0A 2OMTB 2V2TA 1LP9B 5B4MD 4AKPA 3L6FB 4JO4H 4NZFA 4OCNC 3MRQA 1L9RA 1AGEA 3R06A 1J9QA 1BM1A 1X44A 2GJPA 3PWPE 4BKLB 1S9XA 1SGKA 3US0A 3SQOL 1INEH 1PZ5B 3N44B 3PE9A 4Z7VF 4CILA 3KLAB 3UTPE 1D5ZB 4IEFB 2M1KA 1NC2A 2EXYD 5DZLA 4PGZA 4PCYA 3EH5B 4WUUD 1MHCA 4JFOB 3APCA 2FGWH 4B41A 5INDB 3CDFA 2ZAHA 3RDJA 3HTLX 4NPKA 5DLML 1T66C 1VZGA 5C09E 5EEZA 1KYOJ 3Q44A 1HEZB 2CUMA 1N8OE 2N1TE 3QAZB 4QUOA 4FA6A 1T2JA 3SPCA 5C0IA 4U6VH 5T3XH 2IGFH 1MREL 1OTTC 2V4LA 4Z5RB 4KO5A 1ZCRA 3AM8C 2Y3AA 4HJUA 4HPOL 2N0MA 4KY1H 3MKGA 2GCYB 4FKEA 4PLKD 4Y9GA 2BVQA 2YXWA 3TA3D 3TA4D 5I74C 2YQGA 3WUWG 3M86A 3T1FA 2DWYA 1E28A 2YO3A 2OMXA 5G53A 3CDGB 2X7LA 3IXAA 1OB0A 1X5FA 1EEYA 1ZLWK 4ANUA 2CXKA 3JV5A 1ET8A 2ZAIA 1OPGH 4PWGA 2D03L 1J8HD 3GGWA 3CWGA 1UWXK 1RZIB 2EIJB 2YFNA 2WXOA 3U1SL 4B6ZA 3JWDC 4L0PB 3VD9A 3VI3B 3U4BH 2XNAA 3GIVB 4R83A 1T80A 3KWWB 5B1BB 2XWDA 2OTWA 1KELH 2WLHA 3W5NA 4JGMA 3D07A 2AKRB 4HIHB 3UTTB 1QEWA 3QJZA 3MOAL 2VSCA 3DURB 4N2MA 4N6RA 3NEOA 2AGJL 4FFTA 3SE8L 1HJBC 4IBQA 4RISL 4GBXD 2HPTA 3QJXA 2E56A 3OKYA 3ILDA 4TVPD 4NN6B 5K5YA 4GW4B 1F86A 1VEPA 1A4KB 2VISA 1C1EH 2Y6SD 3FZUD 4X8JA 4W9EC 1YEWA 1A7PH 4IQHA 4FCHA 1IC1A 1KCRH 1E4JA 1CVSC 2AK1L 2E9GA 3CCHB 3L5WA 4XMKL 1RKRA 3NCJH 3K6DA 2FUQA 3LY6A 5H2NA 5AVVB 3U1PA 3U4KA 3ARQA 5E6RB 3P0YL 3QDJD 3NYAA 4F8QA 4DW2H 4JG0L 1BQHG 3NRFA 5J7AA 1G6RB 5AW0B 3C60C 3VG0H 4Y1AA 3LNDA 3RFZB 5TDOA 1XF5A 1MRDL 3QEUB 3T0EB 3UYPA 4MMYA 3BISA 3OKNA 4QHKI 1FE8H 3D3VD 3HMWL 3MLTB 1FI8C 3CHXA 3PQYE 4OLUL 5KSBB 1R2NA 3ATFA 2Q8BL 4G2AA 4GMSH 4AM0A 5J9PB 5JHDA 3L4VA 2A73A 5CGYD 3GSXB 2GK0B 4YX2L 3KPNA 4PJ8A 5K39B 4NO5B 1M7DA 1OAYH 2JKTM 3FQ2A 2EABA 3M1OA 3QIBC 4NYLB 2QQKH 2WQSA 1P5VA 1UACH 5T5NF 1XGTA 4M6AA 1KXTB 3UG3A 4H1LG 4TOYH 3QCVH 4M7LH 3SPHA 3TFKC 1F6FB 2B1HH 1OAKH 5B39G 1KTKE 4J8RA 1T6VN 4M8QA 1AGBB 4KMLB 2MIZA 3MLSH 1XIWA 1CXHA 1ANUA 5D6DA 3RVTD 3O8XC 2GQHA 1ACXA 4X7CC 3GI8H 3DVIA 3RL1A 4B9PA 4OIIH 3ZDZE 1M2VA 3MZGB 2VDNL 4X80L 1NM9A 1OZTG 3GBML 1GW0A 2Y5TA 3G6AB 2P44B 1WA0X 2WXKA 3C8KA 3IF1A 5AOKA 4S0HA 1EXUB 3KE0A 2EEFA 4PREA 5H37H 3ZKMC 1XFPA 2OQJB 1DSYA 3L54A 4W9FC 1O9WA 1R3JA 4M6ML 2CRYA 1R0AH 1IE5A 2EYRA 1DLFL 1XB8A 1J9CT 3CSBA 4HX1A 1XH3A 2G3ZA 4OFYA 3ZE0B 2OX5A 1X4YA 4WEUD 5IG7B 5DF0A 2FT7A 5BRZA 3WN6A 3RA7L 1PFOA 3ZYOA 4L4VA 2O6DA 1IAIM 4PG9A 3GXTA 3FONB 1WE5A 5KG9A 5EOCL 5TF1H 1CLYH 1LO4H 2A4ZA 4Y2DC 2R4RA 1MW3A 1B9ZA 3BW9A 4WTZG 3HS9A 1IQDB 1B9KA 2ZP8A 1MCWM 4NJ9L 2H7WA 4X9FA 4HUKB 3LH2H 3OSVA 1GC1C 4UV7H 4YVUA 3LSOA 5EN2A 3VFRB 1GSKA 4NZTH 4O5LL 5IESL 1ZHBA 2HJKB 1UWFA 4JAMA 3BWUF 1VFAB 5L8LB 2BJML 3NFSH 3SE3C 3BP4B 2G3NA 5IVXF 3DX9B 4FNTA 3T6VA 3QEGL 5IB4B 2V17H 2IQAB 1DQQA 2W59A 4HEME 3BLKA 3GRWA 4HCRL 5EORH 1OTSC 1ND0A 2B08A 2AJZA 2C1OB 1WAPA 3SCMA 2Z91A 4X9GA 5E24E 4IGBB 5FYJE 2IANA 2V5SA 4F7MA 4PJ9D 5DYOA 1BJMA 5T3XD 2NYYC 3VXPA 1Z9SB 3QORC 2R4SA 3CU1A 5ERWA 2GBTA 4XTRC 4FNPA 4F20A 2FQGA 2VSKB 2DYRB 4QIDA 2WINA 3KJ4B 3OG6B 3V4UH 3L95B 5AW3B 4HWEH 4G83A 4TMPA 2EKSB 1F4HA 1BG9A 1UXLA 3KAAA 3HHSA 1ZJBA 3VI3E 4MLIA 4YDIL 3OKKB 4NSKA 1AIFA 5FC9A 1NGZA 2CHXA 2BSDA 4FNUA 2AK4D 3PL6C 1P1ZB 1UTDA 5IB1A 4UAOC 2NX5D 3ARWA 5CUSL 3A23A 3ZTJH 2OCFD 1MW0A 4P46C 4XGZB 5ITFB 1I85A 4OGXH 1KPVB 2J4WH 3TESA 3PWJB 5JR1L 1U3NA 4EMZA 4KNUA 4UQIM 1OL0A 2Y06H 1UB5B 4M7ZB 4YHPB 5IB2A 1BBDL 4MKTA 4FBZA 4IHOA 4IOSD 4LAJH 3K1DA 4KDTA 1T66D 4YQXH 2WWNA 5TFSL 4DOHB 1I9IH 2OJ1A 3LPGA 4LLYA 1CPUA 5E6ZA 1RK0A 2WIIB 3BOVA 2WN2A 3QFDA 4ZTEA 1OTTD 2UY6A 4QTIH 4AVIA 1QLRB 1MZYA 2R0LH 2I35A 3HAOA 5D5MB 4YBLB 3I02B 3KPQB 3EGDB 3SKUD 4AJWA 3VSUA 5F6IB 1OSZA 1BV8A 2DQIL 3H54A 4XP4H 5ABDE 3WEXB 4IRJA 3QUXC 3NCBB 1A6AA 5JOEA 1GPOH 1TJMA 4LAQH 1E5BA 3RPKA 3CQPA 3O0RL 4JDTL 5DQDL 4I3SH 5I1IH 3MFFB 1XTLA 3B2MA 4H26A 4ODSL 1KTRL 1BVLA 4FXTA 3HVNA 3V7AE 4IRZL 4N1CA 5IT2H 1VCAA 4JG1H 1E6JL 3BT0A 3ECBA 5HYJE 1AQHA 3FQRB 4OUUB 3WAJA 1CDJA 5ISZA 3KBFA 4FTVA 1T1ZA 5EPMA 4NENB 4GG6A 4UM9B 1GH7A 1R3KB 1VGEL 3PWPD 5HVGB 3SKOA 3PF2A 3P9MB 1SYVB 3KPTA 4YSPA 3SDCB 3LDBB 4P5RA 3LKQB 3UTPD 1DE4B 5DHVB 2J55A 1B0RA 3V2WA 2NY4B 3DDGA 3FO2B 5ECGA 4NOFA 3T3PE 1HT6A 5I82A 3B3IB 1AH1A 4WHYG 3VGHA 4D0CB 2DQCL 4GQRA 4R3SB 2R2BA 4GKSA 5C09D 3VXRA 4PPTA 3TJEH 3CFEA 3DJZA 3JTTB 2A83B 2OM5A 4WCYL 5DK2B 3OZKA 4ZUUB 3EDJA 3H0TA 1BFOA 1IB5A 3GLZA 4HZLB 4H44C 4L9LA 2BINA 5E0QA 4HYTB 1VFBA 5D2NA 2BY2A 3SDAB 1FNHA 2J44A 4W81A 2H1PH 3NAAH 2NY1B 3WHE1 3CN4A 1KGXA 4EKJA 4QRPA 5D7JC 1SXSA 4FXLA 4A55A 5A7BA 3BPNC 5KVDE 4G59C 1WBXB 5HGDA 4U1KA 2E27H 4B95C 5F1SA 4YFEA 5DQ9A 1S51A 3C60D 1AY1H 1FIGH 1U3HA 4JDEA 4U3XA 3WXVL 1NBZA 1Z5HA 2EDBA 3D4YA 3X3FL 1GGBL 3K8LA 3ARTA 3UX9B 4FG2A 3PIQB 3PAZA 1PG7W 4FN0A 1T7XA 4X98A 3VYPA 3HKZA 2OAAA 1SY6H 5CZKA 4YPGB 5A1AA 3AWEA 1GMEA 5A6IA 3WNKA 2W94A 1XH0A 1TZHA 3QIBD 1ASPA 1FBIL 4BDVB 3P40A 1DZBA 1HIMH 3CC5A 1SN2A 4C56A 2VO8A 1SJEB 4OCYH 2Z55A 3L5XL 3RWFA 1B3IA 1R9FA 1OB1A 2DM7A 4WO0A 1EANA 3K81A 3K46A 2V3FA 4JREC 5DQJA 5DSCB 1JGEA 4PD4K 4G1EB 4I18B 5AG9A 2RIKA 4TV3A 3F2LA 3T65B 4LKXB 5FXCH 3O8XD 4ZW7A 1F4WH 1BBJB 4XCFH 1KGYE 3ME0B 1NAMA 1HYSC 1G6RH 1E2WA 3ZRSA 2QZ5A 3FO9A 4FFZL 1BIIA 4G42A 5FYJU 2TSAA 3H9SE 4UOZA 4BEIA 1FF5A 2VIRA 4W9ZA 5FAAA 3KYKL 2R8SH 3D69A 2CAKA 4K3JH 4XOBA 3RBGA 3REVB 3NACH 1CYXA 5CIPH 2H5UA 4ZMZA 3ZKMD 4G8GB 5JORB 2B5IC 3PWLA 1YN6A 3FQUA 4FQQA 4ORGB 5K1VA 5IVNA 4G5AA 1A6UH 5GS2H 1NOFA 5EU7E 1XQ4A 3PQYD 3K71A 3TEWA 1KXVA 5CD3A 3VD7A 5LWEA 3E8VA 3ESOA 3QNXB 4LSRL 3X11B 2TAAA 4GXVH 2HXAA 4LLMB 3AG4B 1JUFA 4FJYA 1RPKA 1TMQA 3HARA 4XXWC 5FB8A 4ETYA 2G2RB 5J6HB 2K9FB 2E9JA 2F1EA 3HAEA 3WY2A 4Y2DD 1SRDA 4X5XA 5HDBE 3O2WL 5G2NA 1KCBA 1Y07A 4ZQKA 3TGXA 1TVHA 3VXUA 4ATWA 4M7LT 4DZBB 5HHQB 1A3RH 5D96C 3EAKA 3MLWL 1GS8A 4AL8H 3ASWA 5FGBA 1MCOH 2Z0BA 1S5HB 4LHUA 1A1NA 3LKPB 4MDIA 5IW3A 4QRTB 3O4LE 3VQLA 4GAJH 4JM4L 1UHVA 4KZEL 1A1MA 2G0LA 4AGMA 4AV0A 1GRWA 4PTUA 2KZBA 1AXTL 5L9DH 5A45A 1S46A 1AZCA 1IBYA 2YD2A 3DBXA 3TP4A 4A6YB 5KVDH 4JO2H 4ELDA 1UKQA 1OTSD 4M3HA 1F3JA 5KYWB 1F5WA 5BXFA 2VXVH 3V0DA 4Y5XB 4XVJH 2R0KH 2ATAA 2NY6B 5DD6A 4R84A 3VI3F 4D3CH 4PS3A 3IFNL 1QI3A 2ENPA 2NYYD 4KXBA 1N12A 4AEEA 3QORD 4PJ6A 2IDCA 2J1ZA 4OR1A 4R90H 5FGCB 4I0PB 1CIDA 3E1F1 5EU7C 1KN2H 3AFLA 1K5NA 1YPZB 2NNFA 2PETA 2RCSL 5DUJA 3D25B 1FNGB 6PCYA 4AYMC 2WLIA 5DTFA 4N2CA 3VWKB 4FPDA 5FR3A 1OSPH 1KOAA 1W2KT 4HLZG 1FYTE 4OD3L 4U1MB 2FQFA 5T3ZL 1OF0A 3L13A 2QADB 3BXNB 5IW1A 2NXZC 1FO0L 2YD6A 5JW4N 1AANA 1JL8A 2XVBA 5C70A 1O5PA 1NIBA 4NQDB 2IFGA 4P46D 5GGSA 1XEDA 3GS0A 1KV3A 1CC3A 4QPEA 1Q72L 4D9LL 4JZNA 4NHUA 5C0CA 1KB9K 2G75B 1DVYA 4OIBA 3US1A 2XTSA 1ZA6B 2X1OA 2Y72A 1S9WA 4RAUA 3S5ZA 1P1VA 1T22A 4PGCB 4ILDA 4XCYA 4S10A 2ZSVA 1ZDSA 4RRPA 2XY1A 5LCVH 2QPEB 2FWOB 3MUY1 3F12B 3GKZA 4K73A 4RQQB 2HFGL 5F88B 4GB9A 1AQKH 5F1IB 4XMVA 2JCWA 3UBXA 1QKZH 4A38A 2R1XA 4AEHL 1SN5A 1A3ZA 1HXYA 3HMXA 1TJHH 4MTMA 4QRSB 5FYJD 3RWGB 3KGSA 1PY6A 1OCWH 4TUJA 2X88A 4JKPH 3O6MH 3DRTA 2QVTA 3QR0A 4N2DA 5KJRH 3QUXD 2I07A 5HHOE 1NLDH 3GT6A 1MJJA 1RXLA 5FKAB 2G4EA 5H35B 2FO4B 3WTWA 1OM3L 4QYAA 4PI0A 4EI6A 2IBZY 4D0DA 1OF2B 4S1SH 4EQ3A 4X6DB 1G1KA 3HR5A 3RPBA 3T3PF 4J3XA 2FLRT 3DVFA 4EIBA 2DV6A 3AVEA 3M8OH 4DVBA 2QVMA 3QNYA 3VX1A 4CVXA 1JPGB 2MEJB 3LD8B 1EJ8A 1MGYA 3C08L 3FFCA 4WUUA 4Q56A 5HBBA 4FXGB 3DX3A 1RY7B 4JQIH 1ZGLP 1DQDL 2ZWYA 4JQXA 3JUYA 2YZ1A 4KHXL 1JF1A 3P4LA 4GUCA 4DETA 4YDKH 4I0CC 4DKEL 1FZKA 3HC4H 2DF3A 3VFGL 4AIXA 1JWUB 1IRAY 1ORSB 3HFMH 4KXAA 3GLEA 2R1YB 3TO4C 3KJ6A 2AXWA 3PV7A 3HE7B 4HSAC 4BBWA 4GEIA 1F4ZA 3EYUL 3TA3A 1TLKA 3OJ2C 1DJXA 1DEDA 2ADGB 4DKTA 2OK0L 4GKLA 2VR4A 2P8LB 2BW4A 3MLZL 2EIZA 2CBQA 2ZYHA 3BH4A 4TM9A 1OAQH 2A9DA 3F00A 5DR5H 3WJJC 5A43C 1J8HA 3Q2NA 3BQVA 1NLBL 2UWEB 1VAHA 1NEZA 2OXHB 4XNYH 5F7BA 5D7JD 4HJEA 4OJFL 1E27B 2DDQL 2EC8A 5EUOA 3U0PB 1FZMA 2FB4L 3HUJE 4G5ZL 5T5FH 1WZ1H 2OL3B 2WQUA 1R5WA 4NPYA 5HYJD 1FORL 5JXAH 3ZHNA 2DQHH 3MV9B 5DHVH 4TSAL 4NQCE 4XC1H 1O75A 2CM6A 2AV7B 3VJ6A 3W9DB 3F01A 4I13B 5IMMA 3PABB 5I2IB 2WCGA 4ELME 4U3SA 1KTDA 4NQEA 3OLDA 5DJYB 5KSUB 4X9YA 4TSCL 4GBXA 4Z8FL 1XF2A 3HG1B 3C5ZC 3LEVH 3MBEA 4Z7VA 3A6BH 4FQJH 4L8SB 1OGTA 5DS8B 3PHQA 5CMAB 1T4WA 1AT9A 5I28A 3RURA 3L17A 3OKDA 5MENB 3RGHA 3OG4B 4WW3A 1JZEA 3T0AA 3VRIA 3BUTA 1HAWA 4YL4A 1NJ9B 5ANME 5LBSH 2CO2A 3AY4A 1QMUA 3VVKA 4BUGA 3OMIB 2F58L 5H2PA 5I1AB 5ICXB 3K8KA 1HYSD 1T21B 4DNLA 4LBAA 3QUZC 3F8UB 3HAQA 4QCIB 1BZ9A 3TIDB 4K5LA 3TWCL 1IBZA 4ISVB 4FZEH 4K7PX 2WSDA 1EZLA 1I7RB 3U46A 2D9QB 4FG6C 3HCVB 4XZ4A 1YPZE 2ICES 3TBWA 1FYHB 1Z3GL 2KZKA 5ALCL 4UU9B 5ACMA 1VGOA 2YC1A 1IAMA 1QUPA 4WEEA 3PWUA 2UUDH 2YSTA 3K2KA 5J1TC 1VFOA 6TAAA 5CZXD 4DHLA 1ADQA 4FMVA 3UJIH 4W4OC 5C0RH 3RP1A 5LN4A 4XX1E 1DN2A 3KW7A 4NFDA 3VXMB 5E2JA 1KGIA 1U42A 5L4IA 1VIWA 2WVSA 3IMUA 1TSRA 2IMMA 3ZDYB 1U9KA 5F7NC 1NPNA 1GTFA 4DT2A 5E8DH 5IFHL 1UKTA 4N25A 2ILLA 1KXQA 1T2XA 4J4PC 4K2UH 2AQSA 3RRQA 2ZX6A 3UC0L 3UPCA 1IE4A 3EKCA 3IJEA 2I9TB 3EJYC 5AD0B 5EF3A 1FWXA 5K69A 4L18A 3KPMA 4BUHA 1GUEA 3FBKA 4P3WA 4OLVH 2HRLA 3MNZA 3R19A 1EV2E 4JRXB 4URTB 2HTLC 4P9HL 4WFEE 4RRPM 5FO9A 5D6CA 2X4SA 3NP3A 4R26H 1AE6L 2W0FB 3KNBA 4G6JH 4HH9A 4I2XA 3U2SA 1QP1A 2YQ3A 3ELQA 5KWYC 1OW0A 3H9SD 3ZW3A 4IU3A 1EZVY 2XQBH 1KT2A 1TEFA 4HZAA 4ZPTB 3QUMA 4MJHA 2XWRA 3KL5A 1DBAL 4WI6A 1Z0NA 4HIEB 3PS6A 3N42B 1PAMA 4B9CA 2DTML 3PGCA 5MI0C 4OD1H 1KB5A 1YO4A 4FFWC 3L9RB 1UUSA 4NGHH 4YHML 5E0FA 3ZY7A 3ECWA 2YQBA 1QR4A 5CILL 1URLA 1Q90A 4XC3H 2P43B 5AFAA 5KYUA 1N0XH 1UA3A 5D7HA 4XXCA 4JCMA 3HRPA 4O4YL 2P26A 3FFDB 3FRUA 2NY7L 3AU1B 1PDKB 5EU6B 3M1BA 1ETJA 2HVKA 5TDPB 4Z77B 2NXZD 4L8BA 4P5TB 4UWQB 4Z3GA 5HHPA 1LD9B 2PP8A 5BV7L 3T0BA 1WBZB 3GZKA 2Z31C 4BXVA 5DEGA 1E9PB 1FLRH 5L88H 1A65A 4A6YH 3CFDB 4TNFA 3K8MA 4H20H 2I7OA 1L0MA 1XZWA 2HLAB 3O4LD 3S35X 2Z92B 1KACB 3BVWA 4X6BB 3Q01A 2Q6WB 1N7ML 4BA8A 3F7KA 4Y1TA 5F89B 2QKIB 5F8QC 3JWOC 3VFVB 1S9VA 1TETH 3CPLB 3HJ0A 43CAA 2XQYK 4PJ9A 1KENL 2Q3AA 2BMKB 4HUUB 4PRIE 3OB8A 3IDXH 4JQVA 2ZKHH 2NY0C 4AEIH 5B3SB 3CAPA 4PB9L 1OTUC 4UIKL 2AJXH 2SEBB 3AS2A 2E7DA 1G1YA 1Q9LB 2IOOA 3O6LL 4HALA 5I18L 3WE6A 1MNNA 5GSRA 3V4PB 5F7EL 2IGTA 4F91B 5LUMA 3WO4B 4HIIB 4RGMC 1M6UA 2G5RA 2CLRA 3O2DA 4Y9FA 4XMWA 2AJVL 3QG7H 2R2EB 3MV9E 1RURL 2V2WA 1PXRA 1JZFA 3VXNB 4DKFL 1T0NA 4Z78A 3CVHL 3BP6A 5FKPA 1JZJA 2NX5A 2B20A 4FQXA 1FYTD 4MDRA 4ALAL 3MRFA 4KK9C 4YSDA 4UT7H 1L9TA 2Y1AA 4X4ME 1TENA 5GJTL 4Y4FD 5BQ7B 4BRJA 5MEOA 3CFTA 4OFVA 1P9MA 1G7JB 1S7RB 3MNDA 3PU7A 4Y4HC 5B1JC 2DEWX 4LCCC 4GW1B 3QWQB 1E8WA 1KLGA 4IOSA 2B15A 4ZXBB 1BAFH 2H47C 4QI1A 1YEDA 2NQ3A 4U2ZA 7FABH 3FTYA 4J3OH 4OT1H 3K6NA 4ANXA 4M7JL 4YZFF 4DO6A 2Q8AH 1IC0A 4L35A 5F9WB 3STZA 1JZDC 1UFUA 5HI5C 3HRZA 4GG8A 1SQMA 4K94L 5HDRA 1LEIB 2Z7WA 3MBVA 4QRFA 3TO4D 4A7VA 5IVXA 4APQB 2OZNA 3L3IA 4U0QB 4RA0C 5B8CA 1YEGL 4IRSC 3L3OA 1I75A 4I4WB 3POCA 5AW5B 5J56B 3V0IA 1AZZC 3TNMB 3DX2A 3HUJF 3H1ZA 2JKNA 4NN5C 1SDAB 5IQLA 9PCYA 1RZKH 3C8DA 1R3IL 1NKOA 2JQAA 2AQPA 1FFPB 4JO5A 3DIFB 1S8DA 5HHOD 3OMAB 2ERJC 5DC9B 2P5WA 4G7QB 1ZPUA 2EICA 1Z5YD 5H94A 2BDNL 2F8VA 3DOSA 4UOJA 3EH2A 2VN7A 4ELMF 3RQ3A 3UTQA 5T1MB 2OV0A 1U8LA 2A9CA 2F5AH 5AKSA 4JFXB 5FYLE 2CJTA 1FJ1A 2F6AA 3NVQA 3PWPA 1S5IH 4UDTA 1MFEL 1XT5A 1I1AB 1SVBA 3ZYJA 3K6SB 2Q86A 2H45A 4YDLC 1IO4C 1IC4L 2X87A 1JNHB 4EBQL 1JV5B 3HLAB 2FUTA 1E4KC 2D0GA 1RD6A 4DN4H 1J1XH 3FHEA 3B9KD 3QWNA 4U1NB 3KG5A 5LBGA 3MA7B 1E43A 2X2YA 2GSMB 5IJKA 1JPEA 5DI8A 1MFCH 2ZCKH 1MWAB 1T6WA 2R69L 2HG0A 5D72H 5DFAA 1UENA 3QNZA 1SYSA 1M56B 4AENA 4PRAA 5JPNC 3WKPA 1KLUB 1BVZA 2PP7A 4K3EH 1S7WB 1ITBB 4RNRB 3SYAA 4GUQA 1CTNA 1WFUA 1VGKB 4QXTB 4YHOH 4LPXA 1GOHA 1KNOB 3WE1A 4WGKA 3OVUB 4P04A 2V37A 4YDVB 4L8CB 1YPZF 5BW7C 3QUZD 1B0GB 3L3JB 1LM8V 1T5WA 3V5DA 3C60A 2JJVA 1YEKL 3QYCA 2DQFA 1R3HB 5T1LA 3CFCH 3NJMA 5IQ9A 2YA1A 4ZOCA 4NDMB 5FW6A 3T77B 1DQVA 7PCYA 5KYYB 4FG6D 3O3DA 5H37A 4YJZL 5TGZA 2I5YL 5BMFH 4DGYH 5HGAA 4B9FA 2HFFB 4HG4J 4FXKC 4DERA 4NQCD 2IC2A 2K6ZA 2DLFL 3EJTA 3G6DL 3IDNB 3OX8B 1S4IA 3SBPA 4YC2B 3EFOA 2IF7A 2FJHA 3L1OL 2X70A 1FPTL 1P0SE 5HHNB 5DD0L 5EU6E 4JCLA 3ULUE 2IH3A 2WXIA 4EZLA 4LCIL 4WDIA 4JO1L 2NUTB 1NIAA 4PRHB 4G9DA 1JJUA 3HZMB 2C7UB 1YAZA 2Z64C 3GHEL 3H3PL 5E8EA 1UURA 1FBBA 2P5PA 4PRDA 4V1DD 3T6QC 1UT2A 1WTGT 5F7FA 4J4PD 4NQUA 4PJAE 3O8XA 1NCCH 1W16A 4MB3A 3GBEA 1HK6A 4E5XA 1XF4A 1NANI 3FRPG 3FNKA 4J3OF 1USZA 5DYSA 5DD3H 3EJYD 1MFUA 5J3HC 3ZKXC 1BX2B 1A6TB 3BQUB 4EDXA 1R47A 4WAFA 1EMTL 2FIRT 1L9OA 2YKLL 1N2RB 1RVFH 2HTLD 4KHTL 5IIEB 1IKFH 3GTNA 3MV7E 1DZEA 4PVMA 4A7GF 4QJ5B 4MNQB 1RI8A 3GSQB 2XG5A 1ITCA 5IB3B 4Z3FA 1KCVH 4KTEH 3BSZH 4HKZB 4Z9KB 2MCPL 2UYLB 1ZHLA 4WUKH 2NZ9C 4K3DL 3ZR6A 1QAWA 3C5JA 1IGFL 1N4XH 5FV1L 4R96A 2I1XA 3QUYC 3VW3L 2DKUA 5FYLH 1XHHA 4TUKH 2EVGA 4JEGB 4XMLH 2BCKB 4BSWA 2VUKA 4X6DF 3JTBA 4PR5B 1GAFH 2HT3C 2V7HB 4JHAL 4V11A 3DSFH 3HKFA 3BUYA 4FFWD 1JDDA 3TBYA 4P4KB 4CGUB 1Q0YL 3GUTA 2APTA 2KUTA 4B60A 1U8MB 2KKQA 3GB7A 4GAYB 1E6OL 2FR4A 3I6KA 4H25A 3GMQA 2VDPB 3ULUC 4XNMA 3CHOA 2XJKA 3L7FA 2HFEA 3P02A 4BQBA 4WV1A 4NP9A 5IHZA 4JO3L 2QFPA 1CUOA 1XF3A 5H8DA 1UCBL 2XA8L 2AANA 1ONQB 1ZKAA 1HQ4A 1KZYA 4LGPB 1CXEA 1JG9A 4QXGH 1CO1A 2EDXA 1E67A 4Z0BL 3WKNA 2YEZA 4ZO7A 2R1WA 2QV2A 1BMGA 4GKOA 4JPWL 2HG5B 1FG2A 3FN3A 5AZ2H 2DI7A 4WFED 1XB3A 2JQMA 5FUOL 1DFBH 3ZO0A 3A6CH 1YNKH 3UAEA 2O4EA 2KSAA 2ODHA 5J1AA 1E7VA 4J3OD 3LX9A 3QXAB 3VE0A 1X5ZA 4LASH 5G5DA 1RFDL 1IBGL 2N3JA 5AW8B 1OAUH 3QORA 3RKPA 2NY0D 5AW1B 3KXFE 2BVOB 5F2FA 3VI0A 2JFCA 4M6OL 1OTUD 3MUHL 4J1UA 5I1EH 2ZCLL 2FATL 2OMTA 3GMOA 1GHFL 3NFNB 1LYQA 4HSCX 1U8QB 3L6FA 1Z9OA 1DO5A 4G71B 1IFGA 1N6UA 1MCQA 1P2CA 3L5HA 1CN4A 3J27A 1PIFA 3P77B 1I1CA 2AQRA 2COVD 3BGFB 4HF5H 2MKWA 3CVBA 1PZ5A 2A7BA 3UZAA 1D5ZA 2V3DA 3U36B 4KK9D 4JY4B 4TQ8A 4P46A 1RP8A 3C9NB 5BZDB 1CL7I 5IFJA 4P59L 1KGWA 2ZF9A 1EEZA 4JFOA 5FS5A 3FF8A 5GRJL 5HD8C 3GJEB 3STBA 3CFMA 4ZRGA 2K6YA 3WEOA 1AACA 1NCAH 3O81A 3T2NH 3VXTA 1PW3A 3RIAF 2YN3A 3NH7L 1U8KB 4BHUI 4LSTL 3ALXA 4HEMA 2R0ZL 4JDVA 5A44A 3QJQB 3T45A 4LKCB 4X7TB 2JMRA 2OYPA 5IHWA 1F56A 4JZOB 4AQ8C 1RZ7L 4POYA 3BD4A 4CAGA 5HI5D 1F45A 3GHBL 3MJ9H 3FQXB 4MMXB 2Q7NA 3QQXA 3V4PH 4X7SL 2UUDK 1F58H 3DI3B 4IRSD 4JPVL 3EFDH 3W11C 4OCRH 2VT0A 4PGDA 5JUEL 3KBHE 3MKKA 4GRMB 5IY5B 1CLOL 2M2DA 1Q9KB 3WNOA 5I71C 4KDVA 2JF1A 4GIAA 4HBCL 1NBYB 3VI3A 1WCBA 3KWWA 5JW4M 1WVZA 1U0QA 4G6KH 1EO5A 4OSUL 4F57H 2UXVA 3SE6A 4Q7DA 4WWNA 3ZL2A 5IM7A 4GSDL 4C8XA 3HW7A 3MRLB 3L4ZA 5H2HA 2XQYA 2ZWZA 4HIHA 3UTSB 1KBGH 1C08B 1E4XI 2VL5A 1A6WH 4F2MB 3P2TA 4PMFA 3TYGH 3DURA 3HE6B 1IU1A 3QDMD 2VLRE 5A2BA 1BVNP 4JPKH 3ABMB 4EZKA 1I82A 5ABAA 3QE5A 1HDMB 2Z4QA 1SY6A 3OF6D 4L1HA 1M0MA 1YEIL 3NJHA 1S7TB 4XBPA 3BVXA 4KI1A 4M5ZL 1M0KA 3ES6A 1D6VL 3MLXH 5EUKB 5HDLA 4P2OC 1KCLA 4CC0A 4J39A 1ZLVH 1EHKB 4UF7C 3CCHA 2IAMB 1N68A 1W6LA 4ZZFA 2G5BA 5D8JH 1IKNC 3TYFB 4U1SB 5C0GB 2VLJE 1HINL 4KKLC 3TN0C 1HHIB 3TO2B 2WVVA 1W8NA 1RPUA 4MNQE 4OFDA 2GT9B 5K9QG 1K3IA 4ZODA 1RCYA 3MBXL 1F8TH 3O6KL 3VFTB 2X4OB 1I1RA 1MHPH 1S53A 4YN3A 3EHBC 2HYMA 3G6JE 4DP2X 4K0OA 1VRSA 2X6UA 1AAJA 4GNKB 3S36H 1QSFE 1XXFC 5HYJA 5AWZA 1P8UA 1NCDH 1QFWL 3IKKA 2E7MA 2KHAA 3GXMA 1UH4A 2VDRB 5JQ6H 5CIPA 2WSPA 1DVTA 2X3CA 4YHYC 4HC1L 4OCWL 5IUCA 3ULUF 3UTZB 1SOQA 5FYLD 3L9BA 1H5BC 3V55A 3BVUA 1ACYL 2V8MA 4NYLA 3INUL 1WC7A 1ZT4B 4N90E 2ETWA 1GW6A 5BCAA 3D12B 2BXYA 4JR9L 3EXLA 1E50A 1MWAH 2AITA 3M1CA 3MO1B 4XWGH 3TT1H 3TNNB 4PJAF 1T5KA 1RULH 4RWHA 1U8PA 4LSPH 5L7XL 1U93B 4LCYB 1GTNA 1AGBA 2IH1B 3DYMA 4GSQA 4AWJC 1KJ3L 1SUJA 1QX1A 2HFTA 2MTPA 4UDUA 5HGBA 5ITCA 3ZLQC 1CLCA 1O0VA 1PD6A 2K6WA 4K7PL 4UINH 4UQCA 2C3XA 1QBLH 5CINH 2ALAA 3UONA 1J10A 2VN6A 1CI5A 3FTGA 4N4YB 3G6AA 4HFWB 4NQTA 1I8MB 1RK1B 1SFHA 4CADA 3JWDL 5J3HD 2IVFC 5CEXB 2HJLB 1EXUA 2O6EA 3G5XB 5E08H 4P9MH 2YCZA 3K6FA 3TFBA 1XAKA 2JLPA 2BWQA 5ESQB 4BUQA 2M83A 5DO8A 4BRVA 3UAJC 2C3VA 2WV3A 5JDJA 2ICWI 2OJEA 1TTBA 5EZJA 2ZQKA 4O51B 5FCUL 3SE9L 3V52L 2NZ9D 4LSUH 5DRZB 2DQUH 1T1YB 3QUYD 3IYLW 3SZKC 3W39B 5CWSB 2FNWA 5CJOH 5EWIH 1WCQA 1DQML 3DHJA 4G3YL 5CJ8A 1RV6X 2GEEA 4YUEL 3ZTNH 3TS8A 3TPUA 2JCCB 2YGNA 4BV0A 2DQDL 3DK0A 4NZJA 1F3DJ 2PTTA 2WQ8A 2OFQA 5HY9A 4ZFZB 1JSYA 1T7VA 1VZIA 2YPLB 4GLRH 4ORZC 4G8EA 5D1ZB 4AQAB 3V6OE 4BZ1A 1M7XA 1LTXA 4YHLL 3CVIL 3FHAA 3WSQH 2XV3A 5FECA 4HD9A 3CBRA 3CV5A 5EIVA 5I73B 4KZ0A 1QEXA 4FQHB 3IGKA 3ULUD 4Z7QB 4ADJA 3KMDA 3VXQA 1UM6H 4YLQT 4XZUA 2X6CA 1OP3K 1EZUA 3I9IA 1G7PB 2FT8A 3MV8E 1VFAA 1OV8A 2V8LA 5AZUA 4RESB 3US9A 1IAOA 2B8OT 4ONGH 4L29A 3X3GL 1CR9L 3U2JA 4HMDA 2H3NA 5DVKA 1YECH 2FHCA 5IB4A 2B14A 4HK3N 1NCIA 5ILTL 4NKQB 1Q1JL 4HU2A 1EZSA 3B43A 1KYOK 3MTRA 4JLRB 2I27N 5E7BA 4LLWB 4Q4EA 4DJMA 2EC9T 2C1OA 3U7YH 5GGQL 1L9NA 2F95A