2QPDB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 36
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpdB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpdB02
2XX1A 1EHKB 1PLCA 4GBRA 2BP8B 4L0PB 1KBWA 1R2NA 5B1AB 4HCFA 5H2LA 2PCYA 4NAJA 1GY1A 1X0I1 2EILB 1CURA 2B3IA 1CC3A 3UABA 3S3DB 5H2HA 5I6PA 3FU9A 1AT9A 2YCZA 1EZLA 2HX8A 1OCRB 3HAPA 1SF5A 4DP9X 4RH4A 3NSDA 4BV0A 1WA2X 2KSYA 2BWDA 4A2DA 4A2FA 4A68A 5I6NA 3OE8A 3ZPRA 1JZFA 1UATA 2PP9A 2YAFA 3VGAA 4DP6X 1E67A 1ZPUA 1BAWA 1S8JA 2FWLB 7PAZA 3OE6A 1KG9A 3ZPQA 3JTBA 3UGEA 4E9SA 4HWLA 1OCZB 4L35A 2DV6A 4MQTA 3UONA 1N68A 2AVFA 2WO2B 4GPOA 3KW7A 2DYRB 1QHJA 3HASA 3NY9A 4FPDA 1FBBA 3N2JA 3FU7A 1ADWA 2N0MA 2WSDA 2YCYA 1JFPA 3NSYA 3ASNB 5AKRA 4DP5X 5JJJA 2AFNA 1GSKA 3SBQA 1AZCA 2HRHA 2CJ3A 2ZOOA 3AG1B 3BQVA 3NP3A 5I6OA 1GYCA 3QJVB 4G7QB 2BW5A 2FQFA 5KKHA 1N70A 5DHHA 3QBIA 5B34A 4BVNA 5G36A 1JERA 3C75A 5AHYA 4G71B 2HX7A 5EN0A 1CYXA 1KV7A 3ABMB 3NJIA 1XIOA 2GC4C 2VW4A 1GY2A 1H2SA 2I21A 3NJMA 2L6XA 2CALA 4E9XA 2XXFA 5B0WA 1AZNA 4XT1A 2FQEA 2VSMB 3SBRA 4DPCX 2YAHA 2P80D 3MX0B 1BXUA 2P80A 1R1CA 3CDZA 4A2GA 3EF4A 1MZZA 3TBCA 1QHQA 1PXSA 2BO0A 1Q5JA 4FAAB 3V2WA 3ABGA 3WNJA 2BP8A 4GP8B 2BW4A 4G7SB 5B7EA 1S8LA 5TK4A 2TSAA 1ASPA 1PY6A 3GDCA 1KDJA 4F7KA 3NJKA 3AG4B 3AYMA 2MTAA 4E9TA 2Y02A 4N6HA 1JVLA 2I1XA 2W88A 2QPDB 1NICA 5G54A 2ZONA 2I7SA 1C8RA 4N8UA 5IY5B 4E9VA 3SQRA 4PXFA 1VLXA 4YSOA 5I5JA 2UXGA 3NYAA 2JFCA 3T6VA 1ID2A 3ZDWA 1FA4A 5ITCA 4HCGA 3T6ZA 3X1FA 5H2MA 3X1NA 2MRYA 3QJRB 4IARA 1JZHA 3AY2A 4KNSA 5DHGA 1AG0A 1GS8A 1O0AA 3GYRA 2GSMB 4KO7A 5C1MA 2IAAC 5B1BB 1KBVA 1W6WA 4YSUA 3QJSB 1A8ZA 4N4WA 4X4KA 4UANA 1R84A 2Z55A 1AS6A 1ETJA 1E12A 1JZIA 1IW9A 5B2NA 2GI0A 3IE9A 1RZQA 4WTQA 3DTUB 1OE2A 3FSZA 4YSRA 5B1JC 1ZIBA 1MG3C 1F88A 2IDQA 4IB4A 4BXSV 2KSBA 3NJGA 4WKXA 1RZPA 1J9TA 2IWEA 9PCYA 2BZCA 1FWXA 2BHFA 1AP9A 2YQBA 1ET5A 1JXFA 3S8FB 2VW6A 2J56A 2YAMA 1BRDA 2YDOA 3UG9A 1WS8A 1X0K1 2UXFA 2PLTA 1NIAA 6PAZA 5I6KA 3EHBB 4NC3A 4DJHA 3QBKA 1H68A 1IXFA 3A7KA 1A65A 5JJNA 4YL4A 3OE9A 2AANA 5I5MA 1MGYA 3HARA 1AZRA 1L9TA 4WW3A 2Y04A 3HAQA 3GXUB 3V9EA 2HXAA 1NINA 2TSBA 1X9UA 4CSPA 1S53A 4HYXA 4MQSA 2Y00A 5A44A 1PNCA 1NDTA 1HZXA 2ZZLA 1M9WA 2EIJB 4E9RA 3PCYA 4PAZA 5I28A 1JXDA 2HPYA 1KDIA 5F7BA 1OCCB 5B6WA 1OOWA 2FJSA 1AR1B 1S51A 1OE1A 3FSVA 2NTWA 2YAOA 1BEXA 4CSZA 4DP2X 3L45A 8PAZA 5I6MA 1PCSA 5H2KA 2CBPA 2I85A 2ZWNA 3COCA 3NT0A 3PLYA 3UACA 1OV8A 4GXFA 3FPXA 4A67A 4KOCA 4AKQA 2HRGA 1PXRA 1AIZA 3DKHA 4Q89A 1ET7A 2BP0B 5ITEA 3H56A 1XB3A 3SBPA 1AZUA 3HANA 2VMJA 3BVDB 1PLAA 1T5KA 1J9QA 3WKQA 5D4HA 4EF3A 1W8EA 5D4JA 2E86A 1L9QA 2PPDA 4K5YA 1AG6A 1ILSA 3DDLA 2BWIA 1SJMA 1L9OA 1NWPA 4JHVA 1CYWA 4YSEA 1BQRA 1QNIA 2R7EB 3CVDA 4M4RB 4X31A 2YAPA 4FA7B 5ANHA 3PWHA 3RZEA 5H2JA 4DP7X 1GZMA 2YDVA 4UHRA 4KO6A 4PCYA 3REYA 4A66A 3UTVA 4X1HA 1NIDA 3WKPA 3WG7B 2X72A 3FQYA 4AKOA 3NP4A 1NIBA 1XJIA 3T45A 4ZK8A 4XTLA 3ZIYA 4G70B 4GY4A 1WA0X 1UAZA 5BR2A 2XV3A 1PMYA 4HCIA 4BUOA 7PCYA 3ODUA 1OCOB 1J5DA 2FNWA 2XUWA 3QDCA 2VM4A 2PEDA 2FT6A 2YXVA 3PXOA 5G28A 4MD1A 3H4HA 1A4CA 1J5CA 1L0MA 5ETZA 1L9RA 1QKPA 1HAWA 1CWQA 2QPEB 3VI0A 1TEFA 1BQKA 2VM3A 2Y1AA 2YCXA 1KCBA 1GS6X 1GS7A 4Y9HA 2IWFA 4IAQA 3OAXA 3NSBA 1GU8A 3S3CB 1P8HA 2PPEA 3ERXA 3T6XA 3C9LA 3ZEVA 3OM3B 2Y69B 4YSTA 2IWKA 3X1BA 4LDEA 4YVUA 4AZUA 3IBOA 4BK5C 4QIDA 5B35A 5A8EA 2PP8A 1AANA 1IUZA 1AZBA 2UXTA 4X32A 5TGZA 3T9WA 1MZYA 3FSWA 4BDVA 1NTDA 2RH1A 4KNFA 3SN6R 3ABWA 4HHWA 1OF0A 2KSAA 2Z73A 1GW0A 2HZHA 4BEZA 4GYBA 3CODA 4FBZA 2XVBA 3UAEA 1W6LA 3MBVA 1WA1X 2BP0A 2IH8A 3H4FA 4KNTA 1E0PA 2UX7A 4WAVA 2OV0A 3IN0A 1VGOA 1BYOA 4JQ6A 2WO3B 3OMNB 1SNRA 2FQDA 4NERA 4BWBA 1C8SA 2AZUA 2I7OA 4QLWA 5AZUA 3DQBA 4G72B 2X87A 4EIYA 3IN2A 1LN6A 5EHFA 3AW5A 2CAKA 3X1GA 4YSAA 1M0LA 1IKOP 2J55A 3AM6A 2GC7C 1X0SA 2XXGA 3X3BA 2R7EA 5A7EA 1ZIAA 3VHZA 3UADA 1M56B 3HAOA 2JXMA 4E9QA 5B1KA 2PPAA 3QBLA 1PAZA 4LDOA 3V2YA 1NIFA 4MFHA 2HX9A 1L9SA 1P8IA 4OV0A 4JKVA 2QDWA 4QKTA 1SFDA 3FYIB 4MD2A 1B3IA 3MBWB 3TASA 5LWEA 3KJ6A 2W8CA 1ILUA 3S3BB 2YARA 3QAPA 4KLYA 1FBKA 2DWTA 2DWSA 5G2DA 1NZRA 1SHXA 1E65A 2Q9OA 4UG2A 4GP4B 2OJ1A 4BWUA 4HHGA 1OE3A 2R4RA 5G2CA 1XB6A 3FQ2A 2XYBA 3NSFA 1QLEB 4A2HA 2NTUA 1P8UA 3QQXA 1NIEA 5JJEA 1PLBA 3CVCA 5H2IA 5B6YA 4DP4X 2FTAA 1GUEA 2J5WA 1YLBB 1WS7A 1ZDQA 1TN0A 4DP1X 3VVKA 1SHWA 2DYSB 4HZ1A 1DZEA 3QBGA 1AS8A 1BYPA 2PPCA 3PAVA 4LDLA 1AACA 1CUOA 3G5WA 3UAAA 2PPFA 3AZUA 4K9JA 4HYJA 4BDVB 2IDFA 3PAUA 2A3TA 3QJTB 4PXKA 5I5IA 1PY0A 3AYNA 4GRVA 2CCWA 4YSCA 5F8UA 2FQGA 4GP5B 4P5SA 3D4SA 4DP8X 2AT9A 2XV2A 2J57A 2IDTA 2AZAA 3X3CA 1TEGA 3WIAA 1IBZA 2J4YA 4E9YA 1JZEA 3ABLB 5B6VA 3PPSA 1ZDSA 3PBLA 1JV7A 1F50A 3UTXA 2IDUA 2JAFA 2R4SA 1QM8A 4GYCA 5H2NA 1RCYA 2ZXWB 5F7AA 1WAEA 3FT0A 1SFHA 4N4YB 2XU9A 1V10A 5G2AA 1ET8A 4UAHA 2JAGA 2G87A 2UX6A 1JGJA 4AMIA 2B08A 1BRRA 3OMAB 3CAPA 1JVOA 1RKRA 2BRDA 1X9RA 2GIMA 2GHZA 3V9CA 1MDAA 5G53A 1KMEA 3FQ1A 1FFTB 4KO9A 3CVBA 4BWTA 3WI9A 5AZDA 5BR5A 2LNLA 1IW6A 3AG2B 3OQRA 3T71A 1UCQA 1QKOA 1TU2A 3NJFA 5TK2A 2XWZA 2YCWA 4BXVA 5H2OA 1AS7A 4UF7C 4YSDA 5B6ZA 4TXVB 3S8GB 4TL3A 1SDDB 6PCYA 1ZV2A 3KW8A 3PXLA 1M0MA 2UXVA 2NRDA 3UZCA 1NWOA 3VG9A 5B7FA 5B7MA 4P5RA 3C9MA 3FPYA 1PZAA 3UZAA 4AKPA 1ASOA 3NJJA 2EI4A 5PCYA 1KGBA 3QPKA 1BXAA 1KYAA 1A4AA 3IEAA 1J9SA 1IC0A 5I26A 3JT2A 1A4BA 3DIVA 3TBBA 1MG2C 3NSCA 2Y01A 3WNIA 1KGYE 1JV6A 1BQ5A 3EH5B 4XXJA 2F95A 2H47C 2JKWA 3OD3A 5I6LA 4QI1A 2XLLA 5H2PA 1Q5IA 4MBSA 4Q8BA 1XMEB 1C3WA 2GB2A 1SF3A 4HIPA 5FC9A 4HAKA 3FS9A 3X2QB 4XTOA 3FSAA 4DPAX 4QRYA 4W9ZA 3ZX1A 4ENZA 2QDVA 4E9WA 2FT7A 1F56A 4BWWA 4JKNA 3UTYA 3QJQB 1S54A 2XX0A 5D4IA 2VT4A 5J7AA 1E30A 1U19A 5E9NA 1HFUA 5B1JA 2PCFA 4DAJA 4DKLA 2YXWA 2CUAA 2IDSA 3NJNA 4AX3A 2WJKA 2YAQA 2M3GA 3N55A 4DP0X 1BRXA 1E5ZA 3TU6A 1DYZA 2GBAA 4F2EA 2XV0A 3FYEB 1VJMA 2X88A 1AOZA 2F93A 3NJLA 4AI7A 1HAUA 1IBYA 4HALA 3TA4D 3UTWA 2VN3A 5AX0A 4F2FA 3PAZA 2RACA 1PZCA 1KG8A 5A45A 4BEYA 4XTNA 3EH3B 3PQRA 5PAZA 1L9PA 1V54B 4A4MA 2IH9A 1NPNA 3AG3B 4A2EA 2I20A 3CG8A 2BZ7A 1KCWA 1A3ZA 3NYKA 1L9HA 1SDDA 2ZIYA 2DY2A 3RFMA 1JZGA 1TN5A 1PF3A 3T6WA 4YSQA 3ASOB 2PP7A 3WQJA 2OCCB 1PZBA 1JOIA 2EIMB 4NB7A 3ABKB 3RYMA 4YSSA 5LDUA 5DYSA 3NY8A 5AX1A 3QAKA 1S52A 3EH4B 3FU7B 4KOBA 3HB3B 4KO5A 2I35A 1J9RA 1M57B 4JHUA 4J4QA 2EIKB 1V55B 4W1TA 4YSPA 1F4ZA 3NS0A 3OMIB 2FT8A 1BM1A 2WJLA 1NPJA 3CZUB 3ZBMA 5FJGA 1AAJA 2Y03A 3NJHA 5AFAA 4JR8A 1BXVA 3OE0A 4KNUA 4EA3A 1XB8A 2HLEB 2VW7A 1GR7A 3PDSA 1PNDA 5AWZA 3D12B 3HEIB 4M3HA 2KS9A 1I53A 1URIA 1DZ0A 5B6XA 2YAEA 2ZFEA 3P0GA 3VW7A 4DPBX 3U25A 2VSKB 1E5YA 3EMLA 3QJUB 1ASQA 2EINB 3FU8A 4AMJA 3CDZB 2LLNA 1M0KA 4L6RA 4EJ4A 2H3XC 2Q5BA 2QT6A 4YVNA 1AQ8A 1JXGA 5AHZA 4XT3A 2H5UA 4G7RB 3X1EA 5B3SB 1JZJA 1TKWA
chains in the Genus database with same CATH superfamily
1VGKA 3UG4A 2EDJA 1JL8A 2LAGB 2V4LA 2Z8VC 4UQAA 4GO8A 2W07B 4XN2A 1JF5A 2PKDA 4K2UL 3VXUA 4U7SA 5AW1B 1WFOA 1OLLA 2OMZA 3JZ7A 1H15B 5E2VL 1BREA 3MOBH 2CO1A 2VN5A 5G5DA 5EUKA 5TFSL 5ETUA 2BVOA 1J0ZA 4YXHL 5EA0L 2CDGB 3CC1A 4TMPA 2COVD 2D9QB 5H2BB 2KSYA 2FLRT 2YRLA 4OFKA 4JZOA 4RZCA 4F7CB 1AO7A 4JFXA 5E2UL 5C1MB 4MCMA 1J10A 2BNQE 4DP6X 1DO6A 4X5PA 1QBBA 4FQJL 3S4SG 4JZNA 3OE6A 2H1PL 4JPWH 4DH2A 2E8YA 2I32A 4HWLA 1OCZB 3F01A 2DV6A 3OC5A 3PV7A 3C6SA 1G1YA 5FXCH 4UV7H 2ENYA 4GPOA 4OLXH 1ICTA 2DYRB 5ESAA 2GTWB 3NIFF 1PYWA 1Q9LA 2WSDA 3AB0B 4BK5A 2EDLA 5IF0A 5KSUB 4TVPL 4LKXA 2EEAA 2KERA 3S98A 4GG6F 5E6IB 3ZE0B 4LLMB 2XWJB 3NSXA 5D7KE 2K4WA 1M3IA 4KJPC 4AQ8C 3SKJL 1JNLL 2KKQA 4UTBL 2XZQL 4MSWB 2GC4C 2A4ZA 1GY2A 1H2SA 1F8TH 4QHPA 1MHHA 5CR8A 5A43C 4MAYB 4NQDD 1XX9C 4LNRA 1IT9L 4LAQL 4K9EC 5LNDA 2FBJH 2YK1L 4CMMB 2J72A 5IBLD 2IG2H 2O5YL 2WZPD 1XIWB 3PQYA 4JPQA 2Q86B 3UJIL 1H8OA 2K4AA 1E8XA 4RQQA 4BH7B 2XPGB 2VXUH 5I8KL 5MENE 3K3QA 3Q2CA 3PWNA 5E8NA 4C57C 4ZMQA 4E9TA 2MKWA 2X6VA 4M03A 4PJIF 3M6DA 4TULL 3PFUA 2BZDA 1ACCA 5AYUH 1FCGA 1U3HB 2NY4B 3ZDWA 4LKCA 4JPKL 2MRYA 2Y5QA 1Y6NR 1E5AA 1TDQA 2PNDA 1YQVL 3IDJB 4IEFA 4QI3A 2A83A 1D5BA 3JTTA 3WN6A 3FQTB 1AS6A 4QHUB 2AJUL 3GBEA 3MRBB 3IYLW 2WXNA 3F7VA 3FTVA 1ZIBA 5HJ3A 1UWXK 4M4RA 2O6DA 4NN5B 3NJGA 4FADA 4FMKA 4LSRL 3PL6B 2JKNA 2MKLC 1W0YT 2MPAH 4ZPVB 3QDMA 1VFMA 1HWHB 1NMBL 3GGWB 2WXMA 3L8QA 4AEIL 4FNTA 2J56A 1U58A 1WS8A 2XN9A 5DS1A 4RDQG 2KQMA 5GS0L 2AF2A 4QRSB 2AANA 1IC7L 5KSAA 4YPGA 2A99A 1FZOA 5IBTL 2P5WB 2TRHA 3BI9X 5E8PA 3HZMA 2WXPA 4QXVA 4WJKB 4Z23A 4R4FH 5FF6A 2K9FB 5KJRH 4N2AA 3VWJC 4U1GB 1MREL 5A2FA 1HZXA 1M9WA 4XOEA 3MJ9L 1UQSA 1JXDA 1YPZE 5D7IF 2LLGA 2DJ4A 4GG8B 4KK9C 3WY2A 2OMYA 1B2WL 1KCLA 4FI7A 3FFCD 1VFBA 1S51A 4RWYH 5DVOA 5E9DA 5FCSH 2BSSB 4APQD 1BW8A 4N2LA 3ZGIA 5I17A 1CFTB 3TFKD 4NRZA 4ABQA 4E41A 1A4KA 3LEVL 3NSJA 1MY7A 1CF8L 1SLWA 4ELMB 5BCAA 1NBYA 2I9TA 2I9LA 2Z31B 5EEUA 3GBMH 2OFQA 1XB3A 3HC4H 2A9BA 4Z8FL 3KCPB 1TFHA 5JORB 1J9QA 3Q2VA 2UYLB 3LQZA 4OLVL 4B3EA 3FO0H 3ARRA 4IKIA 4L37A 1AG6A 4GSQA 4XGZA 1JN6B 4HJJH 4L0YA 3V8CA 3CVDA 3EYUL 3BPLB 4OD3H 4UZUA 5SWSD 1IGFL 3BWUC 4PJ5B 2EXWC 2Q2EB 5DSCB 3WN5A 5MP6L 1TZOA 1YN7A 2IALA 4GSRA 1GZMA 4D3CH 1DANU 1GCYA 3F5WB 5KSBA 3WMPA 4WWPA 2WBJC 2A6IB 3B7YA 4K55A 4MASA 4XTLA 4G70B 4N68A 4G82A 2YBRB 1J5DA 2OLDA 1WBYB 5JYMA 2VDOL 3GSXB 5L6YL 2VKWA 1HZKA 4TN9A 2MPVA 3ML9A 1ACXA 3F7LA 4Y5XC 3F7YB 4Z76A 4HKXA 2OP4H 4AZ8A 3NH7L 4IAQA 1UENA 3NSBA 2WIIA 5I1AB 2Q76B 2PPEA 5K93A 1RURH 2WUBL 1MIEH 2B4CH 2VXSL 4WO4A 5JZ7D 5EEVA 4KKZA 1KC5H 3E6FB 4MA7L 5KYYA 3OR7B 1DQDH 4ONGL 3QNYA 3BGMA 4H2AA 1CK0L 4U3XA 5GISH 1JV5B 3WO4C 2FJFB 5DWUH 4BKSC 1IGIL 4G9FA 4NKDB 5GJTL 1YDPA 4TS6A 4JRYE 3GSNL 1F4AA 1RVFL 3MRLB 2IH8A 1MRFH 2ZCHL 5BQ7A 3NA4A 1I9EA 1KPUA 3U0TA 2UX7A 2NSMA 3DUUB 4HIJB 3OKKA 4ADGA 1A5FL 4AYBA 1HNYA 4XXDA 1PZ3A 2X87A 4GMTH 1RMFH 3IN2A 5H4YA 1G6VK 1U21A 3AW5A 4U6TA 2AVGA 3ESOA 1BYNA 1X7SA 3G6DL 3X1GA 1LHZA 3AM6A 3S48A 4H0GA 5CGYC 3CFUA 4YBQC 3HAOA 2WQ8A 4N3TA 4J3BA 2AQQA 2Q8BL 3PWPE 3S96A 2HX9A 4ZQKB 4PBXA 2AGJL 2YKLH 1L9SA 2QHRL 2DWYA 4OF8A 5I5RA 1I1AA 1HJCA 1FSKB 4R0LB 3B2MA 3CLFH 1ILUA 3DYPA 5GGRB 4G1MA 1I9RL 4AL8C 5AAWA 1AP2B 4Z7WA 2GTQA 1SHXA 5L2KA 1E65A 3H85A 4YL9A 5IHZA 3MJGX 3QEQD 5CNHA 5CJOL 4AEHH 2VLKB 1KBBA 3KLHC 4G1EA 4YDLB 3RWDA 3FCGA 1E4XI 1WFJA 2FVNA 4ETYA 1TN0A 3PGFH 4UOZA 4KROD 1DZEA 1AS8A 1UEYA 1WFTA 3V6FB 4S1DD 2CBTA 2P24A 1X7QB 2OMWB 2E7MA 2E4TA 1E43A 2WB7A 1FNGA 1G7LB 4UQIM 3MUGA 5GS1B 3IJ7A 4U05A 4H7VA 4LLAA 5HI3C 3VVVA 1PQZA 2VDRB 1NOLA 5D7LD 1MAKA 3B9KA 2AXGB 1PSKL 3GUTA 3RTQD 5I2IB 2DL9A 2J8UA 3TTSA 2WYTA 1E40A 3WIAA 4IU3A 1OGAA 5IG7B 3L54A 1FBIH 4N8VG 5GIRB 2OK0L 1G9EA 2R0ZH 3LOWA 4ZUSA 5G2NA 2IC2A 2WPGA 1QR1A 3GMLB 3AM8A 3IWVA 4OLEA 5IROA 3P4MA 4NKIH 4NQCE 3WFZA 3WU1A 1BRRA 5GGTL 5ADPH 4F58H 3M1OA 4NO2B 2HVJA 4AYID 2XWRA 4FGMA 1V5JA 4KO9A 1FH5H 4L2YA 3U7YH 4NRYA 4EOWL 1LDSA 1IC1A 3KHQA 2WLHA 4HFUH 3Q3GB 1NCWH 1PJ9A 3C87A 5TJWK 1R3JA 3CMOL 4WUUE 5DHXB 3RILA 3ARDB 4EN3D 2DMBA 3O0RH 3ARBD 5AOZA 1ZV2A 3V5HA 1WUZA 1IBHA 1UM4L 3RFZC 4W9GC 1GSMA 2X3AA 1QABA 2DBLH 1HKLL 4BSWA 2P8MA 1F4YH 3SDAC 1U3JA 1GYUA 3VXQB 4GW4B 4Z7VE 4WGKA 2E74C 1KPVA 2Q7YB 2NY6C 4H8QA 3PGDA 4MJ2A 3QCTH 1ITBB 1ZXKA 3TJHD 3L3HA 1C3WA 1M7DA 4U0RC 5FGSA 5FC9A 1L3WA 3KL5A 3L4TA 3MGOB 2BS8A 5IV2B 1MUJB 2WB1A 1T1XA 3U79A 2ZE0A 3ALWA 5FYKH 4F7TB 3LXBA 2GJZA 4JY5H 3UPCA 5DJDB 1EHNA 4FQIL 2RALA 3IJSB 3TLRA 1SXSA 2PCFA 4HH9A 4DAJA 3DOHA 4XN9A 3GIVA 2W07A 4HGWB 3SGJA 4KK8C 1G7HB 5DHYB 5D6DA 1PVHA 1DSYA 3H53A 2AW2A 2IWGA 5C09A 4OGXL 3TC9A 2B7DT 3K4ZA 1VJMA 2X88A 2JJVA 5E2WL 5JXEC 3BAYA 4OGYH 2KYIA 4FFYA 2IAND 3G04A 4JO2H 4F2FA 1MCBA 4XN8A 4OI8A 1DQIA 4KV5F 3G5XB 5A45A 3A4DA 3MLSH 2WYIA 1JJUA 3AREC 3PQRA 4X5RA 5EN2A 2HG5B 4U6XB 2GUOA 3GJFB 3BLBA 3IDUA 5IJVB 1A6AB 1SXCA 3VFGL 2BZ7A 2GI7A 4IGBA 4WSKA 1W8OA 1SDDA 1JF1B 2DY2A 3OHXA 4KI5D 3T4AA 1HHKB 4HWZB 2FO8A 1YEFH 4HIEB 3RWHA 1PX8A 1SOSA 3CN0A 4MXQD 4UT6A 3WNOA 4ENED 5JYLA 1U6AH 2GTWA 1I7ZA 3NIGE 4ZFGL 4PGCB 4J4PA 1R5WA 2MNJB 1P84K 4OCRH 4FQCH 4U6VL 3SPIA 4TL4A 3FO9B 4Y4HB 3STZB 5I73C 4ZZFA 3OMIB 5E6IA 4IU2B 2WJLA 1PKQE 2L0DA 2V0AA 1YEJH 4F8OA 5FDWB 1J8HE 2VDPB 1MJJA 3WDHA 3BH4A 4P9HL 4WWKC 5EU6E 1XH3A 4M3HA 3L3OC 5KSBF 2YD2A 2IV8A 4HAGA 1HH9B 4N1HB 4J2XA 3WHXB 3O6MH 5F1IA 3K91A 1DCEA 4BFKA 2YRPA 3WJMB 1JFQL 4S1RH 4EJ4A 1XIWA 4JB9L 2ZQKA 5DD0L 5D96B 2H5UA 4L3ED 2ATAA 3QXTA 4HT1H 4BH7A 4Y2DD 4NGHH 3ZR5A 4I88A 2ADGA 5B38B 2PF6A 3WXVL 4HEMA 5CJQL 4FQXB 4EI5D 4XCNB 2BY0A 1IKNA 4LVHB 5I6PA 1U8OB 4Y4KC 2R4RH 1FN4B 1SYSA 3B43A 3N41F 3OGOE 3BP5B 3CZFB 3H0TB 4MNQA 4BBWA 4QF1B 1IEBB 4HKBA 5D1ZI 3G6JB 2NY3D 4A37A 2W94A 2BMKA 3GKWH 4XVJL 1LVEA 4X0KB 4PW3A 5CJ8A 3TO4B 5IJKC 1PY9A 5F89B 4QHUA 1T1ZA 3MRBA 4ABUA 4UT7L 1QTPA 2XTJD 2D2OA 3CCHB 2WXGA 3QQ3B 5CEZL 4FFZH 4HWBH 3BFQG 1UT1A 2CUMA 1FVDB 1RLWA 2G0LA 2R0LL 1EFQA 1MNUL 2AVFA 3BE1L 5TH2B 5EOQH 3TT1H 4PJXB 4KUCD 2BCKB 4YPJA 3SDDC 1HE8A 3K6NA 1MJUL 5AW9B 4KXZH 5SX4H 4MBOA 1BLNB 2HKFH 4M6OH 1LGVA 4GUQA 4G7QB 3LIZH 2EJ1A 2FQFA 4OM0H 4LVEA 2P48B 3LHPH 1LO3L 2I27N 3FTUA 3IMTA 5A3ID 2G4GA 4X4MA 3ME0B 3DV6B 4LQFL 4EBQL 2WTOA 5F1SA 4KJYA 5T33L 1A64A 1MFUA 2IAMB 1TENA 2E4FA 3PS6A 2ZUWA 2PYEB 4XNZB 3UJJL 3VG9C 5CGMA 5DYFA 5I0WA 5T1JA 4PBVC 1I3RB 1GCFA 2AQNA 3DUSB 3WFEL 5HGAB 4MA8L 5FYJU 4B9FA 5DHDA 5AW5B 3K2KA 1EX0A 5D1XC 1E3FA 3IM1A 2FWOB 2Y02A 5I71B 4GLRH 4D0BA 3VAEA 2I7SA 4NNYA 3UYPA 4LHJB 1CS6A 1IIKA 2UXGA 5CN1A 5BRZB 1V7NL 3VFVA 5ITCA 1DQJA 4BUGA 4KO7A 4XMPL 3EGDA 2R0WH 2J4WL 2R2BA 3JWNH 5ERWA 1P6FA 4ZSOE 3RVVD 4N4WA 2WVUA 2Z0UA 3M45A 4FNUA 4OSUL 3UO1L 1R84A 3MV8D 3N91A 1JZIA 3BAIA 1JN6A 2JI2A 2HTKD 2R27A 1NBZA 5FK9B 4WTQA 4DZ8B 2J8UF 1HS6A 1U95A 4PLKC 4J3OF 3ZTJH 4ANKA 4MAUL 4Y0GA 2WGNB 1J0IA 3CZEA 2APWA 4QRBA 4Z18A 3WJLA 1WQVT 3VXSE 2YQBA 1XGYL 4WI9A 1YEHL 3W0WA 3TN0C 3VGGA 1KJ3H 5ISZA 4N2DA 1F3DH 4BE5A 3W11D 2APBA 3AY4A 5EIVA 3ECBB 1AGBB 1QUNB 2BJMH 5JJNA 5D4QA 3OE9A 1CI3M 1UD2A 4Z95L 2Y36L 2BSED 1FO0A 1VB9A 5SWZE 4X7CC 5KSVB 2CJUL 1QA9B 4X6FB 3R1GH 4OLWH 5E1AB 1L7IL 4M8VA 2HJLB 1JPST 3FCSB 4K5NA 1HINL 2ALAA 4NP4L 1SLVA 4R90H 3CHOA 2WLZA 4YE4L 1IILE 1E7UA 1OEZW 4ZT1A 4FULA 2DLTA 5F7EH 3D4ZA 2BS9A 1ECYA 2HJFB 1TF4A 2ZCLL 5F7BA 3ZL2A 4JREB 2FJSA 2NY5L 4W6YB 4JK0D 4XCFL 1GYVA 1KTJA 3MRPB 5T1KD 2FJFA 1SXAA 1ZOXA 2J88H 2VLRB 2K3HA 4L4TD 1NBVL 3L9RB 2HUEA 1TNNA 1ESOA 4NRXA 2HVKA 4K2UH 3WV0A 3MRLA 4XBGB 4M93C 3U0WH 2Y5EA 3P9MB 1B4TA 4IDJL 1KGWA 5E2VH 4PV9B 3H9ZA 4HIJA 5AOLA 1EFXB 3IETB 5TFSH 1PLAA 4YXHH 5EA0H 2IQAB 3HS0C 3HE7B 1P7QB 5HDRA 4PYHA 3MRCA 4CVXB 5L88L 4U2YA 2P26A 1DBML 2DH3A 2W9DL 4UTAL 2RD0A 5E2UH 4KNQA 1KGXA 3W5MA 2P8PA 3VMNA 1QNIA 3PAYA 5E70A 5F9DC 4JLRB 1FAKT 1ZWIB 4FQJH 2W65B 3KLQA 3IU3A 1PBYA 2H1PH 1Z9SA 3VQ2C 4DKFL 4ZNCD 4LEOA 2VDMB 1M05A 2X4TA 4DEWA 4W4OC 4X0NA 2ZP0T 1XJIA 2V5YA 5D1XE 1R5IA 1TYRA 4TVPH 4WNQB 2CCLA 3O4OB 4XH2B 4WU5A 3K0YA 1E90A 2ZOLA 1QVOB 1EH9A 4QRQA 2ZG2A 1CU4H 3HC3L 1CWQA 3SKJH 2Y1AA 2EADA 3I9PA 4UTBH 2XZQH 2Z7UA 5E1HB 2PW2B 5FUOL 3UBXG 4I2XA 4PM1A 4NC0B 1OWRM 1QTYT 3SJVB 2HCZX 3FTWA 4FYQA 2F2HA 4BQBA 1IT9H 4QXGL 2HAZA 4LAQH 4YSTA 2LQRA 4LMQE 2G5UA 4AZUA 4YVUA 2OMWA 4XNBA 2YK1H 2VAAA 2O5YH 4QOKA 4PRAB 2V6HA 5IW3A 32C2B 3BZEB 4QTFA 1WZAA 3UJIH 5INCA 2BWQA 4OIAA 2LTQC 4CDGC 1A6UL 5H94A 3ZSTA 1GW0A 2JV6A 2AXGA 2GJRA 3GMMA 3O11B 4H20L 4DAGL 1RPKA 3MBVA 5I2IA 1K2DA 2YZ1A 4KNTA 3L3JB 3GSRA 4TULH 4M8QA 4L8CB 3A4EA 1BD2B 2P43B 3OMNB 5FW6A 4JPKH 4HS6A 4BEIA 5EWIL 5T1MB 4U6YB 4FQ2L 2DLFH 1YQVH 4C4KO 4YSAA 5IFAL 1X0SA 1JZ5A 4JFFA 5EZOL 3UADA 4TLTA 2AJUH 1IC4L 1N26A 2WNKA 3HHSA 3M1BB 3SGKC 3I6LD 1EIBA 1H3XA 3OMZA 4QRPE 5BUAA 1WGOA 5DEGB 4LP4A 1WDAA 2B9BA 1TT6A 3VDBA 3QO0A 1S78D 1SQMA 1YN6B 1D6VL 3INUL 5LWEA 4HUXA 4LSRH 3IGAA 2W8CA 1NMBH 4AEIH 2YQ3A 3GKZA 5HI5D 4HUVB 5EZLB 1ZPLA 3MFFB 5I8EB 1CE6A 4MX7A 5DGRA 2J5LC 1AXSA 1G0YR 3DGGA 4UB0L 2AI0L 5GS0H 1T04B 2ZX8A 3K72A 2NT1A 1IC7H 3NSFA 3WEAA 2NTUA 4NAMA 1F4HA 1S9XB 3ECWA 2WXRA 3DGCR 5IBTH 5B6YA 2VLJD 3LKRB 1FAIL 4QJ4B 1MCKA 4AYFB 3E8UL 4KKAD 5CFAA 3VVKA 1DZBA 1N7ML 1TJGL 3ESNA 4FZEL 2JK5B 4P2OB 2BRRL 1MREH 1TITA 3MJ9H 5DJ2A 4FQLH 3QI9B 2F6AA 4BDVB 3MGOA 4NUGH 1U8IB 1MUJA 4FG6D 1GZHC 1B2WH 4X6CE 2KPNA 1CTNA 4AV0A 4G11A 1CICC 1NCAL 3PXJA 2PABA 3VFMA 2J57A 3EDFA 1CB4A 5G4NA 4YX2L 4H4NA 4JRXA 1R3KB 4QHNB 1A7BA 3LEVH 5DU7A 3LZRA 1CF8H 4NZFA 3SE3A 2GJ6D 2BIIA 2K6WA 3M7FB 5EEYA 4E0RB 5CBEA 4TUKL 4B50A 4Z8FH 2B15A 2Y2TA 2F54D 1CGVA 4UU9B 5DD5L 1U30A 2ZXQA 4OLVH 2IPUG 2R0KL 1KGUA 4BWTA 1JGDB 3QJHA 5BR5A 5D2NC 3QZWB 4QMEA 1XGTB 4ZO7A 3F7RA 1J11A 3EYUH 3JWOL 5HYJD 1S5HA 3AVEA 3P69A 3T1FB 1IGFH 1IAKA 4APQC 2YCWA 5MP6H 3SBWA 4AC2A 4JFDE 1ZT1A 4KVNL 4NXKA 5DYOA 2FYYA 4WHYH 3RHWK 3T8MA 4NBZB 3QYCA 3VWJB 3E6HA 3L1GA 2CRIA 3I3DA 5IBUG 3PWPB 3RIKA 2RGSA 2EDKA 4XZUA 3NJJA 1J9SA 2VDOH 4Z7OB 2NNCA 5L6YH 5ICYB 3GINA 1BPLB 1CGYA 4Y1SA 5HYQB 3KPRA 5DJ0B 1LO4L 2YPVL 1TLKA 1OT2A 5FYLL 4PRPD 5J0BA 3FQNB 3VRLF 3B9AA 3NH7H 5H2PA 1C5BL 1X5MA 4U2ZA 4NN7C 4ZJ9A 2F68X 1VZGA 2GB2A 2WUBH 5LHDA 4OKVA 2I24N 1OTSC 4X5QA 3RGBA 2VXSH 1T0PB 5LLIC 4B9YA 1SOQA 4KXDA 3HAEB 4MA7H 1BJ1H 3GRBA 5E7BA 4ONGH 3AACA 3WJMA 3ZTJG 4Y19E 2CLVA 1UJTA 1CK0H 2NPLX 2VT4A 3FT4A 5F9WC 1IGIH 1HDMA 5GJTH 2G9HB 1YY8A 1TJXA 3NJNA 4QYOB 3GSNH 1RVFH 3LXAA 2ZCHH 4F33B 3MA7A 5B4MC 4OZFG 2Z7WA 3K6SA 1A5FH 2H6PB 2BS71 2WBJB 2WN3A 1HAUA 1OAXL 3FTYA 4HUNB 4LCUB 1QASA 2CNZA 1G7PA 3H0TA 3G6DH 3D2TA 4QF1A 3LYRA 4AQ1C 1CO1A 3LEYL 3O3AA 4DUVA 1WF5A 1IC5L 4PS7A 3TO4A 3AGVA 2Q8BH 5L9DL 3BWAA 2VDRL 5LDSA 2AJVL 1MFAL 5D1ZD 3FULA 3QIBC 3NK4A 4Y5XB 2AGJH 3CH1B 4EMZA 2QHRH 4N6RA 1N6VA 3DWTA 2O26U 1QSEB 1FGVL 4PGBA 4GRLA 2DI8A 1BVNT 5C8JB 1UB6A 1I9RH 5JPMC 3STLB 1SN0A 1OW0C 3ARVA 1A4JB 2P8LB 4QCIA 1NCBH 3HTLX 4NKQB 3U2IA 4F8LA 3H9SB 3WO4B 3C60D 2AK4D 4QJ5B 2FT8A 3IAQA 3HJEA 4WHCA 5CJOH 5DHMC 5MERA 3D25B 2XJKA 1JPEA 1RHHA 3P9LB 4I0KA 3WFHA 1KTDB 5IK3A 2A4CA 3FT3B 3MV7E 1R5VA 3OX8B 3A6OA 3P3RA 3QUYA 1ZS8A 2RFXB 3ZO0A 4KKPA 3FBKA 3QJUB 4A1RA 3C8KB 3V0GA 4AMJA 2BIHA 3L17A 4JQVA 4KGJA 4NZJA 4NQEA 1RZGA 1ZE3H 4LB8A 2C4FT 3GNML 2W80C 2BP8B 3B2DC 2V2TA 3G5VB 1JRHI 4G6FD 4ALAC 1PSKH 1WBZA 2J6EL 3IPBA 4L8BB 1NMAL 1J88A 3BKML 1CC3A 5KZCD 5EEXA 1VIWA 2NOYA 4IK6A 1OCRB 3G3LA 3R7RA 1W72A 2F9BT 4KROC 3VI4B 2GVYA 2JQZA 1WWCA 4OFQA 5GGTH 3GM8A 3UZEA 2ADIA 2YAFA 3TH3T 1BPVA 3T8XB 3MRDB 4EOWH 2A74A 1CXEA 2W9EL 3UP1A 4NUPA 1GOGA 1U8QA 1UVQB 4TNEA 2M8XA 4ZUWB 7PAZA 4K8RC 3W37A 5FK9A 4KZ0A 3FC8A 5EOCJ 5C07B 2FHCA 4XBPB 1BF8A 3GK8L 2WO2B 3CMOH 4Y9GA 5K39B 3LHAA 4M7KL 4YIQA 1X5IA 1VKXB 4LF3A 3WXWL 4F57L 1QBAA 4FXKB 1UM4H 4XCYB 5FX3A 3MV9E 1KB5B 2ZXEB 3CDYA 3L2MA 4ZUVB 1HKLH 1MRCL 2YGOA 4ZW3A 5K9OA 3B83A 4LBAA 5DHHA 1K4CA 3OSKA 2OL3L 1T5WA 5DJAB 3SEPA 1CYXA 3D69B 2JCCE 3DX8A 2P45B 1QLFA 2ZKMX 3S5LG 4WFEE 3WBDA 4H5SA 1E9QB 1G94A 5B0WA 3NK3A 4P2CG 1ZHKB 5F9JB 1SEBB 3KLAB 3UBHA 1BXUA 1QWHA 4MQ7B 4EN3C 1JDAA 1IM9D 3ARBC 4OLYL 1R3LB 3TVMA 5IREA 2XVKA 5GGSA 3SKOA 2HJFA 4BA8A 3WNJA 2A2QT 5FYKU 4FQIH 3HR5B 1NQBA 5DFAA 1KDJA 4QRRB 4C56E 3S9DB 1KN2L 2VLRA 4D0CA 4PRIE 5C0BD 5KVGL 3K71B 2UWEA 2CLZA 3GMRA 1JWUB 3K2MC 1C8RA 4NHUB 3LRMA 4YBLC 4PJBE 2VDPL 1NFDA 4P2QD 4G5ZL 2DI7A 2ICWB 2JJSA 3MRQA 3TBSB 1KB9K 1NL0L 4OGXH 5GS3A 1GS8A 5E2WH 3LS4L 3UDWA 3LEXB 1HSBA 4V1DD 1KBVA 1WICA 4PJAB 4UOJA 2VYRE 4V2CB 4NQTA 1KF9B 4CVXA 4K7FA 1OGTA 4FTVB 4QO1B 1RZQA 3JVGA 5EU7E 2YA0A 1OE2A 4NSKB 3KGUA 1AXIB 1ZWIA 4JFED 3VFGH 5E1IA 3C5ZD 1Q0XL 4FJZA 1MFNA 2NY6B 1MLCB 1NCIA 2DQUL 2W1NA 5JHDD 2IWEA 2MEJB 3ULVL 2Y5TB 1NCNA 2DJMA 5I1HH 4HFWA 5EFIB 4U0RB 1N19A 3G5ZA 4ZFGH 5FKAB 3DGDA 3MAWA 3U4AA 4WEBL 1NC4D 2VRKA 1NCGA 4DJHA 4N25A 1E28A 3NEEA 4U6VH 5E23A 5GRYA 3MROB 2C9VA 3BIKB 2Y0SA 1QVOA 1AY1H 1XGZA 2O72A 2EC9T 2AITA 4YHIB 2APTA 1Z5LA 3SQOL 1KBPA 4RMVA 1EO5A 1NA8A 2JJWA 4XP1L 1V3LA 1CFQA 4BFGA 3J27A 4P9HH 2IIJA 2X1PA 2HSIA 4DZBB 4L9LA 4KI5C 4Q6IB 2VLME 4LOEA 4PLNC 3DPBA 4DCQB 5IJBC 3S2CA 2JMRA 1ZLVK 2G2PA 4MXQC 4ENEC 1HK6A 1PD1A 1YJDC 3TESA 5B6WA 3DJRA 4ZXBC 1D2PA 1JFQH 3L81A 5AW7B 3UIYA 1XTLA 5DZAA 2Y7QB 4TKWA 4WHYG 1CD9B 4JG1L 1UD3A 5DD0H 3BZEA 1BMWA 1JHKH 2NUPA 5KOMC 1E9PB 1L0PA 1BDYA 3AREB 3MTXA 4ODWA 1ZA6B 4NQVA 4XPHL 5J1AA 5KBDA 1BQSA 2VISB 4JDVA 3WXVH 3LZLA 5CJQH 1BZ9B 4L1HA 2VWEE 3US0A 2WQUA 4PS4L 5DZLA 4L8CA 4PRNA 1BJ8A 5GSRA 2YKKA 3BX7C 3AXIA 2ITDA 5T1MA 4NO3B 4CADB 3KYNB 5C0JB 1I7TA 4O02H 2HT4C 3DDLA 3OGCB 3O45B 3RBGA 1IM3B 4XVJH 2CKBB 1COBA 3NFNA 4OT1L 4Q2ZA 4WI2A 5C0EB 2BVQB 1J1XH 4UT7H 4HUKB 5CEZH 4LLUB 2YDVA 4ZSOB 2WQWA 4WWKB 2R0LH 1MNUH 3BE1H 5JW4R 1ZEAL 3L3OB 2BNUB 4G7VL 4HZLA 1TYEB 1N18A 2XI9A 2C1PA 3MXWL 3SGEH 1VFAA 2ZUVA 1W0WB 3NRPA 3GSQB 1PMYA 3CXFA 1MJUH 4LP5A 2AERT 5C0IB 1EHAA 3JSSA 5TDPB 1NUGA 2YUVA 5EZLA 4XVSL 2VM4A 5I8EA 1TO4A 1JNHB 4U1JB 1NANH 2NR6C 1KNOB 1QLRB 1LO3H 1KOAA 2YHGA 2QPEB 5JNYB 1IAII 1YMMD 1I9IH 2C9SA 1GS6X 3NACL 4S0HA 4LQFH 4EBQH 2XTJC 2EE2A 2HWZL 4M9OA 4Q97A 3Q8CA 4AYFA 1FZKB 5T33H 2Y69B 2H9GB 2WVTA 3S5ZA 4LBEB 3IBOA 3UJJH 3MN8A 2DEWX 1Q90A 2D0FA 3T9WA 4X32A 4BDVA 3WFEH 4MA8H 2VZSA 5ALCL 1BBJA 4JE0A 3HG3A 5HDBF 3W82A 4OAWA 2XVBA 4HUWA 4AT6B 3TCLB 5E6RB 1QP1A 3ZOAA 4LLWB 1HVXA 4LXFA 2XC8A 3F3HA 3KPSB 3BD4A 4HJUA 5F88B 2ADFL 2WO3B 1V7NH 5AAMC 3BUYB 4QLWA 2QADD 5CLWA 4DS7E 3UTZB 3SDDB 4XMPH 4W81A 1ZK5A 3SYQA 2J4WH 1T6WA 5I9QC 1PZUB 1S7TB 4GQQA 4OSUH 5GZOD 2H26B 4NPJA 3UO1H 2AQTA 2X6MA 3LV3A 3ROOA 4IYKA 1NFIA 4K3EL 5CJ5A 4QNPE 5HJDA 1JGDA 1F3DJ 3DBXB 3PYCA 1TVBB 2OXGB 4MFHA 1QTSA 2YD4A 4RAHA 1BVKA 3KEHA 2JWYA 4HPYL 1BZDA 5CD3A 2VB5A 2DTML 3OKLB 1QATA 1B3IA 3QDJA 4MAUH 1JZ4A 1YHPA 1KBKA 1V3KA 2E7DA 5F1OB 2DJSA 3EO1A 3WIHA 4BV1A 4PY7A 1XGYH 4XN1A 1YEHH 4KRLB 4I0CC 3AWGA 3VG9B 3DYOA 1KJMB 3NUKA 4BWUA 3RVVC 1G6RB 3E2HC 5LXGL 5AWNL 4A2HA 3EOBA 3HS9A 4B9CA 4Z95H 2Y36H 3GS7A 2IADB 5HYQA 4I3RL 4YN3A 2HTKC 2CJUH 3E9TA 5DUJA 5F7DA 2J5WA 1L7IH 2ZOWA 3FQNA 5DURB 1HINH 4KTGA 2PPCA 4BSVA 3U2JA 2VDML 2XA8L 4YE4H 4PJHE 3LKOB 5AL0A 4RGND 2ZCLH 3MJ6A 5KBMA 5FPIA 2NY5H 3AYNA 3P77A 2YXMA 2CCWA 4XCFH 2OR8A 1OQXA 1G9NL 2COQA 3HMWH 3RZCD 5DRXB 1TVHB 4YOKA 1T20B 4YH6A 1NBVH 4QEGA 5CJXC 1BZOA 1QSZA 2B9AA 4NQXA 2Q7AA 3GJEA 2NQ3A 4Y1TA 3CFDB 4F33A 4IDJH 3D3VA 3FL7A 4JANA 3ILPA 2VXVL 3REWB 4TSAL 1NUNB 3HLAB 2VNCA 3MYJA 2IOIA 2V17H 3C5SA 3BH9B 5L88H 2G60L 2OR9L 3CVBA 3QA3A 3PY9A 2W9DH 4UTAH 5K59E 4UZSA 5D1QB 4JHZA 1R24A 2UWEF 4KK6D 5DC4B 3UZQA 2VC2B 4IRSC 1FE8L 5FYJE 4UF7C 4O58L 1NFDF 4DKFH 4WSGA 1OAYL 2XY1A 4P3CH 1SXNA 1P7BA 1YEIL 2BNRA 2C9RA 4A6YA 1A9EA 2K8MA 1I8UA 3BVUA 4N8PA 2BSCA 4XMLL 1EEZA 3T3PF 4QRPB 5C8JA 4NQQA 4HKZB 4CSTA 5D7JD 3PNWB 1C16A 3IEAA 5CSZA 5CR1A 1BIIA 3MRHB 3TIDB 2HFTA 5IM7A 1NCDL 3EYOA 1U8CA 2AS5M 1N59B 4XPGL 1KGYE 3HC3H 2CIIB 2Q2LA 1T83A 3DURA 4PJ8A 1MI5D 5FUOH 1KTDA 3PDDA 3FT3A 4MBSA 3OX8A 3Q8FA 4DW2L 3TYFA 1EHLL 4M93B 1SMDA 3FOLA 3OAYH 3S0PA 1N3NA 1KJ2B 1O7VA 3HG1E 1SLXA 3MRGA 1RY7B 3NZ8B 4QXGH 2XYCA 4CSSA 1MCPL 1G4MA 2XJLA 4NAQA 1QQDA 2AJZB 1MCOL 3HS0B 1F56A 1XCWA 3FQRB 4K9EL 1AD9A 3BSZA 3D85B 2E3VA 2M83A 1A6UH 4I1RA 5DD3L 43C9A 2VQ4A 1MFEL 3IMVA 4DAGH 4H20H 3QORA 3QFJE 1DSFL 4BCXA 5J5EA 1YEGL 5HHVL 4DVBA 4MJID 5DFVD 1ND0B 4IRZL 1JUFB 1IBYA 5EWIH 5FO9B 1H3WM 2X2YA 4FQ2H 3FUDA 1IGYA 2JIXA 3OJDB 3QNFA 4M5ZL 3FB6B 5IFAH 4FHKA 2EKSA 3K4DA 2R29L 5EZOH 1ED3A 3D18B 1HQ4B 3T8XA 4IKNA 3K8LA 4A4MA 3GF8A 1IC4H 4CC1A 1UVQA 2Q3AA 1WAPA 4J8RB 4MNGA 5EBLB 1YO4A 5BJTB 4W9HC 1JHLL 4KKCD 3QCUL 1W8NA 2XOTA 4U7MA 4XBPA 4G6AD 2PP7A 1NMCB 2OCCB 5DJ6A 5BS0E 2F53D 4NKMA 3INUH 1D6VH 1M1SA 2OW7A 5LDUA 2EE9A 5AX1A 3QAKA 3Q7JA 1ODAA 4Z7QF 4UILL 4FXKA 5KVFE 5DCCA 1CXLA 5HYIA 2ARJB 1B6DA 3DMMD 3QNZA 1U91B 4ZO9A 4UB0H 2AI0H 3ZK0A 1NSNL 3BD3A 5GGVY 2FGWL 2H1LM 1FQ9C 3SYAA 2ZF8A 1XB8A 5DDHB 1FAIH 2B59B 2B1HL 3CSGA 4FTDA 3ZE1F 3LKPB 5AWZA 4RFEB 3E8UH 5T3XD 2A9CA 1N7MH 1S7SB 1MHCA 1TJGH 1URIA 3BP4A 4Y16D 5F9JA 4EN2A 4FZEH 3QUKB 3VVWA 2BRRH 2RQEA 1HX0A 2X7LA 3F65A 3FU8A 4ELDA 4NQDB 2LLNA 1AQ8A 3CZLA 4PRBB 1BX2B 1ZGLP 3VMPA 4G7RB 2FECI 1NC2A 5F21B 4JFOA 1I3VA 4GBRA 3HR5A 4A38A 4YEFA 5EEZA 4S1QL 2PCYA 1C5DB 1NCAH 5FCUL 4EIBA 3VXUD 4ODUA 4NYLA 4AV5A 2WZ0A 4K07A 3H8NA 4DK5A 1AYOA 1I1RA 4NENB 4HGKC 3WEMA 4AIEA 3WFDL 1ZHLA 4BZYA 4LCCA 2DEXX 5LN8A 3ULUC 4QY8A 3ZMEA 1C9SA 4TUKH 1HU8A 3LEXA 3IGKA 3ZPRA 1AO7D 5DD5H 2R0KH 5AVWB 3GTTA 3LPPA 5KYXB 4L5FE 2J5LB 4PEEA 5DZJA 2DIAA 3BN3B 5D2LB 1TQTA 2ATPA 2VMEA 1UWYA 3HI1A 3W39B 2QQNL 3WY4A 4XMKH 3T0ED 4EEEA 4O2CB 4MNHB 5DVNA 4KVNH 5HHMD 5DUBB 1MLCA 4X7EC 3C9NA 2N0KA 3ASNB 2ENQA 2SEBB 2VDLL 3X12A 4U1HB 3WIFA 3VWKA 2ZP9A 3ZDXE 4L3FA 1BZEA 5I6OA 1GYCA 4O4YL 4HP5A 4R7XA 4X9HA 3ATEA 5G36A 3C75A 1ROCA 1HCZA 1N2RB 5CP3A 3MUHL 3LMJH 1CICB 1Z5YD 1LO4H 2YPVH 5C0CE 1KJVB 3I6KB 5FYLH 2EVFA 2VR4A 2GSIB 3O6FA 1C5BH 4DZBA 4KKLD 3L95B 4Q6IA 2ZAIA 5EO9B 4RLDA 1QHQA 4KMLB 5AOJA 1BF2A 4F3FA 3N40P 3NIDF 2BERA 2EUWA 4OLZL 2Q6WA 1NDGB 4N5ED 4OCNC 2EIZB 3GMPB 2X4OB 1UZGA 4HMEA 3VDAA 3BKJL 3FQXB 4OV5A 2BIMA 3AYMA 5D2NB 3UTSE 3PP3H 1E9PA 1XF4A 2I1XA 4YGVB 2ZONA 5BZZA 1D9KC 4APQB 3SQRA 1OARL 4KMQA 5I5JA 5KUMA 1G87A 2MCG1 3RVTD 1BZ9A 1QACA 5GXBB 4LPTA 5LAPA 2AEIT 4XB8A 5AZEL 3X3GH 4F37K 1NJ9B 1O0AA 3MMEA 3O2DL 1OAXH 2ZXGA 5B1BB 1XFPA 3KS0H 4YSUA 3GTNA 2NX5D 3DTXA 4ZOCA 1WD8A 1QEXA 1QRNA 2F5AL 1E12A 3LEYH 4QXTB 4KDTC 1IC5H 4FZ8L 2OMVB 5L9DH 4OZIB 1CGUA 2VDRH 3CIQA 3LNFA 4GSXA 1MFAH 2Q3ZA 3LKQB 4YXLL 4LRNL 1CTOA 4BCZA 2CPCA 5ESVA 3S5YA 4WKXA 5SWSB 3QDMD 2BZCA 2BHFA 4X5WA 1P4IL 1QPKA 4JM2C 2BOBB 3PWVB 1OOAA 1FGVH 4IBUA 4CC4C 2I25N 3NTCL 4I9XA 3R18A 4KKQA 6PAZA 4N8CL 1T21A 3AUWB 5BO1L 4PGEA 3LAFA 3FDWA 5HPMB 5KSAD 1NLBL 4AL8L 4PJCE 3AS2A 3QPXL 3VH8B 4GEIA 5F9WB 3HI6L 3ULUE 4GO6B 4JGUA 2YS4A 2ZYHA 1L9TA 2KQNA 3GXUB 1BSIA 1LWHA 2KPWA 2HXAA 1AXTL 1KPRB 2TSBA 2E7LA 4PJFE 2Q0ZX 2ZG3A 3HNTL 5D70L 2A9DA 4L29A 4R4NC 3KWTA 2F19L 2OTUA 5L0QC 1S9VB 1SVBA 3EG9A 2LAAA 3QQ4A 3BUDA 3B9VA 1KB5L 4P57B 4ZQTA 5E9DD 4GINA 4C47A 3N50A 4PTUA 4IIQB 5KAQF 1T80A 2V2XA 2IXQA 3GNMH 4ORGA 2EXYC 1C12B 2CBPA 1HOCB 2DF3A 4Q4IA 2J6EH 1MXDA 4OUUB 5AKVA 3VRIB 4A67A 4F1ZA 1NMAH 3BKMH 3QIBB 1I4FB 1XF3A 3TZVD 3KPSA 4MWFA 3OG4B 3ZL1A 5EUOA 4ZFOA 4ZOBA 1R9FA 1JWSA 3IMBA 5JPMB 4JFQB 1T7YA 2D4DA 1S7TA 4JAMB 2W9EH 4WHTA 1KT2A 4X31A 4G43A 4NUJA 3DBXA 4X2UA 3PWHA 5H2JA 2OXGA 3S7GA 4KO6A 1DSWA 3DK2A 4GH7B 1HZHL 3GK8H 2P42B 5IR1B 1KULA 4M7KH 2HT3D 3JV0A 4Y5VC 2XG5A 3LN5B 3N44F 1I31A 4R83A 3WXWH 1N5AA 4YWGL 4OY9A 7PCYA 4URKA 3E8VA 1XWVA 2OYPA 5I1LA 3RURA 1MRCH 4X9YA 2VJXA 5G28A 3HZVB 4PRPE 5I6XC 4YDMA 4FXLA 3L1OL 3ZHLA 1Z7JA 1V3MA 1RUPL 5ETZA 4WFHD 2FO4B 1MDTA 2OL3H 2IBZY 3MRKB 4UQ3B 4CVWA 4N9GB 5KVMC 2EKJA 3TEZA 1XSIA 1LNUA 3SODB 3KR3L 4YHYC 2P5EE 4NI6A 3GJFH 2X38A 3ZPDA 2G2NA 4GQPH 5KW9L 4OCXL 4WO4D 2MQCA 3ZEVA 1S9WA 4N0UA 5AVTB 1UH2A 1K85A 2IWKA 4KROB 4OLYH 2CIKB 3EO0B 1FZJB 4G9FD 2CMRL 5IMLA 3V6OA 3UGXA 5DFTA 5HHOD 2VKXA 2WNWA 3JV4B 4QTIL 5JO5B 5IMMB 2O61A 5KVGH 5JHBA 1O7DC 1U93A 3ARGA 3MRJB 5D7LB 4AJ0A 5EIIA 1JHTB 4HOMA 2JQAA 2VDPH 4EPSA 4B53A 4G5ZH 5D5MA 1BF5A 1RUAL 2AZUA 4BGDA 1GHFL 3VX1A 1ULVA 1LQBC 1DQQB 3DJ9A 3LS4H 5BQDA 3REWA 3I85A 3CQQA 3G6AB 4ZMXA 4ZOEA 4TQHA 4PLJD 1F58L 4WV1B 5EBWB 1KGIA 5FLVA 4IOIB 4OI7A 1P7KB 3D0VB 4QT5B 2VZ3A 1F90L 3UIZA 2ENPA 1U8NB 5D1QA 4X7SL 4UDUB 1UOKA 2Z8WC 3VI3E 1Q0XH 4G8IB 2QSCL 2LW3A 3D07A 1I1AD 5J9PB 1DBBL 2DQUH 4LOUC 4ISVA 2FJHB 4JFTA 4Q4EA 3ULVH 2X4RA 2CO7A 3N1QC 4XO8A 3IJYB 3DDFA 1DJHA 4O2FB 4EN3B 3ARBB 3S4SB 4P46A 4QRAA 2CUIA 2DM2A 3A6BL 4D9QD 2PTTA 1E8ZA 3HRPA 3PNWA 3IGFA 3TIDA 3PJLA 1OP3H 3QUXA 4XTRD 2CKBL 1Q38A 3CVCA 3FJTA 3N43B 4UTAA 3SQOH 2EDRA 5DEJA 4XP1H 2X6AA 2HVBA 2R23B 1D3CA 4OCSL 3HPJB 2KL6A 3CFKA 5FO8B 3KNBB 4LGSB 1OAKL 3O0LA 4LDLA 2GK0A 4AGOA 4J12A 1M2OA 3G5WA 2Y07L 1RI8A 3NZ8A 3P4NB 4GEJA 4ETQB 4F15C 3E38A 4HIQA 2MTPA 5I74B 4PRHE 1QR4A 4U31A 4PJDE 2AJZA 3IAGC 4JG1H 1T7VA 1W9XA 3HZ3A 4X6DB 4HMCA 3PHOA 2JELH 4PJ7E 4XPHH 5EU4B 5AG8A 3D39D 1R75A 2AJSL 1OGAD 2J4YA 1IBZA 1JZEA 3B2VL 4J3OD 1NDMA 3T09A 2X4UB 1JV7A 1CD0A 1WHOA 1Z0NA 4UIKL 1QM8A 5H2NA 4YS4A 4PS4H 4P3DA 2XWCA 3BZ4A 1EANA 3MBEC 3VU2A 1QNZL 2CPUA 2N3JA 1ND0A 4H1LA 2GTZA 4RFNC 1BG1A 5FO9A 2X89A 1ZK9A 3A0OA 3OJDA 4JJ5B 3RB5A 2IANB 2WTPA 3FB6A 4RMTA 4JZJB 4OT1H 3EJJX 3MACL 3OKDB 1HQ4A 3NJFA 4MA3A 4TLUA 4UQ2A 3FAXA 3O41B 5FYKE 4PG2A 2Y6TE 3L7FB 1CQKA 3TV3L 3PG2A 3FT2B 3PU7A 1ES0A 3JUZA 4FYTA 1ORSB 1ZEAH 3BVXA 3QPQC 1N0LB 5B7MA 4J3XA 1AH1A 2C9PA 3MXWH 3ZE2F 1SJVA 1CDJA 1KGBA 3B7TA 3NFPB 4IBQA 4NO0B 3VXMA 4XVSH 1MCLA 5L4IA 3L7EB 5HGDB 2GEQA 3F6JA 5EBMB 5AZ2L 3MVSA 1AE6L 1E4HA 1F3JB 4RSYA 2PWEA 2BVPA 1JK9B 1ZLWH 3NACH 3UC2A 5DDHA 2HWZH 5C08A 2J1YA 1Q5IA 3T77B 1FZMA 1NGQL 1PG7X 2UZIL 4F2MA 1H3GA 4GOSA 3P2DA 2RAMA 2ZSVB 3AADB 5ID1B 4IMLB 4DN4H 2WSPA 4XAWL 4ENZA 5C3IA 1Y7VA 2FT7A 2DIBA 3BN9C 3HCVB 3AQXA 4UCFA 5IQ9B 2ITFA 3CSPA 2WZPA 3V55A 3ISYA 1G6RL 3D0AA 2Y06H 4PJHB 4L3EB 5CBAA 1OM3L 4YC2C 1C5DA 4GO9A 1XT5A 4DP0X 4Y2DB 5HGGS 3H2PA 4EUPA 4V1DE 5C09D 2H0EA 2P9RA 4LL1A 5JQ6L 3MGTB 2J8OA 5A16B 1HHHA 5FECB 2ADFH 2N59A 3BQUD 4POZC 5FB8B 3UTWA 1KTRL 1SMAA 4EIZC 3PAZA 4C4BA 1KCUH 5F6HJ 5ANMA 5T1LA 3HA0A 4BEYA 3FFOA 2ZUXA 1OP9A 2WTRA 4K3EH 3TX4A 3AG3B 4M1CD 5KYXA 4IGBD 4ZDHA 3UERA 3PDGA 4P4RA 4D9LL 3EDKA 3V8OA 5D2LA 4HPYH 1ZLDA 2XTJB 1MSPA 4Z3IA 1FYTA 2DTMH 1GZPB 4GKZB 5EUOF 3DVNA 5DYSA 4OIIL 1EPFA 4UQEA 2QADC 4U1HA 4KXCA 4DIXA 4JHUA 3KWWA 4GUCA 5G55A 3L6FB 1A3RL 1S7QB 1QI5A 2CO6A 3AS0A 4YSPA 3GSVA 4CVZA 3T0DA 5GZOC 5LXGH 5AWNH 1B0RB 4FQQA 4PGZA 4N26A 1AAJA 2GKIA 3S37L 3NJHA 3M86A 1V05A 4EA3A 4I3RH 3E9UA 3ULSB 1H6UA 4J6IA 2X3BA 1KJVA 3D12B 2VC2L 1FPTL 1I53A 5IQLA 1DZ0A 3VW7A 2VDMH 2XA8H 1P5VA 3SDXE 2QKIB 3V4UL 1EAPA 3C6LA 5D93B 1XDTT 5C3TA 2H3XC 1JV2B 3AU0A 1JXGA 5I9QB 3U6XA 1JZJA 1EHKB 5F8QC 1G9NH 2Z7YA 3HBQA 4HCFA 4WFFE 3E0GA 4FFVD 1THCA 1F11B 4WK0B 1GY1A 1AHWC 1X0I1 3FFCA 1VJSA 4O51A 1FG9C 4I0PC 4OZHA 5LCVH 1I9JL 3OHMB 2R2EB 4BE6A 3FONB 3HAPA 1JXKA 4LESA 3RJQB 5I15L 1WA2X 2VXVH 4IOFD 1FFNB 1NJ9A 3QULA 4TSAH 3W9EB 1KJ2L 5DA4A 2PXYC 3OE8A 1WC7A 4XBEL 1TJHH 2G60H 2OR9H 3L4XA 3QFJB 5E8EB 4J1UB 4U1NA 3E2HB 5J7CC 4G8GD 4QXTA 1EXHA 1BLIA 3MV8B 5GZNA 3VO0A 4BHUA 4AEFA 3L3GB 1FE8H 3COOA 1N9PA 4UM8A 4O58H 1OAYH 5D5MF 3FU7A 1YEIH 3WL9A 3ARFD 1V8HA 2BXZA 4OJCA 5FIEA 1SJEB 1MW3A 2IOOA 1G9MC 3GXNA 1K3ZA 3CUPB 3KGTA 2ESVD 3MJWA 4JFSA 5MHSE 1JERA 4BVNA 1NCDH 5HPMA 1CL7I 1S7UB 4A7VA 3VH8A 1XR8A 4F24A 5E00A 3VXNB 2VW4A 3FQUB 5K5YA 1U3ZA 4MAZA 1Z9LA 3V4PB 4KK6C 3CFMA 3RWFB 4KXZI 2G5BB 4HUCA 3EYQC 5SX4I 3CFEA 1FFRA 4DW2H 1EHLH 4ANWA 2EO9A 3CDZA 4XAKD 5JLZB 2H6UA 1S9VA 1UZ6F 4MQSB 3IXAB 5B38G 1Q5JA 1MCPH 2FJGA 3MHZA 1QSFE 4L1TA 1MCOH 5LJYH 3GPSA 4K9EH 5JIKA 5CN3A 5ECGA 3I6GA 2TSAA 1LE5B 2ZXAA 3RL1B 2GY7B 5KANI 3IDGA 3O2WL 4IIQA 1BGXL 1RSYA 4ZW8A 5G54A 5DD3H 5T1KB 4M7JL 1HOCA 1MFEH 2FL5A 3A4FA 2ETWA 4IRSB 1FA4A 5DMGD 3VRIA 2JFCA 1DBAL 4L4TB 1DSFH 2E46A 5FA4B 1E9OB 5LB1A 1YEGH 5HHVH 5JW4N 1RZ8B 1JDCA 1I1YB 2X1XR 5IKCA 2WLIB 4IRZH 3WCYA 3QJSB 1A8ZA 3DLQR 4XE5B 5FW8A 3UYRL 4M5ZH 3SOBL 1INEL 3J7HA 4GLRI 1RZKC 3AFLA 4H0IA 2CWRA 3VU1A 5FOJA 4CW1B 1UFGA 3NJVA 3QFDB 1ZA3A 1KLFB 2Y7NA 3ZYOA 4XZ4A 4LPUA 1JHLH 1OLZA 1R3IL 2YPKA 1YEDA 5D71L 9PCYA 4LGRB 3W0WD 1CYGA 1N6UA 1GTFA 3UG3A 2VW6A 4KDWA 5LO7A 3UG9A 2UZYB 1JF6A 4UILH 5DFVC 3VGBA 3VFOB 1JDDA 1HKFA 1IXFA 3PNRB 4P5MB 2VR7A 1F6AA 3ZDZB 1NSNH 1J0YA 2FGWH 3Q13A 3HPLA 2XG4B 3MRKA 4MJ6A 2G4EA 1I7UB 3QEQA 3ZDXB 3KDMB 2B1HH 4ONHB 2YSSB 5IIEA 3HUJB 5CSBA 4NOBA 4FNRA 4M62L 4QTHA 4G8FB 5DRWB 2ZZLA 2IMMA 3LVEA 1LO2L 2DL2A 4JO3L 1AKJA 3M17A 2X2HA 2OBGA 2VE6B 5D7HA 1PY4A 2H3NA 3FSVA 2CIKA 4PHZA 2VSDA 1ZJBA 3UTPE 2P52A 3BJLA 4NQSA 3QGVA 3TA3A 3KGSA 4S1QH 4X8GA 5FCUH 2DRUA 3IF1B 5DK2B 5IVOA 4XP5L 1IGCL 3FO1A 2XWTB 3CPLB 2GBUA 3RTQA 1KTLA 3WFDH 3RGVD 1ZJAA 2H2SD 3DV4A 4KMTL 4KTEL 1ORQB 1PKOA 3WKQA 1W8EA 1UA6L 2E86A 4E5XA 4UIMA 2NZ1A 2GABA 1DUYA 1YZZA 2YPLE 1WV7T 4I8DA 4WV1A 4LLDB 3DX6B 3HAEH 3IDMA 4OD1L 4P5TC 1J18A 4B7IA 1ZT7B 2R69L 2AXJA 3B1TA 2HFFB 2WLYA 3HHRB 2WV3A 3LSOB 4MA1C 4KJWD 1JE6A 2XKNB 2QQNH 1JBJA 5D7IE 2EVGA 4G8IA 2VXQL 4WTXA 1G0DA 3DXAD 3ZIYA 2ZPKL 3D2UA 3V52L 2E6PA 2VDLH 2Y4SA 4NCC2 3V6BR 4BUOA 1XCTB 2K8QA 4WFGE 4R97C 2GCYA 3ZJAA 5BRQA 1CI5A 1BOGB 1FIGL 3QQ9C 2FH6A 4OI9A 4Y2LA 3W9DB 4XNDA 3U7AA 1BA9A 1BQHB 2Q20A 4PN6A 1MOEA 4TF4A 3DX4A 2OSWA 3OAXA 5HJBA 4HJ0D 5C7XL 1MW1A 2WXLA 4AH2A 3FOMA 4OTXL 4YDNA 4NM4L 3T6XA 2VLJB 4DUXA 7FABL 4PJCB 4MCYA 4LAJH 4PQXA 4YFDB 4BK5C 3RUGE 4QIDA 1KIRA 4I5BA 5B35A 1QW9A 3D09A 3P4NA 2EXSA 4OLZH 2GFBB 5HYEA 3IDNA 3QHFL 3FRPA 3GRWA 1Z66A 2E47A 3BKJH 4QRFA 4BEZA 2IGLA 1SDAB 4F7MB 4W9FC 1PU0A 3NCYS 2AP2A 2WOBA 2I5YL 2WP3O 3MODL 3UC0L 1OARH 5I1DB 4FMFA 5C0DB 3I50L 2WNXA 3BRFA 3VXOB 5AZUA 4W93A 5AZEH 4DKDC 1LP9A 1P1ZA 3EJZC 5HYFA 3IDXL 1F18A 2OYLA 3O2DH 1OKEA 1ETB1 1IKOP 4JFFD 3UTTE 1FL3B 5IOPB 1TUPA 4HU2A 2F54B 1RULL 4ANVA 3US1A 2F5AH 4L1LA 4JJ5A 2ZKYA 2IANA 4N5EC 1UT2A 4WIQA 3QBLA 3KE0A 4JZJA 5DHEA 4FZ8H 2D4FA 1ZVYA 5EMYA 1A2YA 4L4VD 2X44D 4OZHF 3D8MA 3Q8AA 4LRNH 4JKVA 1XEDA 4PB9L 4WRLA 4MD2A 6FABL 3HZKB 4ZODA 3RDTC 1P4IH 3NCWA 2XTSA 1KGCE 1U8PA 1N0LA 3NTCH 2YD5A 4N8CH 4WI7A 1GZQB 1Q1JL 3DC0A 5FAAA 3VFWB 1MPAL 5IW1A 2KT6A 2VJ0A 5ALBL 1SN5A 3CBKB 5BO1H 3PXHA 1TQSA 4PJEB 4QHLB 1JNNL 2P4AB 1S7XB 2ZX5A 1NLBH 4AL8H 1A1MB 5ELIA 3QPXH 2IDCA 1XH0A 5A1AA 1A7OL 1MLBA 3HI6H 2F8IA 3FB8B 5IQNA 5BXFB 2CGZA 1QW8A 4HJSA 1AXTH 5I0XA 5KS9A 3PPEA 4HZ1A 4BK4A 5D70H 1ZTXE 3HNTH 4GAFB 5DK3A 1BYPA 1FFPA 2YC1A 4PRPB 5JDSB 1TQBB 2F19H 1CFSB 4P23A 1P6AB 1TCMA 1ZT4A 5HTSA 4ABWA 4M9PA 5DFWH 2YQ2A 2BDNL 1E42A 1IGJA 1P4LA 1EDHA 4JPSA 4XCEA 4LHQB 1KB5H 1QEWB 3HCVA 4ZAKA 5EC1B 5KJ4A 4UT9A 3W38A 1YRKA 4N3UA 1UXSB 1KXTB 5KSAC 2AZAA 3B9DA 3HZYA 5IB5B 3S35X 5A2IH 2YEZA 3L9BA 4JRXD 4QHMB 4IHOB 5SX5K 5EF1A 4L3EA 5IHLB 1ERNA 4L9DA 3EJSA 1F50A 4DT2A 4ALAL 4Y2DA 1RCYA 4OZGB 1LDPL 4L1BA 4PCSA 5DZ9A 4AQEB 2N01B 3QR2A 1M1XB 3MRRB 5GRUL 4EI5A 3BXNA 3CAPA 5KVEE 2V5RA 1JPGA 1YC7A 1LEIB 1BFVL 2P1YA 4KX8A 3U7WL 4GI6A 3RKDC 4KHTL 1Q94A 4HV8B 4JM4L 3S8GB 3CFTA 4FLQA 1HZHH 4K8RL 5IB4A 5D1ZB 4TVUA 3VE0B 4H2CA 3OKNB 5L0QB 4IOSA 3PUUA 4YWGH 4QGTA 3CJJA 3QPKA 1M6OB 3V7AG 1JWMA 1T0NA 4M43L 4CU7A 5IGXL 1DN0A 2LHAA 1A4BA 3KPRD 4M7ZC 4Q14A 3ARQA 5MEOA 3L1OH 1RUPH 5CEYB 1OM9A 3IKCB 1C8QA 5IQMA 5CHNB 3WN5C 3KR3H 2A6KB 2AAAA 3PQYE 3FH8A 5KW9H 4OCXH 3GI8L 3JV6A 4B3VA 1DE4A 4XTOA 2NTSP 4HYTB 3LD8B 2HT3C 2QKIA 2KZBA 2PN5A 2CLRA 4HX1A 1HESA 3QJQB 3BVTA 3GZOA 5D4IA 1FGNL 3REVB 1JV2A 2APFA 2CMRH 3S36X 2EDEA 4JN2A 1BHGA 3U9UA 2Y6SD 4E42B 1Z1WA 4H8PA 2YLKA 4QTIH 4XP9L 1TKWB 2HFEB 4GXUN 3CFBB 5I1GL 5B8CA 5FGCE 3QRBA 5JW4Q 5C0AE 2AV7B 5ITFB 4HDIB 4PJDB 4F2EA 2XV0A 1N0XL 2R2EA 4GBXD 4MS6A 2F93A 3WJJC 3DO7B 3AU1B 5CIPB 1RUAH 1GHFH 4Y5VB 5KZCB 4WO4C 1U8JB 4K5PA 1FFNA 3QXAA 4U1MB 3WD5L 3U2SB 1MH5B 1F58H 5TF0A 3GLAA 1XH1A 1D5XB 1HIML 3FO2B 1O6SB 3LKSB 1AD0A 1F90H 3MLUL 3QCVL 5I6XB 4FKKA 3ZHFA 4X80L 2UY6A 1G1KA 4X7SH 5H37A 3S2AA 3L3IA 3TBVA 3E1F1 3MV8A 1IV8A 3OBAA 2XN9E 4NJ9L 3O9WC 2DMGA 2QSCH 3HVDA 4MQTB 2ZCKL 4GRLD 1DBBH 4YLCA 2N1TE 1EGJL 5HDLA 5FV1L 3N1MC 1DLHB 1SJEA 2ADYA 4TLSA 5DC0A 2AEPH 3A6BH 4PLJC 1Y0LA 2FIKA 1AGEA 5AOKA 3ZBMA 5F3BA 4APXA 2CKBH 1E4KA 3T2PA 4MJ5B 3QUYD 2YWYA 1I3GL 1QHPA 1SXBA 5F0PB 3P4OA 5FLUA 3VGFA 4OCSH 2BSEA 3RWFA 1OAKH 4DPBX 1I1AC 3SPHA 1KXVA 1ZGLB 2Y07H 1OTTD 4NQED 4WCYL 1M0KA 4E41E 1KEML 3V9FA 1IM9B 1O5PA 2PCPA 3RIFF 1YJDL 5HDQL 3OL2A 4NQUA 2PO6D 3UTOA 3RL1A 4XWGL 2Z1KA 2AJSH 4Z77A 3B2VH 4XTRC 1G5GA 3ZYZA 4JQIL 1OB1B 5CZXC 3SO3C 2QL1A 5C0BB 3BPCB 3CU1A 4UIKH 4L4TA 4S11A 1O75A 3U6RB 1KCRL 4DP9X 1RZ8A 2BWDA 3DX9A 5DS8B 5ITBL 1RL1A 5KYNA 1QNZH 1GGIL 5DWPA 4O2EA 1S7VB 1UG9A 2JJTA 4V1DB 3QYNA 4HZAA 1S8JA 3FN9A 2FWLB 3V5DB 3MACH 2VITB 3B9KC 3V7MA 5HPOA 1P5UA 1BEYL 4CW1A 3QFDA 3ZYIA 2AXWA 5D72L 4RDBA 4HCRA 3DIFB 3E3QC 3TV3H 3NY9A 2E9GA 4JFEB 3HB3D 3KAAA 2APSA 3C5ZB 3OKOB 3KPOA 4J3VA 4PD4J 1LP9F 5AOMA 4Z7UF 5KAQG 3THML 3ZVVA 1HQRA 3AM8C 5JJJA 4FNPA 5IROC 4FA6A 5JHDB 2CRYA 3ARSA 4F15B 3D51A 2WOYA 1UC6A 4QXWA 3NEXA 3KXFD 4HC1L 1DUZB 3L4VA 3VFOA 1LMIA 1MFCL 1NC4B 1UKQA 2XBDA 5AHYA 3BUPA 2HX7A 5AZ2H 1AE6H 2R29A 2YN3A 2VDQB 3RVWC 2OI9B 4J6RL 1PTZA 3T3MF 4B97A 1AGFA 3MREA 3MZGB 2BVUA 4PI2A 5TE6L 3VFTB 1J12A 1NGQH 1WRFA 1EUUA 2UZIH 3KDMA 5E95B 3WLBA 4AM0B 4OFYA 2P80A 1KBGL 3RWIB 1GAFL 1MZZA 3TBYA 5EPMB 4XAWH 1PD0A 3U6XS 4WNSA 4NZUL 4JCMA 4RFNB 3KPLA 5BW7A 3CX5K 4AWJC 5FYJL 1CWVA 5F6IC 2GSGB 4JRYA 2P44B 1MCQA 2JCWA 1PIFA 1G6RH 4JY4B 3IVKA 5LGJA 1OM3H 3MRFA 1JYVA 4KWUA 5DK2A 5KS9F 3QJFA 4R7DA 3HBZA 3T6ZA 5JQ6H 1CDBA 2NYYC 5ID0B 1H9VA 5JIQA 2WXKA 5JOFB 1DDTA 2QFRA 5IOKA 1ORQA 1WAAA 3QUMB 5JMOC 1FCCA 3NOIA 2GT9A 4Z3GA 1HXMA 2D03L 5B2NA 1ZV9A 1IRAY 4W70A 1WZKA 3BH8A 1EXGA 4D9LH 1LLAA 4FKHA 3ZMNA 2HFFA 3LNEA 4Z7WE 3SGJC 3WIIL 2X05A 5ILTL 5L2KE 5D6DC 4RETB 3Q8EA 4AW7A 3KBEA 2UXFA 1EXUA 4OIIH 4C59B 1BZ7B 2BOCB 4A2MA 3IJHA 4BINA 3GRGA 4EVNB 2ZNXA 1OANA 1UTDA 1A3RH 4XNUL 1P2CA 2CJTA 4MDIB 4U6HA 3RB7A 3S37H 4WW3A 3A24A 1YEKL 4IDLA 5C9JB 4M1CC 4IGBC 1LYQA 3OHXC 5IBUB 1X9UA 5F8RC 3T4AC 4CSPA 1MFDL 5HYSB 5DO2D 5K1JA 1YMMB 2VC2H 4CN1A 1FPTH 2ALWA 5K69A 1PNCA 1XXFC 4E9RA 3GEWB 2VLJA 4CU6A 1MWAA 4JG9A 3IS1X 3OAYK 3V4UH 5FGBA 4J4PC 3DIDA 2J8UE 2YAOA 4MD0A 4D0DA 1JPTL 3I02A 4TVPD 2EH7L 5IQOA 1PCSA 5E6IC 1CTMA 2CKNA 1R47A 2Z34A 1MJ7L 3ESMA 1AIZA 1I9JH 4QPEA 5KVFL 1OHQA 1U0QA 3V4PL 3OF6D 3QDGA 5KVDE 4YHLH 5E1GA 1DQTA 3KHOA 3O3BA 4Q6YA 4ELKB 4MAYC 1XZ0A 5I15H 3MOBL 4Q9BA 2FYVA 3NIFB 4JQXA 1SY6A 1KJ2H 2GJ6A 4WW2A 4XBEH 2QADB 1ILSA 5MEQB 1XIWC 1M7IB 5IOPA 2EDDA 2BOLA 2FEDC 1NBQA 2MNWA 4P06A 4BH8A 4FA7B 4U1IA 5EO0A 2D3VA 43CAA 4GG6B 4XOCA 4OZFB 3WYRA 1CDUA 3IXTB 2E56A 4P3WA 3O4LE 4WUUA 3SIKA 1IKNC 3TEXA 5C0NC 2DJUA 3FCTB 3RIAF 1BAFL 1QFUL 2MMXA 3J2PA 4LU5L 5DQ9B 5HYJA 3DX0A 3FTXA 2NY4C 2F8OA 3ZKSD 1A6ZA 1EO8L 4GKSA 3PXOA 1GL4B 2RH0A 3ILQC 1S7XA 1RJCA 4UUJB 4LDCA 3BVNA 4R96A 1A1NA 1X5LA 2IWFA 3FB8A 2FBOJ 1AHWB 4M7LT 4YO0A 3SYCA 5IQ7L 2OA9A 4RMQA 1J05B 1YNTA 4LLYA 1Y6MR 1P8HA 4Y1AA 3SGEI 3ERXA 1P7HL 4LOFA 2DWEA 4PJIB 3VX0A 4I7ZC 5GPRA 3AITA 1GGBL 1IIIA 4LDEA 1NANI 3AMLA 4L5FL 3L13A 5J89A 3KMDA 2PP8A 3VXTB 1ACYL 2FBJL 5E4EC 2Q87A 4RGNB 2GBTA 1L6XA 2DQ6A 4HHWA 5GS0D 4O9HL 3O2WH 1BGXH 1DANT 1FL6B 1UXSA 1KXTA 3TV8A 3VXPA 1OAQL 4M7JH 5FHAL 3RX9A 4AQOA 5BOJA 2L7UA 1DBAH 4PJ9D 4CNIB 4E36A 4HWNA 4XXCC 1MXGA 1Q9KA 2AQ3A 2CJSA 1G7JB 4AQEA 4EJ1C 1NGXA 1LN6A 2Y7SA 1DVXA 3BUQA 2J55A 2AEOA 3N04A 2BHUA 4NCC1 3X3BA 2R7EA 5E03A 3UYRH 4W9IC 3SOBH 2HRLA 1INEH 2GG1A 1J0KA 2NCMA 2PPAA 5FO7B 5JA9A 3VYPA 4PR5B 1ADQL 4WZ9A 3O3DB 3H7BB 4HGMA 4WSJA 5IEKA 1S5IH 3ZUCA 1AI1L 3K8MA 1KYDA 4G80A 4HV8A 1R3IH 4KQ0A 5D71H 5D1ZA 3UL4A 5CKGA 3ZE0E 3CSTA 1S2EA 1LTXA 3VE0A 3HFFA 1T1YA 2G2RB 4A2LA 4A7TA 3SPVB 4UG2A 3OWEA 5DZPA 4UI2A 4D7BA 1DTUA 1M6OA 1MCHA 5D7IB 4KRMB 1G7MB 1NIEA 1PKQA 2PW1B 5D7JB 3OR6B 5CEYA 5F6HI 3BPLC 5EU6A 3RWGA 3C60A 1ZDQA 2AK4A 1JVKA 1YUKB 1DBJL 4M62H 3CFJB 2NMSA 3AT8A 1LO2H 2CDFB 4LP8A 3WJLC 4JO3H 4LCWA 4HEME 5I5IA 4JFVA 2NY0D 3KJ6L 3K2IA 3AY4C 1CDIA 4KQ3L 4K15A 5FDYA 3KPMA 3REVA 1DEDA 4DHLA 3BDYL 5AYTA 4MZIA 3KPQA 3WUWB 4E42A 3DRTA 3GSOB 3KPPA 2Z91B 3CVHA 1ZSDA 4JJHA 3IK2A 3ABLB 4PREA 1OT4A 2ZCZA 4MNQE 5TDNB 4MTMA 3CFBA 3E7JA 4XP5H 1U8KB 1IGCH 3FHQA 3PP3K 4FKEA 2R4SA 4ZX4A 1F13A 3D3VD 2AV7A 3BEVA 5LBSL 4IBTA 2B2XL 2XU9A 2Z92B 1RZIB 4KMTH 4KTEH 4AMIA 4NZRL 4QAWA 1UA6H 4MJIB 3BIAX 1G5AA 3OXSB 4Y5YA 4P2RD 3ULUL 1ZVSA 3U2SA 4LEXL 2EYSB 5DI8A 4OD1H 5J13B 1XV8A 1TU2A 1OAZL 4GMSL 4JKKA 2R69H 1KIPB 3ZTCC 4NZ8A 4LVOB 5I16B 1A6WL 5C0FB 4OM1L 1NAMA 3UPRB 2VXQH 3IT8D 4P99A 2BRQA 2ZUQC 1VF5C 2ZPKH 3V52H 1WAAF 4X4ME 4ZW6A 2EI4A 2H2SC 3CH8A 5CWSA 4AENB 5IP4A 1KG0A 2XWXA 1IBDA 2DQJH 2UVEA 1QO3A 1QI4A 2P5WE 4PHXA 4ZMYA 5JDJA 3DIVA 4R3SB 3TBBA 4AXWA 4YDKL 2ERJB 2BH0A 1FIGH 2ZOUA 4PJ8D 1SDYA 2F7PA 1OQOA 4M6NL 5C0GB 5DJYB 5I6LA 1QZNA 5C7XH 4MJ5A 1RV6X 4KJWC 4OTXH 2BSTA 3ETTA 4NM4H 3NZUA 4D7PA 2OZ4L 7FABH 3FS9A 5D6CA 4Q0XL 1TMQA 3P0GB 4Y16B 3VXRD 2N56A 3TF4A 4F5CA 2RR3A 3X3FL 3BP6A 5EO1A 3QHFH 3X13A 5B1JA 3ZT5A 5FM5O 2YXWA 5BNXD 3LS5L 3QORD 1VGKB 2F74A 2N7BA 4EIGB 3OXRA 3QEUA 3TH4T 3I75A 1E3XA 1TO5A 2I5YH 4MA1B 2ICEA 2DD8L 3TU6A 3UC0H 3VXUB 3I50H 4HJ0C 3BDXA 2OMZB 5C0BA 2AEWA 4JRFA 2JIXD 3DETD 2BVOB 4P2QA 3ZL4L 1PZCA 4GMTL 5ECJE 5KYUA 5A40E 4PW4A 2G3NA 4JZOB 5LKNA 1RULH 3VRLE 3B4NA 3K5RA 4RZCB 1AO7B 4JFXB 1NPNA 2KDYA 3NVQA 4HAFA 3T65B 1WCQA 4GIPD 3NYKA 3RNKB 2EDQA 1OB0A 3QEGL 4JZNB 3UBGA 4PB9H 5ISZE 2EABA 4OGZA 3IKKA 1QRKA 3L3DA 1TETH 1VGEL 1FVCA