2QPDB

An unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unexpected outcome of surface engineering an integral membrane protein: improved crystallization of cytochrome ba(3) from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 36
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2qpdB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2qpdB02
1PCSA 3V9EA 1AS7A 3SQRA 2YDVA 5TK2A 1PLBA 5I5IA 3V2WA 1QM8A 2Y1AA 3S8GB 2LLNA 3G5WA 3PAVA 2UX7A 2GHZA 4XT3A 3PXOA 2HXAA 3OQRA 1BRRA 2I35A 1UCQA 1M9WA 3WKQA 2E86A 3GYRA 4KNUA 5B1JC 4HWLA 5A44A 4GXFA 1DZEA 1QKOA 1M0LA 2VSKB 2WJKA 4GY4A 2EINB 3OMAB 4AKOA 3WKPA 4E9RA 4G7SB 4KNTA 3PXLA 3JTBA 1ZIAA 3VW7A 1RKRA 4YSTA 5B7FA 5AX0A 4BWWA 4OV0A 1JZHA 5H2HA 1HFUA 4UF7C 2DYSB 3OAXA 1JGJA 1CUOA 4K9JA 1GZMA 3OE6A 1H68A 1NIEA 3AG4B 4BK5C 5FC9A 1T5KA 5LDUA 2Y02A 5I28A 7PCYA 4HYJA 3ASNB 3GDCA 1AZCA 2XLLA 4X1HA 2HLEB 2YQBA 4HCIA 4G7QB 3AG3B 1M57B 1R84A 4KO9A 2XV2A 3FPYA 2XX1A 4YSAA 1I53A 2Q9OA 4UAHA 5G2AA 2UXFA 4QRYA 1KG9A 2Q5BA 1FA4A 4GYCA 2XYBA 2H3XC 3QBKA 1A4AA 1AACA 2GB2A 3CDZA 4FPDA 1S8JA 2ZOOA 2YCZA 1EHKB 4KO6A 4BV0A 1AZBA 1NWOA 1SFHA 4DP4X 2VSMB 1P8UA 2QDWA 5D4HA 1J5CA 3D12B 4QKTA 5B34A 2DWSA 3CVDA 4A2FA 2YAOA 1AZRA 5I6PA 1MG3C 4G70B 1ET7A 4KOBA 1PXSA 5B2NA 4N6HA 1CC3A 2HPYA 1E0PA 3KW8A 4Q8BA 5H2NA 3SN6R 3X3CA 1LN6A 2ZIYA 1X9RA 1V55B 3OE0A 4M3HA 3NYKA 3ZDWA 3NJFA 1OCOB 1SHXA 1TEGA 2YAMA 3AY2A 2B3IA 3PDSA 1OCCB 1JFPA 2MTAA 5TK4A 2X88A 1S54A 4GP8B 2RH1A 1AG0A 1PLCA 2IWKA 2VM3A 3FYIB 3NSCA 5TGZA 4P5SA 1HAWA 3AM6A 1MGYA 2TSBA 3EH4B 2CALA 2VMJA 3NY9A 3HANA 1XB8A 4HAKA 4L0PB 2G87A 1F4ZA 1BRXA 1GW0A 2BHFA 3AG1B 3ABKB 3WNJA 4HCFA 1HZXA 2Z73A 4HZ1A 2EI4A 3S3BB 1A3ZA 3ASOB 1V10A 2EILB 4MFHA 3NY8A 4HCGA 5B6VA 4NC3A 3QPKA 3C75A 3UABA 4DJHA 4BWBA 1RZQA 3UONA 3SBRA 5D4IA 2JKWA 4EJ4A 2KSAA 1IW9A 4DP1X 3IE9A 5H2IA 3IEAA 1PAZA 2Y01A 1NIAA 5B7EA 1QKPA 4GRVA 5LWEA 3A7KA 3AZUA 4PAZA 4YSDA 4G71B 1W8EA 2F93A 2UX6A 4NERA 2VN3A 4PXKA 3H56A 2KSBA 5H2LA 1QNIA 4MQTA 1OE1A 2XU9A 1WAEA 1MDAA 1IKOP 4UG2A 3T6XA 2CJ3A 4AMIA 3TA4D 2YAEA 1ETJA 5DHHA 5AZDA 1OF0A 3ZIYA 5PCYA 1BQRA 1KDJA 1L9TA 3UADA 1JXGA 3OD3A 1Q5IA 3VI0A 5BR5A 3WQJA 1B3IA 1J9SA 2ZZLA 4HHWA 4TXVB 3ZPRA 3OMNB 1AOZA 2QT6A 5AX1A 5JJJA 1PY6A 5B1JA 4GBRA 1GS7A 3CVBA 4E9WA 4QI1A 4WTQA 1XJIA 2BWIA 5B1BB 3V9CA 5ITEA 1TU2A 2NRDA 3NS0A 1ZIBA 2BP8B 1S8LA 3C9LA 4JR8A 1GY2A 3NSYA 2ZONA 1NINA 1MG2C 4CSZA 1F56A 4G7RB 2XX0A 2XVBA 3CZUB 1A4BA 4F2FA 2J4YA 5E9NA 3ABWA 4XTOA 3FU7B 1F88A 3EH5B 2QPDB 3N2JA 3OM3B 2EIKB 4BWUA 1GYCA 3X2QB 1J9TA 3FT0A 2W88A 2MRYA 2XV0A 5B6WA 2BP0A 5B0WA 4A2EA 5I6LA 4BVNA 4KOCA 1C8RA 5FJGA 4QLWA 4E9YA 4Y9HA 4ENZA 1BXUA 3OE8A 4F7KA 2JAGA 5JJEA 1NTDA 5I5JA 4BXVA 2YCWA 5PAZA 5DHGA 5JJNA 2M3GA 1IBYA 3ABLB 3FSAA 2YCYA 3PAUA 1AAJA 4MD1A 4MQSA 3NJLA 2BP8A 1V54B 4KO7A 2CCWA 4UHRA 2QDVA 3NP3A 4BDVA 3MX0B 3C9MA 1JVLA 1SDDB 4BUOA 1L0MA 3HEIB 2YAFA 3AG2B 3X1EA 3S8FB 4XT1A 4L35A 2HX8A 1GSKA 1JZFA 1NIDA 3UTYA 3X3BA 4BWTA 2WSDA 2Y00A 3AYNA 5H2JA 3QJTB 4DKLA 1EZLA 2IAAC 5I6NA 1ADWA 1VLXA 2JAFA 1ET5A 2BP0B 1ZDQA 4HHGA 1OV8A 3U25A 2BW4A 5G53A 1ASOA 1C8SA 2GSMB 5B3SB 3T6VA 1W6LA 2QPEB 2I7SA 2YAHA 3FQYA 2BO0A 2YCXA 3T45A 1PXRA 1X0I1 4A66A 2NTWA 1ET8A 1GY1A 1AANA 3NJKA 3UAEA 4ZK8A 1MZYA 1L9QA 2DYRB 2HRHA 2AANA 3ABMB 3DTUB 3OMIB 1ZV2A 2FT6A 2N0MA 1SF5A 1JV6A 1A65A 2IWEA 2JFCA 1OE2A 5I6MA 4DP6X 4E9XA 2PPFA 2BWDA 5F8UA 1ZDSA 1JXFA 2ZWNA 5AKRA 2UXTA 3EH3B 1NPJA 3CVCA 4AKQA 2EIJB 1TKWA 3IBOA 4A2DA 5AFAA 2XV3A 3PCYA 3H4FA 5B7MA 2IH8A 4JQ6A 2FT8A 3HB3B 1S51A 3MBVA 2IDSA 1OE3A 3FYEB 4HALA 5B6YA 1NICA 3TU6A 2I1XA 2UXVA 1JZGA 4KNSA 4FBZA 1ILUA 5B1AB 2BZCA 1GR7A 1L9HA 4QIDA 3RFMA 1JZEA 1JV7A 3QAPA 2DV6A 1IXFA 2PEDA 4WAVA 2P80D 1CYXA 1PNCA 2FQFA 1URIA 3FU8A 4A2GA 5ANHA 1CWQA 2AT9A 4W1TA 1KCWA 3HASA 3SBPA 3WI9A 1W6WA 3MBWB 5H2MA 1AT9A 1IW6A 1ZPUA 1XB3A 1YLBB 4YVNA 5B6XA 4YSRA 2KSYA 1OOWA 1E12A 1GS8A 2BRDA 2R4SA 1SF3A 2VM4A 4DPBX 5I5MA 3FSVA 2IDQA 2I21A 2VW6A 2IH9A 1KG8A 2CUAA 3ZX1A 3NJJA 7PAZA 1JOIA 4DP9X 1MZZA 1TN0A 3NJIA 3FU9A 1WA0X 1FWXA 4JHVA 1XIOA 2XWZA 2H47C 3EMLA 1BRDA 1ASPA 2Y03A 3NJGA 2FNWA 2TSAA 3PBLA 4AMJA 5AHYA 1PZAA 2R7EB 3ERXA 3KW7A 3RYMA 4UANA 2BW5A 2IDFA 2PCFA 1S52A 4J4QA 2B08A 4M4RB 1E5ZA 1M56B 3NJMA 3QQXA 5ETZA 2J56A 3VGAA 1JZIA 3FSZA 4FAAB 5F7BA 4DAJA 5B1KA 4YSEA 4BXSV 4CSPA 1PZCA 4FA7B 2WO2B 3T71A 1AZNA 2BZ7A 4EF3A 3QJSB 3PWHA 4DP2X 3DDLA 2PCYA 3UZCA 1PLAA 4E9TA 2ZXWB 2ZFEA 4AZUA 4IB4A 5G28A 3WNIA 2GC7C 2Z55A 3CAPA 3PQRA 2XUWA 2YXVA 4JKVA 4X4KA 1A8ZA 1XB6A 9PCYA 2FTAA 5F7AA 1SJMA 3HARA 2DY2A 3NSBA 3QDCA 3QAKA 3UTVA 5G36A 4JKNA 2OJ1A 1U19A 5C1MA 3TASA 3VG9A 1VJMA 4NAJA 1QHQA 2PP7A 3NYAA 4K5YA 1DZ0A 3QJRB 3QBGA 1X9UA 2FT7A 3H4HA 3T6WA 3D4SA 4GP4B 1L9SA 3N55A 3X1FA 1AS6A 3JT2A 4HIPA 1PZBA 3BVDB 4W9ZA 4WKXA 5EHFA 3SBQA 1L9RA 4X31A 1M0MA 4X32A 3ZEVA 4DPCX 3VVKA 1BAWA 3FQ2A 2XXGA 1IC0A 1J9QA 3NJHA 2DWTA 1KDIA 3HAQA 1TN5A 1H2SA 4IAQA 1BYPA 1J9RA 1ILSA 4MBSA 2PPEA 4A68A 2KS9A 1J5DA 3UZAA 2YAQA 1OCZB 4IARA 2GI0A 2A3TA 2IDTA 1AQ8A 1S53A 1ASQA 2AVFA 2YARA 3QJQB 1NIFA 1AIZA 3FQ1A 1WA1X 3FS9A 3BQVA 3T9WA 4AX3A 1BM1A 5G2CA 3CG8A 4RH4A 1E5YA 3CDZB 4N8UA 5D4JA 1BXVA 3DQBA 1PF3A 5BR2A 2NTUA 2X87A 4HYXA 2GBAA 1KBWA 1JXDA 2IDUA 5I26A 5B6ZA 1SNRA 2W8CA 2YAPA 3AW5A 3S3CB 1IBZA 1KGBA 2FQGA 2J5WA 2P80A 5KKHA 1L9PA 2XXFA 1KMEA 4A2HA 1L9OA 5G2DA 1UAZA 1NWPA 1SDDA 4BDVB 3UTWA 3TBCA 1GS6X 1KGYE 4DPAX 2Y04A 3FPXA 4YL4A 2I20A 4YSUA 3DKHA 4KNFA 4NB7A 4YSCA 3EHBB 4P5RA 1E65A 1BXAA 1IUZA 2Y69B 1JERA 1KV7A 1CURA 5I6OA 3GXUB 3IN2A 4YSOA 1AG6A 3X1NA 3FSWA 2YDOA 4A67A 5J7AA 1A4CA 3UTXA 4PCYA 5H2PA 2WO3B 4G72B 8PAZA 4E9VA 5ITCA 2PPCA 2YXWA 1WA2X 1P8IA 1N68A 5AWZA 1AR1B 2PP8A 1O0AA 3V2YA 4LDEA 5AZUA 1RZPA 3WIAA 4MD2A 1BQ5A 1OCRB 1UATA 3HAPA 4EA3A 2AFNA 1BYOA 4LDLA 2I7OA 3UAAA 1FFTB 3NP4A 4YVUA 2IWFA 4EIYA 5AHZA 3PLYA 1TEFA 2R4RA 3TBBA 1PY0A 1XMEB 3X1BA 4N4WA 4YSSA 1GU8A 1X0K1 4AKPA 3NSFA 1NPNA 4E9SA 5H2KA 3HAOA 4F2EA 2X72A 2CAKA 4GYBA 4DP7X 3NSDA 2FJSA 4BEYA 4BEZA 4L6RA 1HAUA 1FBKA 3WG7B 3NJNA 2VW7A 3RZEA 3L45A 2GC4C 1QLEB 3P0GA 4YSQA 5A45A 1VGOA 1BEXA 1NZRA 4JHUA 3ZBMA 5DYSA 2AZAA 3ABGA 1KYAA 3COCA 3ODUA 1CYWA 1JZJA 1NDTA 1BQKA 2WJLA 3T6ZA 5I6KA 1AZUA 5H2OA 2PPDA 3QJVB 1E30A 3QBIA 4AI7A 4YSPA 2VT4A 1FBBA 5A8EA 1ID2A 4XTNA 2GIMA 1WS8A 3ZPQA 3UACA 1AS8A 2UXGA 1KCBA 4DP8X 1SHWA 1E67A 3NT0A 4GP5B 3OE9A 4GPOA 4XTLA 5A7EA 1NIBA 2PP9A 3S3DB 1SFDA 3PPSA 1KBVA 3CODA 1F50A 2HRGA 2OV0A 3IN0A 4E9QA 5IY5B 6PCYA 2LNLA 2FQDA 3QJUB 2I85A 3AYMA 2J57A 2EIMB 1DYZA 1RCYA 2FQEA 4N4YB 1R2NA 2HX7A 3KJ6A 3UG9A 2HZHA 3VHZA 1PMYA 3FU7A 2AZUA 4XXJA 1AP9A 2JXMA 2R7EA 1JVOA 2RACA 4LDOA 5B35A 2CBPA 2J55A 1WS7A 2OCCB 4WW3A 3EF4A 1P8HA 4A4MA 4DP5X 1X0SA 2HX9A 6PAZA 1R1CA 1QHJA 1N70A 4KO5A 2VW4A 3X1GA 4KLYA 3REYA 2FWLB 3PAZA 1Q5JA 3UGEA 1M0KA 2H5UA 2L6XA 3DIVA 2F95A 4TL3A 2PLTA 2PPAA 5G54A 1C3WA 3QBLA 1PNDA 5EN0A 1GUEA 4Q89A 4PXFA 4DP0X
chains in the Genus database with same CATH superfamily
5D9SB 2APFA 1CF8L 1W72H 5T3XD 1ZEAL 5KS9E 4X7CC 3Q6GL 3TURA 3B3IA 3OLIA 4FQ1L 2MTPA 4W70A 1U93A 1UKQA 4LLYB 3WFBL 4ZW5A 1SXNA 3I9IA 4DEPB 2XDHA 3OQRA 2HA1A 1S7VB 1UCQA 4LLQB 1S9WB 3TO4C 3IXAA 3D3VB 3ZN6A 4QAWA 5KVGE 3HE6B 1LEGB 2BSBA 4ZXBD 3OC8A 4AQEB 3JTBA 1ZIAA 3MV8D 3PYCA 5H2HA 3CVHA 4QF1A 5LVEA 3WUWG 1BQLL 3B3BA 1YA5A 4P9HH 5EG6C 4JO4L 4BA8A 5T3XH 5DFWH 3AWGA 3OXSB 2Y02A 1VSCA 4HKZA 2GQHA 1LDPH 3KEDA 3NIFE 4Z7OE 2YPLA 2L7EA 4K9EC 4NJAL 1TZGH 4PJBF 1H5BB 1F1AA 4JJHA 4NWTL 3HB3D 3MN8A 3VXMD 3DX6B 3FQNB 2JTYA 2MFNA 1NBVL 4YHLH 4U1HB 2VABB 2H8PB 1PEZA 1SUJA 2BCKA 3A6CL 4WHDA 5LWYH 3JTSB 3BIAX 1ZLUK 3CBKB 3PGCA 2O5NA 3VA2C 1U30A 3VFOA 3BH9B 3CPUA 3OKLA 4TMPA 5EU4B 2N0KA 1NCJA 2YD8A 2DQEL 2YUWA 3DGGB 1OCCB 4BH7B 1OTUD 1RJLA 3NSCA 5SWQA 3VFNA 4JHWH 2VL5A 3MLVH 3HANA 5AVRB 1RULH 3AG1B 3O3DA 3JV4A 2ICCA 3C5ZA 5CP7A 1TENA 2Y22A 3CSPA 1N67A 2E27L 4ZX5A 1QUNA 5F7MC 3BUYA 3ZRSA 5DTFA 3NACL 1P9MA 3EHBD 2R1XA 1MI5B 3WFCL 1HHGB 3UMTA 5ADOL 3MJ7B 3IE9A 1F8TH 1YG9A 1LP9F 1T83C 3EO0A 3ZZ1A 4WWKC 4U1LA 1QPPA 3Q6FA 1QKPA 4PJDE 3OGCB 4Z7QF 1P6AB 5DUMH 4PTTA 2G4EA 1KSRA 2DTSA 4PRDB 3O9WB 5T3XL 4P2OA 2MPAH 5DJCB 5C08B 2ETWA 4QHNA 4DFIA 2FUTA 3KPSE 4E42B 2RA1A 4OZHB 2R8SL 3LNEA 3ULUF 1RXLA 3V6ZA 4L05A 3T4AB 4XCFL 1E4WH 2BJMH 1BQRA 2YQGA 3I6LE 3UADA 4AE0A 1H3VA 1WBXB 2ARWA 2EO1A 5FO9B 1MCOH 4P9MH 5I8CB 3BP4A 2OL3L 2Y2WA 1XEUA 3KGTA 1BZ7B 4M00A 4NN6B 4UOW1 4X42A 5B1JA 4E9WA 3I6KB 1R9FA 5AOLA 1JTTA 5I1AA 1BBJA 4Q6KA 4QO1A 1NGZB 4RNRA 4Z0BH 4YK4B 3BT0A 1DBAH 3L7EA 5I1IH 2DQUL 3VMOA 2BP8B 3L9RA 4I18B 3L17A 1OP4A 4M9PA 3T77B 4AQAB 4KRPC 5C3IA 4M6OL 5GRVL 2C3VA 3RI5F 4NAMA 3I6GB 4OVUA 1KG0A 1XF2B 4B3EA 5IMOB 4MD0A 1AYRA 5JHBA 1U4FA 3HRZB 3ME0B 3EFOB 1F86A 3WFDH 4ELMA 1UB5B 2NPLX 3UBXA 2X10A 4DN4H 4WUUD 1C5BH 1VFOA 2EE9A 4JRXE 3BMWA 2DBJA 3EJUA 4R4BA 1I8LC 2WTRA 5FGBA 2GBVA 5CSZB 1RZGA 2XBDA 2A77L 1V54B 2ARJB 3TWYA 2IQAA 2Q7NA 3C9MA 2XG5B 3QEUB 4PGCA 4XXDA 2KDGA 4H0IA 4P2QD 1GSKA 2VH5H 2Z4QB 3PQYD 1WT5C 2ZX8A 4HEPA 3LKQB 1J1XH 3AXLB 1KENH 3P69A 2XQYK 3DVNB 3MA9H 1JV2B 3RKDC 2F58L 4Z3TA 5GS1B 5KSBA 2R23B 1EIBA 4MD5A 3QQDB 1HHIA 1ND0B 2A6DA 3MA7B 1IAMA 2V0AA 3MLVL 3WDIA 1ZHBA 2GAZB 4EKJA 1KFAH 1YMMB 4M7KH 1NC2D 2QLVB 1OP5H 3UAEA 4ALAC 1YNTB 2JKTM 1N8OE 4Y88A 2DYRB 5KYUB 3ARRA 1WUZA 3GSNB 2D7MA 2JWYA 3RUGB 1RUML 2D7OA 5E2TL 2JFCA 3BQUC 3PV6A 5ID1B 1IAOA 1H3WM 1KBBA 5F1KC 3GNMH 1FN4B 3EH3B 3CVCA 3KWWB 1VEOA 4F3FB 4R7XA 4X98B 4XMVA 1PD1A 5B7MA 1S5IH 4A7GF 2NXZC 3QS3A 1FFRA 5J9PB 1FGVH 3KXFB 5E6YA 3W2DL 3RIAK 1EZUA 3P77A 4OZGB 3MRCA 3WY3A 4X5QA 5CGYD 1BQLH 4WO4D 3UXFA 4RMQA 1XR9A 3GRGA 1T89C 1A21A 3AWFA 4PV8B 2BSTB 4WU5B 4MNGE 2A0LC 4JO8A 5ENWB 3UTTA 2L0DA 3X12A 4U1GB 2DM7A 4OQTL 1W8NA 5HJBA 3PWPB 2CDFB 1YLBB 1M71A 2XKSA 2R4SA 5I5MA 5HHOE 5CLWA 2I21A 5ESQA 3HVDA 4Q58C 3RTQB 3L3KA 4XAKD 4P4RB 1PQZA 1UWGL 5MEND 4PJHE 2CK2A 4HUWB 5F1IB 4HVBA 4M61B 4P05A 1PZAA 2BSSA 3QDMA 1CIUA 2DMKA 3GZQA 5GRVK 1MCDA 4OGYL 3UBXI 1N64L 2YSSA 9CGTA 5I75C 4N2OA 4LBAA 1EUUA 1LQBC 2BIIA 1YN6A 5E94B 4I4WA 5E6IB 1JZIA 2ICEA 2AAVA 4K4KA 4P46B 4YSEA 5DQDH 2GEEA 1JZ8A 3N1GC 3WHXB 1AZNA 2GY7B 4AMKL 4GW5A 2F54D 4R84A 3H2PA 4R3SB 1KGIA 4PI0A 4IB4A 4NBZB 3WUZA 4AEIH 5I0WA 3T3ME 1M42A 1S78C 1CE1H 4XVUC 4A55A 3QNFA 4CUCA 3QEGL 3VXOB 4EVNB 1GJUA 5TH2A 5C8JB 1SJEB 4KK9D 2AJXH 4YHNB 2R83A 4N90E 4WNJA 3N0PB 1KULA 1XB6A 3ARGA 3GFUA 5IESH 3MRGA 2J6EA 2BINA 4YHLL 1DVUA 3U4KA 3HZKA 3SO5A 3UTSA 2XN9A 3NSBA 3EAKA 4L9LB 4P5TD 3SPIA 3V6OC 2MPVA 3EJTA 4IEFA 4WHCA 4QXUL 2KBGA 3HPLA 3TN0B 3ECQA 1NGXA 2VXTL 3Q5YA 4IGBC 4CNIB 1T1YB 3H4HA 4NLHA 3T6WA 5JHDE 1OW0A 1JG9A 3B7SA 4O51B 4YLQT 5CKAA 4HIPA 3BVDB 3LIUA 4ONGH 5B8CC 5KYWA 2G60H 3MYZA 4R96A 3D69B 3MHZA 3VXSB 3TLRA 5GRWA 2NTFA 2EDRA 2PPEA 4D9QD 2DQFB 3WIIL 3U9PH 4YIQA 5E1IA 4POYA 1R24A 1UOKA 2C8NA 3CUPB 3NCJH 5KANI 4PH8A 3LQMA 4AX3A 5T1DL 1SOSA 1RQ5A 1ZLVK 1MLBA 1UJTA 2P52A 3DO3A 4EQ3A 2B1AH 1IEBA 2FX8H 4K3GA 4PRID 5AW1B 5IVXE 1A9VA 3KS0J 4FNLH 3SKNB 3MPCA 5ADPL 3M88A 1BAFL 5AW2B 1JDDA 1Q0EA 1JGDB 5FLVA 5FPIA 2WQSA 1MF2H 3C6LB 3S36H 1UZ6E 5HYSB 4PJFE 5KKHA 4TQIA 5EBMA 2X4UA 5KW9H 1MIEL 4AUYA 2YD1A 5TF1H 2EDOA 2EVFA 5DJZA 3LPFA 4GEIA 3VU1A 4HBCL 2DDQH 1N5AB 2FIRT 1TSRA 2AEOA 5I6OA 4KNQA 4X7TA 1KBGH 3SCMA 1AHWC 1E8YA 2QR0A 3B9KA 3WENA 4UTBH 1G7MB 1Z9OA 2VDOB 2IBGA 4J3XA 5LNEA 1HZKA 4G72B 4E41A 3OG4B 2PPCA 5BS0B 1NJ9B 4MKMA 3MTRA 1N6VA 4JKPH 3O45B 4L8BB 3F7YA 1A47A 4LGRB 4P5TC 5EORL 5FF6B 3ZDZE 5IVNA 4ZFOB 1BYOA 4LDLA 1C16A 1T3FA 2I7OA 4J5VA 1IM9D 3KLSA 2A38A 1F02I 5HPMA 2IWFA 2R2HB 3QPQD 5HGDB 5GS0H 1XMEB 2M26A 4NO0B 1EANA 5D7IE 1GU8A 3BUIA 3S88L 4LLWB 5CLTA 4PJHB 3HAOA 1WG3A 1J8RA 1CFTA 5SWSA 1DVFC 2YJLA 2FJSA 3CH1A 4RGMC 4L6RA 2OBGA 2FDBP 1FBKA 1OSZB 2YFOA 1H19A 3CVHH 5DJDA 3INUL 4HWBL 3P0GA 1VGOA 1SVBA 2H1LM 4JHUA 3ZE1F 3VRJA 4AVJA 4PJGE 4BKLB 1JZJA 5CJXC 1VZGA 3V0WL 4MAYA 3DX4A 4G8EA 2I5YL 1RIHH 1RUAH 3TA3A 3HJ0A 3P4MA 3NN8A 1KJVA 1NL0L 3MUGA 5DVPA 5BW7A 2PWHA 4QCIA 4IU2B 3MLSH 1P4IL 4L3CB 5L2JA 4JK0D 4N2KA 1K5NA 4Y4KA 4XTLA 4ZAKC 3NH7H 5HD8C 1NMBL 3K6SA 3MNDA 2B1OA 4MQ7B 2FQDA 4N5UA 4X4XB 1RSYA 3PHSA 4ADIA 1IKNC 1X9QA 2A9ML 4LSPH 2EXWD 2PYEB 3ARTA 1UXSA 4FXKB 2W95A 3BAKA 4MJJA 3OC5A 1AP9A 4XPBH 2VDPL 3BJ91 3SOBH 5C6TL 1XGYH 3KPLB 3LN5A 5DO2C 3B2VL 2WY3B 4F15B 2J55A 1WS7A 3MA9L 4I2XB 2WMPB 1ZHKB 1NGWB 1L7IH 2R56H 4LL4A 3C2AH 1NEZB 6PAZA 3TX4A 4KO5A 2PO6A 4KLYA 1B3JA 3L81A 5EZIL 3B2DC 4OSUH 5ICXA 5I8OL 1CBVH 2AQSA 2L6XA 4TL3A 1ZE3H 3S98A 4X4ME 5HYJB 2DI7A 2Y36L 3ABZA 4MJIB 3CZKA 3DWTA 4JFYA 4WI0A 4Z3IA 1DQMH 5CF3A 3MCLL 2DD8H 4Z95H 4H8WH 1WHOA 4UIKH 3Q2VA 2O5ZH 3O0RL 4ZSOB 3VXNA 1BRRA 2LQRA 3KVPA 5AVVB 4FQPA 3SKJH 4F7TA 1ETZA 1IGTA 4JFVA 4DZ8A 4E0RB 4G7SB 1KPUB 1XBDA 5HGAA 5J1AB 2CKBA 4EN3A 3KM1A 4R97B 1T6BX 4UT9A 4P9HC 1D5XA 1IGFH 3HC0A 4UOW0 3HE7A 2VDPB 2VLME 1L7IL 1T5KA 2FJHB 3QCTL 4GG6F 2CBQA 4ZBJA 1M57B 5ILTH 3MJGX 3QA3A 4EIBA 2XV2A 2YBRB 3CIQA 2BP5M 5MEQA 3PP4H 1IKFL 5J11B 5DJYA 3MV11 3P54A 4QTHA 2YA2A 3WFHA 2A9MH 4NX0A 2B4CH 2XYBA 3WYRA 2ED6A 3CDZA 3IFPA 4WNQA 4CSTA 3LHPH 1A6UL 2AK1L 4JFFE 3FU6A 4JREC 1GIGL 4XCCL 1JPSL 3HNTH 2Q76B 2KZ1B 3FNKA 4A2FA 5LGHH 4H8UA 3PABA 1PEWA 3MUHL 3EFFA 4FL4C 4Z7VE 1E0PA 5E9DE 5TF1L 4NO3B 5C0DA 3QZOA 4FABL 2PTUA 3VDAA 4EIGB 3E1F1 4TNGA 2X4SA 3BN9C 1PX8A 1S54A 4OD3H 1KJMB 2OTPA 2FLRT 3AM6A 2QVTA 4XC1H 5IR1A 1XB8A 1W72A 2UWEB 4ENEC 3OG6B 3WE6A 5AAMA 3LQZB 2B5IB 2OJZH 2YXFA 5DRWA 2EI4A 1MI5E 3AACA 5HYIA 4DK3A 4APQC 3NY8A 1LD9B 3KLAB 3J27A 1A6ZA 1ETB1 4XCFH 3G04B 1KB9K 5BV7C 4WFED 5T1LB 1U8JA 2R0KH 2E4FA 4S2SB 4GBXB 4CC1A 2XQ0A 1NBZB 2WGNB 4P4KD 4KWUA 2CE6A 1QR1B 1I85C 2IFFL 2VDQB 5HY9A 4HWUA 4NN5C 3PRZA 5EF3A 3UZQA 1E9OB 3FTZA 1XQ4A 3IS0X 5H2LA 1M3JA 2RCSL 3B2PA 3MRNB 4AYBA 4YHKL 1U2HA 2XTSA 4OKVA 5E4EB 4H2AA 2VDNH 3RP1A 5H2BA 4JRWA 1O0VA 3KYOB 1SYVA 3LEVH 4IRZH 5EBGA 2EYRB 5PCYA 3BWUC 5F3BB 3AQDA 4TXVB 3SKOA 4ZW3A 4HUUB 3UZEA 5I30H 5JHLL 2R2CA 1NSNL 5TFSH 4CRPA 3KNBA 1JAEA 1A3RL 4PRPE 3SGKA 5B1BB 4GAJH 4YUEH 5KAQF 3KR3L 4JHZA 4TVUA 4YDKH 3IDGA 3MREA 3C5ZD 3ILEA 4NN6C 4PJAA 1QPXA 3F05A 4QY8B 1YEEH 1DJYA 4I0KA 4L8DB 4AH2A 4XGZB 4JZJA 3NSYA 2IPKB 1V5JA 5EN2A 3GSNL 4JHAH 4HEPG 5B38A 5E9NA 3RE0A 4PHXA 2HVKB 4XRCB 1T0PB 2VC2L 3EO1A 3N6YA 2AK4D 1P0SE 4PRHA 3V4VB 1VGKA 3L6FB 4FCAA 1FFPA 3CLFH 5AAWC 3DK0A 1OF2B 2G60L 2APSA 1KFGA 3MRRB 5KZCB 5EEZA 2V17L 5EU5B 1XEDA 3WHE1 2PNDA 1TOXA 3ZDXF 1XF1A 2Y06L 5E1QA 3HR6A 3UZVB 3PHOA 2HFGL 1DZBA 4HV8A 2NDGA 5GSVA 1CE6B 2Q3ZA 1XAUA 3MUZ1 2CO1A 4OCSL 5E9DA 4FTVA 1Z0MA 2AEPH 3IT8D 2GSIB 2P5WB 2HWZH 3TT1L 4YDVA 1KB5A 2WZPD 1FZMB 1MFBL 1IL1A 1FSKC 2ZAIA 5KTEH 3AS0A 4HJ1A 5D1QB 3TIEB 2YD3A 4KQ3L 5HHME 3QDJE 4WI7A 1HU8A 4I9WD 4Z5RA 1Z9LA 4TPRL 1DDHB 5A2IH 4PW3A 5B39G 5IJDC 4XPGL 3NJKA 4Q9RH 4MMXB 5L88H 2VQ1A 3LZQA 3CBRA 3SO3C 4C83B 1UURA 1ZGLA 1I9IL 2ED8A 5TD4A 1J0KA 3VUAA 4OIFA 3U6XA 3CU1A 2EXYD 2NNRA 2WXHA 4FFVD 2FL5B 2BWDA 4GKSA 2KPWA 5ICYB 3CFKB 3AU1B 4XNDA 4GRLD 5DD0L 1JD9A 1FV1B 1RZ8A 1GGBH 2YQ2A 1PSKL 1T7YA 3G6AB 2ROYA 4JQ6A 4J4PC 5CGTA 4TVPL 4PP2B 2VITA 4G9FE 3H7BB 4TUKH 1NICA 3OKEA 3UTPE 4X4YB 1GOFA 1UWGH 2AMUA 2W0FA 2ZWLT 4GW1A 5CD5D 4TOYL 3HZVA 2OMZA 1GC1H 2OXGB 2ATPB 2WZ0A 3OHXB 4PJGF 3P1VA 4ZAKA 1DQTA 3TFKC 3SBPA 1YYLH 2ZTBA 4XC3L 4TTDD 1M05B 1DQML 1C5DB 4YVNA 3GJFK 1PKQB 5HGHB 2WO4A 2WVUA 3KYMA 1ZSHA 4IRJA 3A4DA 4WWID 1B90A 2KDYA 4BD4A 5GGUB 4X4MA 2OMBA 4FLSA 3HNSL 4UBDC 3WY1A 2CDEB 1KLGB 3AY4C 3T0EA 3IAGC 3CCHB 5DUBB 4EOWL 3QH3A 5E5MB 5FYLH 1EPFA 3MRFB 4TSAH 4LDOB 3NZHL 1OHQA 2BW5A 5FYJD 2X1XR 2GTWB 1I7UB 2A0LD 3D25B 2ADFL 3S37X 5C0NC 2WXLA 3GNML 5C1MB 5A2FA 1CXFA 3HS0A 4UZUA 1FHGA 4FAAB 3V79C 3GLAA 2BS71 4HS6B 2WANA 1WC7B 3EYVB 5ETUA 3QJSB 1I1AD 3QXWA 1JZ4A 3UZCA 5IVZA 2MNWA 2AGJL 3R7RA 5IBTL 1GH7A 3ZJAA 4FNQA 2G30A 4PMEA 1P4IH 3MXVH 2RFXA 1CD1B 3BZDA 3LY6A 2ITDB 1U8CB 5HVGB 5ELIA 4B53A 2YXVA 1A7BA 3QDMD 1A8ZA 4HPOL 3I6SA 3WBDA 1HE8A 3HARA 5JQHC 3D06A 4KVCH 3MBEA 3UDWC 4YFLI 3DV4A 2QHLA 2EDBA 4RVBA 5LN4A 1M6UA 2PP7A 4TVSa 3JWDC 3SDDB 5GGVH 1X9UA 5EPMB 2OMVB 4GP4B 5I30L 1XD0A 3UP1A 3HZMA 4KKZA 2LVEA 5KUMA 1EHAA 4BSVB 2YD2A 1I75A 1C08A 5KG9B 4H7VA 1M0MA 4PJ8A 3VVKA 3H9HA 3ALPA 3CNKA 4OLYL 4JO4H 1JWSA 1D6VH 1YMHA 3OXSA 3DDFA 4YHKH 4APQB 4WWKB 3VI4A 3W9EB 3IJEB 4H25A 1Q9KA 1QQDA 4JVPA 1NMCB 1AQ8A 2GITA 2YARA 5K1VA 3VI3B 3VSVA 1F3JA 5JHDD 1B4LA 3R8BB 3ARED 2QPSA 3OF6D 5IVXB 1P1ZA 4K71C 4KFMA 3HA0A 4L8SB 4RMRA 4UT6H 4WGVB 1BXVA 4U1IA 5IOPB 1C8QA 5EA0H 5CZXC 3S37L 3VFWA 1JXDA 5F0PB 1AHMA 1CXEA 2IPTL 2ESVB 2EQDA 4K5MA 2YRLA 1OB1A 3SCMC 4ABWA 4Y89A 1KB3A 2FEDD 3VVWA 3GKWH 4U6XB 4WU7B 5FKPB 3BPLB 1JF1B 5ID0B 1B0GA 5FYJE 4FX5A 5EU4A 4KKRA 4NB7A 2NSXA 1AD9B 3IVKB 2CJSA 3V0VA 1FAKT 5HPOA 4K3DH 5JYLA 1U8IB 3ML8A 4OV6F 1HHHB 3BKYL 1SY6L 1TQCB 4OFYA 4HMEA 8PAZA 1DEDA 5CILH 1E3ZA 5DJ0A 5AWZA 4UQ3A 3C5ZB 5CP7B 3MLUL 3KLHD 1VPOL 3DBXA 3GRWA 3CFDA 5GS0L 1N6QH 1Z5HA 5ESAA 3QG7L 1T20B 1E8XA 4XAWH 4B9IA 4PY7A 1HHGA 4XNZC 3WFCH 4NRXA 5AHZA 1NGPL 2BK8A 4K8RH 3GJEB 3X1BA 4YSSA 4U1LB 2VM9A 4XH2A 1DJXA 1AC0A 3SCMD 3EBAA 3O3BB 5L2KE 4W9CC 3I85A 4YHPA 4P2OB 3T5WA 2X2JA 4QHNB 1IBGL 3IJSA 3WEMA 2Q8BH 1GAFL 1BFOB 4LBEB 1KLFA 3IJHA 5FA3A 3C8KB 4YSQA 3VA6A 3H85A 1CYWA 1GZPB 1WBXA 4F27A 3AB0B 3TNNB 4BZ1A 3LAFA 3IGAB 4BQ6A 4P2QE 3BP4B 2APBA 4AI7A 1MJJA 1BZ7A 3RVUD 4X8JA 4Y16A 4HUCA 3MBWA 4J8QA 1X5LA 2XWJA 3EFDL 1LLAA 4N2AA 3R8QA 1X5JA 3GXPA 1A8JH 2Y7MA 3L7EB 4BK8A 5BZDB 5I76A 1LVEA 3WL9A 4LSSH 1SFDA 3CODA 5TF0A 5IY5B 1MY7A 1AKJA 1QVOB 5E1AB 3T65A 4KAQH 1UZGA 5IROD 4OCWL 1QLEH 1UVQB 2C3VB 2J57A 2ILLA 4QXWA 1KY7A 1NMAL 3GHBL 4FL4B 2FD6H 3FUDA 1UD3A 1IBDA 4R9HA 1ADQH 1PMYA 5E7FA 4OCNC 2R7EA 3BAYA 1ACYH 3M45A 25C8H 2J8UE 2CBPA 4HIXH 4OF5A 1MHPL 1X5MA 4RGNE 4XPAL 3ME0A 3C5SB 4R5XA 1KXHA 2OCCB 1D7CA 1UB5A 3QWRA 1P69B 4G6JH 3ZTJH 4AM0B 4WENB 4BCYA 4Z7NE 2HG5B 2AJSL 3HHSB 1QO3A 5E5RB 3V4PL 2A6KB 2DS4A 4PBDA 2EEBA 3DMMC 1YN7A 3CFJB 5G54A 1G5GA 2GYSA 2JJTC 2VR9A 4HUNB 4HH9A 5CXPA 3KG5A 3T2QA 4PGCB 2CO6A 4XXDB 4NUJA 3F62A 4DUXA 1OP3H 2NYYD 4IMLB 3EJPA 3GMMA 5FFGA 4N68A 2X09A 2I35A 1BVKA 3TYFA 1IC4H 3LKQA 4Z7VB 3AXLA 5GRUL 3V4LA 4UT7H 1M2VA 4GXFA 5FYKH 5D4QA 5HHVH 2XQBH 2VO8A 4MD5B 1ND0A 3LPOA 3SKMA 4U0RB 3IDNB 3MA7A 3B9EA 3REWB 1PZSA 3UJJH 4F9LA 5B8CB 5EF2A 4BFKA 1M1XB 4BWWA 1SN0A 1AGBB 4ZW6A 4B0MB 2VISA 3RUGA 3UIZA 2ZWKA 1PZ5B 3OE6A 5JR1H 2NY7H 4RWYH 2Y7QB 3HNTL 3N43B 43CAA 1QBML 3NCCB 4TVPE 3VD1A 5JXAL 4CC0A 1FN4A 4M8RA 2J73A 3LRMA 2HLEB 3GBNL 1NH6A 4ODSL 4ZQKB 3VDBA 1R84A 4DQOH 1P5VA 4NZUL 4W6YB 3M1BB 2EH7H 4Y1SA 4XBGA 2H1XA 3WJJA 5IFJA 3FC8A 4FYTA 2AI0L 2K6ZA 3LPWA 2XVKA 3QAZC 4AGOA 3A22A 3RWCB 3HUJA 5CD5C 5DC9B 2VOTA 3ULVD 5A2KH 4MCYB 1S8DB 4BV0A 1IGMH 4UTCA 3VXTB 5F7DB 1L0QA 3H8NA 4HIQA 4K3JL 3UTTB 2YN5A 4CMHB 4JPWL 5DVMA 1ZV5A 2JJVA 1N19A 3VI3E 2WV3A 3VSUA 1MCRA 1OCWH 3TV3H 3F7KA 4L4VE 3X3CA 2NLJB 5LXVA 2VRKA 4GT7A 4HK0A 1M71B 3RZWA 5ERWB 3GMPA 5ESQB 3RB7A 4Q9QH 1JRHL 1X7QB 4PGZA 5DVKA 1DBJL 5D1XB 1PQZB 1PLCA 4RIRA 3IPFA 1MCEA 3SHSA 4KAQL 1MGYA 1VADB 2CALA 2TSBA 3ZTNL 3NFPA 4HUWA 4LCWD 2XFGB 5KVFH 3GMLA 3PQYA 1NBQA 4HZ1A 1TVBA 3ASOB 2OCFD 4M4RA 1U8KA 2IH1B 2LTQC 1AQHA 5E94A 2WXMA 3U9UB 4Z76A 5EZOL 1NA8A 1IE5A 2BNQE 3ARWA 5IQMA 1N26A 1DVFB 3AS3A 4G6FD 1NIAA 4R26H 3O6FA 5SX5K 4C57C 1TJHL 4G71B 1QMUA 4XE5B 3CFCL 1QEWA 2LFEA 4AQOA 3VXOA 4FOMA 4XPTH 2Z4TA 1NCCL 3MRIB 1TIUA 5E2VH 2KSBA 1F6AA 5HHOA 4LPCA 3D85B 4BRVA 2GT9A 3B6SB 4LNRB 5F9JB 4F80A 3MRGB 2R27A 5AZDA 4BFIB 4UILL 1CGVA 1DHKA 1L9TA 1NGPH 4QHLA 1WAPA 1PJ9A 5INCB 5GS0D 3PNWA 3PL6A 4UMSA 1H9DA 1MFCH 4IEFB 5D7LB 3DV6A 5EB9A 4KI5F 1J12A 3OKDA 4CNIA 5HYSG 2BWIA 1T1YA 4JL1A 3V9CA 3WIHH 1ZLWK 4HU8A 3HBPA 3MJWA 3HC3H 3AJ7A 3QO1B 2AQTA 4ZTEA 2XIDA 3FOMA 5HHMB 3SYQA 4AYFA 2D3LA 4HIJB 3K2UL 4EN3D 5I0DA 4M1CD 4NQVA 3L95A 3EXJA 5C0CA 1DQVA 1MCPL 4EDWH 2HFEB 1XTMA 2PXYA 3U30C 5E6IC 4U1KA 3ZZQA 2UY7B 1EDHA 2NTFB 2YZ1A 4M6NH 3SDAB 1HKLL 4YIQB 3EH5B 4K15A 3C5JB 5IP4A 2C9VA 3PDOB 3MJ9H 4K3EH 1RZFL 1CD9B 3QUYA 3GXDA 5B3JE 5IMMA 2FECI 4OF6A 4R7NA 4UINH 1MWAH 1OT4A 5B0WA 2OZNA 3CFEA 3KPPB 5EOCJ 4KOCA 1U8OA 1ULVA 4AMKH 4QXTB 1BZ9A 1Z5LA 3BEVA 5KBDA 3D5OF 5AW0B 5DQ9B 3WXWH 3FHEA 1CK0L 3AMLA 1HESA 4PJHF 3EYQC 1B0RB 2ZUTA 1LP9E 1MCCA 4RBPH 3FF8A 4TF4A 3WS6C 1AAJA 1I3RB 4YDJB 3T0EC 2X4UB 4QRTB 5EORH 3ENEA 3BH4A 4YLBA 4FA8A 5MI0C 2XPZA 4F91B 2WIIA 3C6SB 1G7JA 1MHHB 3UTOA 4NNXA 4B96A 4KQ3H 2QVMA 4LHJB 5CFAA 3QJTB 2CGRL 3G5VB 5FEBA 1RMFH 4P23B 4M43L 1CR9H 4QRUB 1YNKH 5G53A 2HFTA 2QQKH 4BK5A 4E41B 5DQJA 5B1CA 1IJNA 2KS0A 2MOGA 4J3OG 5HDOA 4XXWA 1DR9A 1ZANL 2HRHA 1FYHB 5H4ZA 3ARPA 3BC9A 1C16B 1T3FB 2D2CC 4LDLB 4F7MA 1A65A 3K2MC 2HUHA 1IV8A 2B0SL 5JIKA 3DX7A 4PV9B 3PWPD 1DFXA 3HFFA 4MB3A 1PJWA 2W0KA 1L4IA 1TKWA 3L7FA 4XOCA 3ELQA 1XIWD 2FR4B 3HHMA 1AGEB 2EDFA 4QT5B 3WTWA 3WHE0 3JTTB 2NY5L 3VJ6B 4A7SA 2IDSA 3HMXA 3ORJA 1FFOA 3QDGA 2IANE 5DRXB 4PJ7B 1TCRB 4BE6A 5DJXA 3K4ZA 3BZFA 3TZVA 2BRRH 1RUMH 4I85A 3FT3A 4MZRA 1V7ML 3B7RL 5CILL 5CU5A 1HSBA 5D6DC 4WAVA 2P80D 2X89A 3EGSA 3MFGB 5BV7H 5D5MF 1I7ZA 3OKYA 3NN8B 1KTJA 1XB3A 4KK5D 1DUZA 4EZJA 5DJ8B 4JY5H 3C08H 3OAYH 2IDQA 4A7VA 4K7PH 2IH9A 3RZCA 1HEJC 5FO7B 2AJZB 1OTSD 3KMDA 4XNUL 4KTGA 3UCRA 1CDCA 3SGKC 3KL5A 2LAGB 3CXDH 3NTCL 4KZDL 4R90L 4FXKA 4OJFH 2JXMB 4C4KO 3NAAL 3KPLA 3LN5B 4J4QA 2NR6A 3S9DB 4X80L 2X4OA 3QJFB 2JJUA 4I2XA 5I1LA 2Z92A 5IBUG 3TO2A 3TO4D 3ESOA 4IBWA 1KNOB 2CUMA 2FJFB 2NUPB 3N44B 3OPZL 2OTWA 2FEEL 2IMMA 4FADA 5AYUL 5G28A 2Y6SC 5GQBA 1TDQA 3KE0A 5DXWA 1BD2B 1EGJA 4PJXA 4JZNA 5BQ7B 5CEZE 4Y1AD 3TVMC 2G2RB 3DURA 4I1RA 2QMJA 3P11L 4XPFH 2PCXA 3IRPX 4LEOA 2C9AA 1UOWA 3A4EA 1DFBL 2GI7A 1IT9L 3QDCA 1FH2A 2BX5A 1KEML 2OJ1A 1JHLL 3QZWB 3NTCH 1YEWA 1AC6A 3EJYD 4IHBA 4Y2DC 4E0RA 1VKXA 1QHQA 3W0WA 2IGFL 3WOVA 4C56B 2QVKA 3WO4B 4MS6A 1A25A 1IGYA 1SLWA 3QHFL 4Q9BA 4EN3B 5I8KL 3KBFA 3SBQA 1E6JL 1MREH 2UZPA 4XWOC 1JYXA 2E7LA 3N5AA 3IXTB 1IC0A 5JW4M 3QORD 3C5XA 3F04A 5C0GB 3QZBA 1LYQA 1EZVX 3CHSA 1ILSA 4YS4A 4AT6A 2PABA 4Y19D 3QA3B 3OB0H 2CUHA 2YBRA 1ASQA 1H8NA 2YHGA 4R2GD 2P48B 4X5PA 2OYMA 1KLUB 4HS8L 2FE0A 1WAAA 3TYGH 1QSEE 4WK0B 4NRYB 1T1ZA 1SLVA 4HXBL 3FU0A 1L5GB 2EDNA 3IJ8A 2LE9A 2W8CA 3SGDH 3AW5A 3QJXA 2MSPA 2R0WL 2WBJA 4NBYB 3X14B 3WY2A 1MCFA 3NEEA 4Z7WA 3D9AL 4N0UA 1S9VA 1IFRA 4LARH 4OCRH 1KGYE 1F58H 4KPHL 1MI5D 4HLJA 4OCXL 4UIMA 4XE0A 4CN6A 4I18C 3O11B 5JW4N 1DEEA 3SKJL 4TSBH 5ISZE 1E6JH 5DVLA 1ES0A 4I0PD 2VDML 4DN3L 4EN3C 3AREA 4YK4C 3GSQA 3PIQB 2WWKO 1VPOH 5EFIA 3ZHNA 5TQ2H 5LNDA 4C4BA 1BFVH 2QQKL 2I24N 1J8HE 1PYWB 2VR4A 3FRPB 4QYAA 5KJRH 4XAKE 2V2WA 5T5NF 4ZS6C 4Y1AB 2CRIA 5C08D 3D33A 2DYPB 2I60L 5K39B 4I88A 1CDGA 1VACB 4R0LB 2DOCA 1WFIA 2YJQA 1LD9A 4H1LB 2EDWA 3IDIA 4YVUA 4KK9C 4JBSA 5T1LA 3NIFB 3RKDD 4TULL 4N85A 1TEFA 1I8MB 2VR3A 1YSOA 3ZT6A 4CU7A 4AKPA 2GTQA 5D1QD 4WJ5A 4F2EA 4HCRL 3QQNA 1OAXL 1OGAB 2VXQL 4FNPA 2P9RA 4JANB 1JNHB 3BDXA 3HE6C 2DQJH 3FO1B 4LPYA 1YAZA 2JCCE 2X70A 1KN2H 1O5DT 4UQBA 1CO1A 2YLKA 1YUHB 1A66A 3IDMB 1QLEB 3KGRA 3NJVA 3QFJA 5H2BB 1WFJA 5DYSA 4PR5A 5I73B 4OIIH 1AE6L 1U3ZA 4N87A 1M7DA 2WBWB 3QJVB 3IJ7A 2VLMD 2BVOA 2VLRE 4UZGA 5DJ2B 4W9FC 4XZUA 4MJ6A 4ZOAA 2QLYA 5HXMA 2CK0H 3REVA 1LE5B 3KH3A 1JK9B 1E67A 2RHEA 2EH8H 1KC5H 4Y7OC 1DJSA 2BVUA 2YKKA 5JOFA 1B6DA 4XC1L 1R3KA 4LLAA 4QGYA 1AR1D 1WFUA 4JZJB 3LB6D 2IPKA 3ZKXC 3P02A 4LCWA 3F7RA 1YDPA 2HX7A 5CZVL 2Y06H 4C56E 4DGVH 4Y1TA 4DH2A 3P3RA 3T2LA 3SQOL 2OCJA 1ROWA 2YBGA 3CXDL 3EJSA 1U41A 2JB6B 4HJGB 4PRHB 1UD2A 2WM0A 4J39A 3PWVA 4TN9A 3DRQB 2GJ6A 1T5WA 2WB7A 2H9GA 1FFPB 3K72B 2VZ3A 2ENPA 2VAAA 4WWPA 3VU2A 1O7DC 3HUJF 1OF2A 1QI3A 3OGOE 5KSAC 4LKXB 3RKPA 3CFBA 3GSWA 4MDRA 3VE0A 3D0AA 4F24A 4I48B 1HXYA 4XN2A 2V2TB 3QGVA 2ESVD 5TJWK 4N1EA 1T4KA 3FQWA 1NUFA 1IAKB 3U46A 5HYEA 4HKXA 3DVGA 5DK0B 3RWIB 5EZOH 4YHMH 2IH3B 2Q3XA 5E9DB 3G5WA 3IGLA 2GFBA 4AJYV 2B7DT 4WWKD 1U0QA 4JKWA 1U2CA 2NSQA 5G4NA 3LVTA 2FBRA 4XWOD 1N8ZB 2Y5TA 1J88A 5GGSY 5TFSL 4CC4A 3L3GA 1QLRA 4PPTA 3G9VA 2CSPA 4BHUI 3KM2A 3X3FL 4ESKA 1UZ8A 1UJ3C 1MF2L 3GUFA 2W60B 1JZHA 1DLFH 5FB8B 3T04D 2VQ1B 4PJCE 4OI9A 1N2RB 1TQBC 4P2RB 1DN0B 2I27N 2WQUA 1QWHA 3HR5A 3PHQB 4K9JA 5A6MA 1TYEB 4MHHG 3IWVA 1G6RH 1IFHL 3ZRCC 3C8HA 1A64A 3D2UD 3VGAC 2XLLA 2YQBA 3AU1A 5E2UH 4N0YL 3K5RA 2FK9A 5BMFL 3M17A 1II4E 1U91A 3OMZA 4CVUA 4NT6B 4XB3A 5IB2B 3DETC 2MQGA 4JRXB 4F7EB 5SWSD 4F2MB 5DO8A 2H3XC 4B50A 4MA7L 2DM3A 4RX4A 1OGTA 1NCGA 1EHKB 5IIEB 3HZVB 3NCBB 5F9AC 1SFHA 3TBWB 1FNSH 1S5HB 3K6DA 3LRHA 5DHVH 4ONGL 4M6MH 5E6ZA 2QMKA 4EZKA 3WTTA 3OHXA 4OLEA 3P3UA 4XOAA 2F68X 3X13B 2VXTH 5E4EC 5C0BB 4D0CB 1K85A 1FLTX 3QFGA 4MAYC 1X5XA 1YEJL 3QWRD 1PKQA 3QRGH 4NUGL 4RISH 4OLVH 2NYZA 3KJ4B 4MJIE 1ZOXA 1JNNH 2BMKA 1J5OL 3LKSB 3W0WD 1JFPA 2ADIA 1EFXD 3MOBL 2GIXA 2ADJB 1KLGA 4PJEF 3T0EB 1REIA 2V7HB 2FYYB 4W81A 4YDIH 4YHOL 1I8AA 4JFZH 2AJXL 2R0ZL 5DUBA 2ENYA 2MHAA 4MAZA 3L3OB 2G3MA 3ABKB 5IEHB 4CBZA 2Y7LA 3L5WB 1EO8H 1TJGL 4PMFA 3MKKA 2OSLB 2GK0A 2O26U 2E7CA 3LRSA 3OAUL 3QHZH 4IOSD 2F5BH 2J6EH 3PWLB 4OTXL 3FMGL 3IU3B 4W4NA 1YEKH 3QDME 3N1FC 1WC7A 3EYVA 4Y16D 1HH9B 4DP1X 3MNZA 1HL8A 3IEAA 3BMVA 5EEWA 1NCCH 1UD8A 2A4ZA 3VFVB 3L4XA 5E0QA 2E59A 1CVSC 2QPFA 1WYJA 4LNVA 1VF5C 1KGXA 5AKSA 3Q7JA 3D85D 2PWFA 2D0GA 3U4AA 1UM6H 4JPVL 3ZRFC 4DFHA 3ZL2A 3MGAA 2CRMA 1HXMB 1XGQA 3LNFA 2VUYA 1MCWW 3T2OA 1QFUH 3W3BA 3KL3A 2XTJE 4JZOB 4ZPVA 1HXKA 1JXFA 3VI0A 3WQJA 2HRPL 4W4OC 4LCCA 5CJOL 4XNXH 5IB1A 3ZPRA 3MBEB 5FHAL 3WS3B 4F8TA 1XBRA 2H0FA 2ITCA 3DI2B 2UY6B 3ZK0A 4WW2F 3OZ9H 2CCLA 4N22A 2JI3A 5BRZE 4C56D 3AROA 5AB2A 3LH2L 4O2FB 3QDGE 5J11C 4H8WL 5KG9A 3RVWC 2GCYB 1WFOA 3N3EA 4FQCL 1QSFE 2PCPA 2IQ9H 4GAJL 4YUEL 1XF5B 3UG3A 4Z3EA 4TQHA 1KIUA 1ZTXH 4G6AC 3AC0A 4P57A 4KJYA 4BWUA 2WCPA 3MYJB 1OIOA 3KPRA 4U1JA 4GPVA 2P5WD 1MIEH 1UWEL 3T0VA 5E8OA 3SYCA 3D51A 1GGCH 3PGFH 3BVVA 2CNZA 1OK8A 2X2IA 1U3NA 4U1IB 4Z78A 4E9YA 4LSTH 1T0MA 2DIEA 2H0EA 3FB7B 4N1CA 4NRZA 2VERN 2VLLA 1FJ1B 3PFUA 4FLHA 5SV3A 5PAZA 4OJCA 1UB6B 4TUJA 1MFEH 4MQSA 2B9AA 4NP4H 5C3LD 2H26A 1U9KA 4R7DB 3LXAA 1HOCA 3VWKB 4DERA 4UDTA 4BUOA 1L0MA 2LV4A 2P43B 3FBQA 2A74B 4Z7UE 4Y9FA 3ECUA 3HS8A 1B0GB 1JZFA 3WNLA 1T0NA 1XZ0B 4BWTA 2WXOA 1Q94A 5LGJA 1T03H 1U8IA 5F96H 3FTGB 1N5YH 2EUZA 1RFDH 4P59H 4JPVH 3EO9H 1DANT 4NZUH 2J3SA 1KF9B 1WZ1H 1LMIA 1C7SA 2BO0A 2AABL 3GXMA 3VXSD 4ZK8A 3VFGH 1MZYA 4KK6C 5ESAB 3MFFA 2P8PA 1H15A 3RWGA 4JS7A 3QAZB 1WTGT 4LCUB 2F1AA 3OAUH 5GZNA 3O6KH 2J6EL 3RWHA 2C9QA 3D05A 5AKRA 5FM4A 3VXSE 2PYEE 3L1OL 3WFDL 2IADA 1A4JA 1I3GH 3QPXL 4XH2B 5DMKB 2XV3A 2VIRA 2ZX9A 1I3VA 3ZE2B 1CI3M 1KIRA 4HX1A 4M62H 2OSYA 1F4WH 4QRAA 5AEAA 1B6UA 3HI5H 4LSVH 3MBVA 3NEXA 2FO8A 5EA0L 3VYNA 1JWUB 4UM8B 1SOQA 1AVAA 2E9WA 1W0VB 3DROB 1MEXL 1T2QH 1YUKB 3OLEA 4PM1A 5DURB 3IJHB 3KPQB 2K0RA 3N40F 1GZPA 1Q9OB 3QNXB 3ZR6A 2G9HA 4AL8H 1FAIH 4X83A 4AXWB 2MCG1 5ANHA 1S4IA 2WVTA 1QABA 4XNAA 1WWBX 2ZCZA 4ZDHB 4WO4A 4BBWA 1TZ8A 4XNXL 5CJOH 1U8MA 2VDLB 5F71A 4QHKI 5FYJL 2E6JA 3DX0A 2J88L 3MRLA 1SEBA 2UVEA 3RWEA 4YSRA 5D2LA 2AXFB 3TEYA 1XL4A 3FO9B 3V6FB 1A9EA 4FRWA 4TLSA 3QJZA 1MJ7H 3KBHE 4E68A 2XTLA 3V8OA 2FO1A 1D7FA 1GMEA 1TO4A 2ZYRA 1MOEA 4MTMA 1FWXA 5D2NE 4YWGL 25C8L 1YEFL 4WI3A 4XHJD 3DGDA 4G8IB 1RJZB 1QA9B 3MLUH 3ZKNC 3RAJH 3TT3L 5IF0B 3S3JA 4BKSC 8FABA 2R7EB 1I1YB 3BI9X 3U1QA 2WC7A 3O2DL 5JW3L 2K8QA 2F5AH 3W39B 1FRGL 2WNGA 3BDYH 3FN9A 1GCFA 3VH8A 3QIUB 1UUNA 2OYPA 1SOKA 1FZKA 4GFXA 2DIAA 4YXHH 1RPQA 4DF9A 1PY4A 3ARUA 2B39A 5GGRY 2C7UA 5K9KA 1RLBA 1CXIA 3T71A 3TN0D 2BZ7A 1F58L 1IFGA 2YRPA 4DP2X 1YN7B 1T22B 1ZSDA 4E2OA 1CQYA 2EE6A 5JQIB 3R7QA 5JO5A 3QUXD 3Q0HA 4KKPA 4YHOH 4M7LL 5C08E 3FQRA 4OZGF 1NKOA 4MJ5A 4WUUE 3RIFF 5IQLA 1J8HD 1KEGL 3EOBB 2F53D 3N91A 4XNZB 3BP7B 4IMLA 5JW5B 4NENA 3VFSB 5KYXB 2WLLB 2AKRB 1KJ2B 4L4VA 4F58H 2MNJB 1VFBB 1SHSA 3C6LC 4OUUB 5F7AA 1ZTXE 1KCVL 3RVXC 4I89A 5FM5M 4AW4A 4X5XA 4POZC 1VJMA 1NCAH 3EJJX 2ZOTA 3FB5B 3KPTA 3QXAB 4L1BA 3S4SG 1DZ0A 4KXZI 4ZMQA 3QBGA 3BKYH 3GSOB 1ZE3C 2NQ3A 2GG1A 3DUUB 1DLHB 2XKUA 1OD9A 4W9ZA 5EHFA 3LKOB 1MNNA 5FYLD 2YEQA 4DK6A 4X31A 3FUEA 4N2GA 3LB6C 4DPCX 1USQA 2NR6D 3QEGH 4UTAL 3P3TA 2NX5B 1TFHA 3OHXC 4MGXA 4XC3H 4W68A 4WIQA 3VXRD 43CAB 1HEZA 4IAQA 4XVTH 3ETBF 2JKLA 2NYYC 2Y2YA 4J7RA 1RURL 2LLGA 4JLRA 5EDSA 4IARA 4KUCD 1JHLH 4ODVL 4XBGB 2A2QT 2QQNL 3ASWA 1WA1X 4XP9L 3BQVA 3APDA 4UQIM 5KSAB 2EVJA 4PG9B 1H3GA 3UP6A 5DT1H 5BR2A 4IJ3C 3VXPB 1A14L 2K4AA 4HYXA 4MCYA 4MJID 5EOTB 2JCCB 4W9JC 3EGDB 1KGCE 3X3FH 3IAQA 1M9SA 1KGBA 3LSOA 5A6LA 1GZHA 1JRHI 2P80A 2VXUL 5DK2A 1UAZA 5ANME 1SDDA 4G80B 5E5LA 3TP4A 4I1PA 3OR7B 3TBCA 3Q2WA 1UG9A 4OM1L 4V2CB 4YL4A 5ANMA 4ADJA 3LD8C 5I1JL 3F85A 3HG1A 2Y69B 2WUCL 4DIXA 4RIRB 3X1NA 2WKOF 2YDOA 4EI5C 4AMXA 4FQ2L 2P8LB 4R0LC 2VLKA 1WPCA 4G59C 4A2LA 4K23L 4YAQB 1J10A 2E6QA 5FUOL 3VRLE 3J8F7 2K70A 4N9GB 5FOBB 3WNMA 2QV4A 4RMUA 4F8QA 3GMLB 2CIIB 1TNMA 2E75C 4YL9A 1GGUA 4KHXH 4HKJA 4MA3B 4MB4A 4KXDA 3WIAA 1U4EA 3ULUL 1UATA 4FQJL 3MLYL 4ICWA 2NZ9D 2X89D 4LSRL 4S1QL 4XOEA 3QO0B 2NW2A 4JG1L 4RDQF 5DD3H 2EDKA 2ENSA 3ZE0B 3MBXL 4IBZA 3SPHA 4QRRA 1T80A 4FKKA 1I3UA 2VWEC 1CGUA 3Q3GB 4Y2DA 5D7LD 4KJWC 2QBWA 4DP7X 3LZFH 1QEWB 3RL1B 3II3A 3DX8B 1KCRL 5BRZB 1SLUA 1SEQL 2F2HA 3IMRA 2WSKA 2BH0A 3NFNB 4MKTA 4NCC2 4U3SB 5KJRL 5C0AA 3I9AA 5KVEL 3DUHA 1YYMH 3SB3A 4CKQA 1KYAA 4QHLB 5INCA 5ADOH 1JPGB 5DD1H 1EO5A 1DBBL 3DSFH 3EG9A 5I15H 5I6KA 2NMSA 4Z7VF 4JFPB 5F7NC 1JHKL 3CN4A 4NYLA 1PZDA 1UCBH 3LXCA 1NAML 3GMRA 4PVBA 5GJSH 3HVNA 1S3KH 5A7EA 1NIBA 4AYFB 4E9LA 4YDKL 1B9KA 1KTDB 3ATFA 3I2CL 5I18H 3QJUB 4AEHH 2HFEA 1CL7I 2QPUA 1YNLL 4KKCD 1P84K 2X6UA 4BK4A 2DBLH 3E9TA 1I7RB 1BJ1J 3W81A 3SDAA 1V27A 4U6VL 4H8VA 2FH8A 4CDGC 1KTLB 5FO8B 2FGWL 4X4ZA 5A3IC 3LYRA 2CHNA 5K1NA 3EDJA 3IXAB 2X1WL 3VXQA 3ULVC 1HIML 1JPFA 1TZIA 2D0HA 2QV2A 3O2WL 2HWZL 1HH6B 1RHHA 3LPGA 3H42H 2HSIA 3QSKB 2BHYA 3BDYL 5AB0A 4EI6B 1M0KA 1A1MB 3CVHB 3DIVA 1KCSH 2X4TA 1JGEA 4DHLA 1HN1A 3V2WA 1Q9LB 3BGFB 1FH5L 2ZE0A 4BSWA 1G7JB 1DSYA 3RDTC 4TS6A 1H6EA 5TE4L 4H8WC 3RGHA 3CFUA 5AOZA 1KPVA 1M9WA 4KNUA 5I1JH 3STZB 1DZEA 3DX6A 4AQ1C 4G1MB 4DGYL 1D5BB 4PJEA 3JZYA 1I8UA 3VG9B 4CJ1A 1EHXA 4POUB 5CFHA 1EJ6A 4OV0A 1EVUA 2X4RB 4ZS6D 2VZOA 3LIZL 4GMSH 4YXLH 4FNTA 4LPWA 4F7MB 4LT7A 2NY4C 5I28A 2FWSA 5JOPE 4HH8A 3SPCA 1QFHA 1NPUA 1EBAA 3K4DA 1G0DA 1DL7L 3JWNG 3L7FB 1H3PL 5JMRA 2MQ3A 2Z8RA 4LLQA 3HHRB 4NKMA 3D4ZA 1RAMA 1KYDA 5IB4A 1K4CB 5G2AA 5KSAD 3SDCA 3QDGB 5DRXA 4URTB 1EZVY 1ZXQA 1OSEA 1Z6JT 4PWJA 3V0JA 5ISZD 3JV4B 2IO5A 1R17A 3MV9B 2V3FA 3QDJA 5DRZB 1AZBA 2F18A 3TCLA 3DJ9A 2OQJB 3MC0A 3NCWA 3VFRA 3L3DA 3M1OA 4LAQH 4LCIL 1GOHA 4QKTA 3NCXA 1AZRA 2V5RA 4JY5L 3EGSB 2R1XB 2E9IA 2XN9E 4N6HA 3IWUA 4M1CC 4HKZB 4OZHE 3NYKA 3BQUD 1LILA 4UBDD 2MEJB 4JM2A 2XN1A 1JDCA 2IWKA 2AJZA 1SJHA 5C08A 4LKCA 2FSEB 2BFVH 3I2CH 4HAKA 1T66C 3A6CH 3SOTA 3FQNA 1KT2B 4GINA 3WTUA 5D70L 4WV1A 5HBBA 4G43B 3ZHKA 5HHQB 1BMWA 4MFHA 4UYQA 3APMA 2BCKB 4PRHE 2CHXA 3D4GA 3ZHLA 4KDTC 2YA1A 4V1DB 3OKMA 4HZAA 1UM5H 2PMZA 3ELAT 3TO2B 4EJ4A 3JT0A 3GTNA 2JCWA 2UWEE 3BFOA 1UEYA 3FFDB 5GXBB 3BFWA 2ZX6A 4FP8H 2DQGH 1LK2A 4R90H 1MFAH 1P7QA 1QWUA 5L8KB 3HG2A 3II2A 2ZF8A 2VJ0A 4NCDA 1RVFH 4QR7A 2VB5A 1A2YB 5J57B 1QRKA 1YO4A 1QR4A 2A83A 1RIVH 3MMEB 3O3EB 4YLCA 1IKOP 1UOLA 1FG9C 1XH1A 2BC4A 1P4LB 3BSZL 4PGDB 4QKXB 4MB5A 5DMGC 5F0LB 4AG4L 2Y3NA 4XVJH 4QRFA 4APQD 2A9CA 3LZNA 4XN5A 2AJVH 1J9SA 1F13A 1HILA 3QHFH 5KSBF 2APVA 4TVPH 3DX9B 3AWEA 5T1LD 4KMTL 3N06B 3MLXL 3F58H 4KGLA 1OVZA 2BVEA 1X5FA 3EO0B 1NMBH 1FI8C 1IE4A 4JUTA 4P23C 2P5EE 4WI8A 2LHAA 3T3MB 4PP1C 1F3DH 2XY2A 2IQAB 2K7QA 4PTTB 2AXGA 5DHVA 5AD0B 2ZONA 5E7BA 3QEUA 1ZVHA 4PRDA 3RJQB 4CMMB 3BKMH 5ABAA 3OVUB 3CZUB 6FABH 1RZJL 1UKTA 5FYKE 3GTTA 4AV4A 2ZCKL 1I1RA 5CP3A 1INDH 2QVIA 4O58H 2E9BA 3FT0A 1OKEA 1RUQL 4HUVA 3L4CA 5FO9A 1NCTA 1ZK9A 3UTZA 1FAIL 1KOAA 3PQYE 4KV5E 2PTTB 2A6DB 3ZTNH 4Y9HA 3OE8A 3U4EB 4WHTA 3BD4A 5J5EA 4RNRB 1YNTA 2M3GA 15C8H 1V05A 2YRZA 4XP5L 3D3VE 3S34H 3VFTA 3NJLA 2BP8A 4I18A 5C7ZA 5T8IA 4UHRA 4X6EB 2P28B 1IGJB 3V6OE 4Z23A 4ODVH 4YDNA 1RUKL 4QOKE 5L8JB 4P59L 4LEXH 3UTYA 3KWWA 2XZCH 2WHVA 1BIHA 3AYNA 3O11A 3AS2A 4NC1E 2IAAC 4I0CC 3QZMA 3KXFA 4OLVL 5AYTA 1CDIA 3CV5A 5EFIB 3P77B 4PRBA 4P07A 2VUKA 3U25A 1DTUA 2B20A 3JWDL 4L3EA 4K9EL 3VH8G 1IX2A 4LK4A 4NM8H 1HDMA 2BSTA 1ET8A 2KLSA 1CDJA 1EGJH 3TPKA 2QELA 2QSVA 4MA7H 3US1A 4LPTA 3NGBC 1JGIA 1FYTE 2JH2A 3L9YA 3MV7B 1I7TA 1SN2A 5CEZD 1N9PA 2PPFA 2XG5A 1ZDSA 2UXTA 4QTIH 5T5FL 1N3NB 1NCOA 1FYTB 1XSJA 1E9QB 3IBOA 4PFEA 3RTQA 3L3KB 4HJIA 3TCXA 4MWFA 1PD0A 4HUMB 4IKLA 1S51A 1OE3A 2V9RA 1KIQA 2R23A 2WQWA 3HKFA 4XMLL 2DTML 2R56L 1BQUA 3ZDXB 3TEXA 4NFDA 1H9VA 3HFMH 1XF4A 1S6NA 2XRAH 3RFMA 1KPRB 3CDFA 1ML0A 2PR9A 1XGTB 4P46A 1MVUA 1OAUH 4MA1B 2HVBA 4OFDA 3QWQB 5JPNB 3US0A 3N9GH 1D2PA 4XNMB 2W9EL 2IAMD 1U58A 3D07A 4MHHI 1E12A 4N8CL 1SF3A 1G7LA 3SDXF 1RIUH 4WTZA 1ZT4A 4C59B 3Q1EA 4F3FA 3ZX1A 3H7LA 2W0LA 2DZEA 3FHAA 5TH2B 1QRNE 4JHVA 2A99A 3MTXA 4YFLF 1CLYH 4DKFH 1R4XA 4DQOL 2BNQA 5DHMC 5IG7A 4XXCC 5GGQL 4W9LC 2JB6A 4HJGA 3PWVB 3VD3A 2GJ6B 1KBGL 2H9GB 5FM8A 4ANWA 1NGYA 3QI9A 3UC0H 5T3ZE 2VAAB 1DQQB 2ZX7A 3PWPA 1QNZH 1PZCA 2WO2B 3TJHC 4LRIC 2P7TA 4HU2A 1WIUA 1GYAA 1HXYB 2X3AA 1T7WA 2HYMA 2B2XH 3GXNA 3IDYB 4FQXC 4LMQI 3RX7A 4AGNA 1IGIL 4ZZFA 2Z31D 4B9JA 4OGZA 4HKXB 4D3CH 1MFNA 1DVTA 1DBKH 3FUFA 2C4FU 3LX9A 2DQFA 4O9HL 3MJ6A 1MLCB 1AP2A 1DO5A 1ZHLB 2GFBB 1UYWH 1TXKA 2R29A 4I9XA 5F1IA 2OMUB 1A6UH 1WIOA 4RMVA 1NC4A 4EAEA 2WVVA 5TDPB 2WQRA 4PJGA 4NXKA 1JXJA 5G36A 3I02A 3EDKA 4JKNA 2OP4H 1RP8A 1V3LA 3NSXA 1WBYA 3GBLA 1FPTH 1PU0A 5ALCH 2CUIA 4JX0A 3G5YB 3K0WA 3KPSD 3ARBD 1NFIA 3LS4H 5FB8A 2Z7ZA 1PZBA 3WXVH 5HJGA 1J1PH 4PIBA 1R0AH 4N6RA 4QRRE 3PWJA 4U6HA 1J9RA 4MBSA 4O2EB 4HIXL 2XC8A 3GBNH 3PDGA 3PPEA 4ODSH 4YHZL 4ZTOL 2XKNB 3CFCH 3EYQD 3HMWL 4B6ZA 3HCVB 3B9KB 3UYRL 5JZ7C 3DX2A 1BM1A 2AQ1A 3QCUL 2H6PB 4F2MA 4NWUL 1TJIL 5CD3B 2HKFL 2DRUA 1KELL 3FFCA 3FAWA 5FF6A 3AXHA 4Y4KC 4OGXL 5B6ZA 3TBWA 1XTLA 4AC2A 1QFWM 2WWKT 1CTNA 3TWCH 3OKKA 1A0QL 4JFQA 4F5CE 4KZEL 4JFDD 3U9PL 4R96B 3VWJD 4A2HA 4M5ZL 1RVFL 5G4MA 1L9MA 3UTWA 2MWCA 4JFOA 2F53E 2N1TE 3DTXB 3SGDI 3DKHA 1ZAGA 3PL6D 2Z93B 4HFUH 4OSUL 2CHZA 4YDLC 4QYOA 5KVFE 2BMKB 5SWSB 4PP1D 4Q9QL 5FYLE 5I5RA 3FSWA 2W59A 1RK0B 5E8NA 2H0PA 2EDEA 1IRAY 5ES4B 1GJWA 1FL5B 5ITCA 2X0UA 2Y1VA 3ZL4H 4ZYKB 3ZLQC 4EOWH 3VRJB 4BKLA 3SKNA 2ZOLA 2EEFA 4NDMA 2ZKXA 2XI9A 3KYNB 3LRSB 1JGDA 1FFTB 2Z7UA 4EI0A 5J89A 4EI5A 2DQTL 4GW4A 1KJVB 3P0YL 5EBMB 5HHXL 1UH4A 1JV5A 4GXVL 3VFVA 3JVGC 2CAKA 4I3GA 5C07D 4YBQD 4NGHL 3BPOC 3SCMB 1EK3A 4XVOA 5CCJA 2ROXA 1DQDH 3RZEA 4AUUA 2YMOA 5C0RH 4G6ML 1CDBA 4O9HH 2CU9A 4JZOA 5FUOH 5T1MB 4UB0H 4UQDA 1J18A 3BVTA 5BVPL 4FQJH 2C3GA 2QKIA 4L9LC 1MWAB 1T6VN 4XTNA 3D1MC 1OSPL 1JPTH 4AUJA 4BZ2H 2RAMA 2YPVL 1QBLH 2BSED 3X3GH 1BEYH 5EZLA 5IMKA 5HGGS 3FU3A 4PJ9D 4JFYB 1HX0A 2J72A 4HSQA 4WFFD 1YEHH 5JIPA 4YHML 1J48A 3KJ6A 1NC4D 1TQUA 2HZHA 5DZAA 5IFHH 4L8CA 2O93L 5BW7C 5IUSA 2A9NH 1QASA 1TLMA 3UX9B 5G2NA 4N2CA 5GRZA 1ETZB 2E46A 5E8OB 4AG4H 1F42A 5CJBA 3O9WC 2Z0UA 4MAYB 1C9SA 2F7IA 3RVUC 4HGWB 4NC0B 2VDQL 4NRZB 2HKHH 4KROD 2VW4A 3FB7A 4L8SC 4N8CH 3MUGB 1BF8A 5MP6L 1OPOA 2DWEB 2H5UA 4IU2A 5L2JB 1HE7A 2KZBA 2PLTA 1FCGA 4NIKB 2EDQA 1PXSA 3HN3A 1HJBC 4OT1H 3MKGA 2PETA 5DWUH 3SQRA 4BUGA 1IM3B 1YMMD 2BSDA 2IV9A 3G5XA 4CDHA 4KZDH 1UM5L 3S8GB 2A74A 2FD6L 5I82A 2DL9A 3CIAA 4Y5VC 2NY1D 5EU6D 2DIJA 1YHPA 2F53A 4KZCA 5E2UL 1TMCB 3QIUD 5EO0B 1AGDA 1CICD 1N12A 1S7UA 1HSAA 3K5SA 3U36A 3L08A 2IDCA 1FL6A 2XWTB 3TVMA 1YC8A 3I3BA 2HLAB 2Q2EB 1RPUA 2A6JA 4WFFE 4U1GC 3VRIA 2EEDA 2FB4L 4JHWL 3MXVL 4JQVC 5B7FA 3B8SA 3BKCH 2OK0L 4Q0XL 2P5WE 5FDWB 5HYJA 5IQ9B 3D7PA 4LAJH 5FGSA 1CUOA 1GZMA 2ICEC 1H68A 3AB0C 3DJRA 3IRCA 4ODTH 2E9GA 2Y6TE 3ASNB 4ZFOL 3F7VA 5FYJU 2J1ZA 2WWOA 2ADGB 3PXJA 3DECA 1E0OB 1LO0L 4ZSOA 4ZUSB 1PIFA 2YPLD 4U7MA 1N18A 1HEHC 4LFHG 1KJMA 4FKEA 3VTTA 4F7TB 2BP3A 1JWUA 4Y5VA 3Q43A 1HHJA 2H45A 3PGDA 4LOEA 4Z0XB 5C09D 1AXIB 3ZYJA 1TZGL 4N9OB 1NUNB 3E6FA 2RCSH 5CN2A 4TNFA 5J1AA 4AV5A 5JNYA 1MREL 1F90H 1BYNA 1Q9OA 3KLAA 2G9HB 4HIHB 1MG3C 4G70B 2BM3A 3FCSB 4ZDHA 1BM3H 5GS1C 4RRPA 4S2SA 3O2DH 5JW3H 2H2PC 2NZ1A 2HKHL 3C5ZC 3BD3A 1BVNP 2VMCA 1TEGA 4N2EA 4FFVC 4LB8A 1NFDE 4IOFC 5DQDL 3B9DA 4DO4A 2VTFA 1MJ7L 2UYLA 4WHYG 5ABZA 3P9MA 1U95A 2H41A 3U2SB 4P5SA 1EFXB 3DIFA 4QTHB 2VMJA 1XCXA 2VE6B 4G8IA 4QHUA 4XR8C 5BRZD 2EIBA 2WLIB 4OR1A 4YEEA 3EYFA 2WQXA 2VN4A 2OMXA 5FYJH 1MCSA 2R0WH 4DO5A 4IDJH 4HIIA 3M8OL 5CHNA 3IFOB 3BAEL 4B9PA 3EYSL 4MXVE 1FZKB 3SBRA 5EC2B 4XPFL 4RMSA 2L8AA 4L1LA 3EFFB 2X0VA 4RMTA 2JKWA 3QUKA 2R39A 4X8XA 5K9KB 2OAAA 1YYCA 4U2ZA 1IAIH 1QSFA 5L4MA 2Y7SA 1U8PA 3SE9H 5I73C 3B5HA 4RQQA 4XBPA 4XPGH 4PBXA 3GLZA 4XGZA 2CM6A 1TTAA 1K8IB 1C7TA 1SDYA 4KJWD 4N5EC 5EN2B 1HINH 1S7WA 3FB6A 3CXHJ 4H5SA 3S5YA 4G83A 4HEMA 4PXKA 2HN7B 3GRWH 1JPSH 3O3AB 12E8L 1OE1A 4XZ4A 1AO7B 1Q72L 4XRCA 4NQDE 4JPIB 2DMHA 3UAJD 3WE6B 5IB3B 1ETJA 3LCYA 4O2CA 4E36A 5F1SA 4OCSH 3ROOA 5DRWB 5D7JA 5SV4A 3JVGA 4NWTH 4U6VH 2NUTB 5LG6A 3WFEL 1PY6A 3UH8A 4GBRA 3FB5A 4IRJC 4N8PA 3KVQA 5EU5A 4JPKL 5C0ND 4ORGB 2I60H 3GSOA 4MS8C 5HHNB 3T1WA 3HLKA 2CDGA 1DLHA 2IFFH 1CE6A 1VENA 2A1WH 2V17H 3ARYA 4WWOA 1MNUL 1OTSC 1QPKA 3NACH 5AAMC 3N41B 3ZGIA 3E6HB 4B7IA 4D0DA 2OK0H 4KITB 2NZIA 3POCA 4LP5A 1CTOA 5LGKA 3PF2A 2XX0A 1K3IA 4FFZA 1KYFA 5F8QC 2FEDC 2DLGA 3QUZD 3MRHA 4KDVA 4OKVB 4OFPA 4KPHH 1DJWA 1E8WA 2EDHA 1IVTA 3LN9A 2MRYA 3KYKL 1SYVB 1AXSB 5F3BA 3PJNA 4UV4H 1MH5A 1MVFA 4A2EA 3SQBB 1AYOA 1DDHA 3SPVB 4BFNA 4XCNA 2J12B 3GSXA 1NTDA 1KGWA 3DHUA 5EOTA 3UIYA 3EGDA 4TPRH 4AENA 4QTFA 2YCYA 3BN3B 4L37A 1CF8H 5FV2A 2BNRB 1LDPL 3HZ3A 4ZOCA 1SDDB 2COQA 4G80A 4FYQA 1ZV9A 4LGSB 3ZUCA 2HX8A 4FN0A 4FTVE 2BFGA 1FV1A 1RZ8B 2C9RA 4Z7UA 3CZEA 4Z77B 3ILDA 3K80A 1OM3L 4DKLA 1UT2A 1MAKA 3EO1B 4I77H 5AOKA 2ESVE 4ES9A 5BV7B 4PP2A 3LHPL 4HHGA 5HI5D 5F0MB 4NP9A 3L8QA 4GQ9H 4P23D 4HOMA 3L5XH 4GW1B 2CIIA 4MZ2A 1MXDA 5E0FA 3GZPA 2CBOA 3O6FC 3DTUB 4ZAKB 1BWWA 1KCKA 1MUJB 2W5PA 3F6LA 3VFPA 2NW2B 5AW7B 5IJCC 3BN9D 3WFBH 3FO0H 4IBQA 4ZW7A 3KBPA 5C86A 2CCVA 4H26B 2EIJB 4IBSA 2JLLA 5AFAA 1BPLB 2YD4A 2EYTB 2P5WA 4HD5A 3RWDB 4J3WA 3SD5A 4Y4FA 3ZSTA 2E8YA 2V5TA 3FH7A 1DQJB 4AM0Q 1IL1B 2K4WA 4WDIB 1OY3B 1KB9J 4WFGD 2AJUL 3WNNA 5JR1L 4LHQB 1ILUA 3QK0A 4F8OA 2QADC 3IRZA 1I7UA 3D25A 4H1LG 1ZANH 1N0LA 2X44D 1I9RL 1J8KA 1J0YA 5CP3H 3RI5K 1FNGA 1K6QH 1A7NL 4A2GA 1MEXH 1T2QL 3GIVB 1ZGLB 3L4YA 4GRWF 3AREC 1L3NA 2A7BA 2QFRA 5ETUB 1CGSH 5FDYA 2OJEA 4ZO6A 2FL5A 4U49A 3IKCB 1GS8A 1HVXA 5IVZB 1G1YA 2ZP9A 4DEPC 3O2WH 5BXFB 4JGNA 1KG8A 2IG2H 3CQPA 4TNWF 4PJ5A 7PAZA 3U7WH 1ZLUH 2OMWB 4Y4HD 3K2UH 1A5FL 4J1UA 2G4GA 4J3OH 1NCAL 4R97C 1QLFB 2HTKD 4JKPL 4P0DA 3OKEB 5HI4D 3ARBC 2CR0A 3CE1A 2GJ6E 2JSFA 2IBZX 1NOFA 2CR6A 4HJUA 2VDPH 2OXGA 3P9LB 3EO9L 5B1KA 2WXJA 3UTPD 3OPUA 1OZUA 5KYNA 1IQDB 5DFAA 2VN7A 1FVDA 4GNKB 3W37A 5HDLA 3DI3B 5F0JB 1JWSB 3MRKB 4B27A 1XF3B 2CKBH 2VRAA 1Q9LA 2XUWA 3CMOL 1FNEA 3S2AA 4BSWB 2OA9A 4WWKA 3NJXA 2MCAA 5KVGL 2RALA 1QLEL 4Y5XB 2FX8L 3IJEA 4H25B 4CGTA 2AV7B 3O0RH 4I8DA 9PCYA 1ORSB 2FTAA 2EIZA 3MRFA 5TPWH 3VI3A 4X5LA 2J25A 1CLZH 4OZ4B 3MRMB 2EC9T 4ZFGL 4HLZH 2YGQA 2VJXA 3O6LH 3HMWH 3VG9A 1A7PH 4PJEB 1U8LB 3STBA 3NFSH 4HS6A 1F1DA 1KY6A 3KPSB 4KTDH 3ZDXE 1ZMYA 3N04A 1TVHB 4GO9A 5IZ7A 5FHBL 3MXWH 3HZYB 2E8ZA 2CGZA 4WFEE 3OWEA 3SDYL 2C4FT 2RFXB 5D1XC 1KDIA 4Y8DC 3PP4L 4H20H 1X6NA 7CGTA 5CWSA 3ZTCC 5TGBA 35C8L 3SOBL 4P3CH 1QYGH 3RDTD 2JK5B 1J5DA 3B2VH 1OAJA 4HAGA 1E50A 4KY1L 4NKMB 1S53A 1RK1B 4QNPF 5EBWA 1NIFA 3ZO9A 1F00I 1WIPA 2DM2A 1R5WB 4D9LH 3B5GA 5JPNC 1UEMA 1A5FH 1KB5L 5F7LB 3T9WA 5E8PB 4CMHC 3CG8A 4FLQA 4JRLA 4HZLA 1YEHL 1BVLA 3BUQA 4LHUG 4NQUA 1CJYA 2C7FA 4Q0XH 4UDUB 4LLDA 2NTUA 3UBFA 2VXSL 1BP3B 4RWYL 2XZAH 2IDUA 1Q0XL 1JMZA 2BHZA 2BOCB 2DWDA 2YAPA 3QUXA 4HKBB 4K8RC 4DK5A 3HG1E 3LRKA 1JYNA 3W5MA 4BSVA 1BPVA 2IV8A 2WYHA 4BE5A 4DETA 3UTTD 5JIIA 3BE1L 4PJ8B 1SYSA 1A7NH 1EEYA 1B88A 1GGTA 3B2UD 4WKZB 3SGEI 1B4JL 3V6BR 2AQRA 3BW9B 2YD0A 4YSUA 4FMKA 1O9VA 3S96A 3Q1SH 2BOLA 4H8QA 4ZS7H 2GTZB 1F45A 3V4UL 3ATEA 5BRQA 3VI4B 1GW6A 2H0JA 1IUZA 3IDUA 3W9EA 5IFAL 2IMNA 5SWZD 4YHPB 2HJLB 2GITB 3EYUH 4YEFA 4LKCB 5DWUL 1IZJA 2WNXA 5IVXA 1BFOA 4L8SA 1KLFB 1PX4A 2CO2A 4KXBA 1W0WB 2YXWA 5IOPA 3M46A 5I66A 1GGIH 3RNQB 4Y2NA 5AZEL 4N0FA 3TNNA 1TO5A 3IGAA 2HP4A 1IC5L 4GXVH 3Q5OA 1E5CA 3ZE1B 1IGML 3UAAA 1EUTA 2Q7YA 3ESVF 4FLOA 2NOYA 2Z1PA 3B7TA 3MBED 4U1SB 2WLJA 5TQ0L 1JF1A 3QI9C 4XPBL 4HFWB 2Y4SA 1LK2B 1SPDA 1P7QB 3L5XL 4LPXA 1NDGA 4RISL 1E4HA 3VD7A 3GPEA 5J6GA 4AC4A 1WAAF 2W1NA 5C0IA 2EIEA 4Y9BA 4F92B 1BECA 1EJ8A 5M95B 1PDKA 1QBMH 2LU7A