3QJQB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjqB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjqB02
5G2AA 2GC7C 3FQ1A 2VSMB 3OE9A 1QNIA 2XWZA 1SDDA 5G36A 5JJJA 2JAGA 2ZOOA 3NYKA 3T6XA 3C9LA 1PMYA 2W88A 2XUWA 4BDVA 1U19A 2LNLA 3PCYA 1AACA 4AMIA 2VM3A 4UAHA 3FYEB 2JXMA 3AG4B 1DZEA 1NZRA 1DZ0A 4X31A 5F7BA 3OE8A 4Q8BA 3S3BB 1F4ZA 2F95A 3QBLA 1E5YA 1M56B 3VGAA 2BRDA 4HIPA 4GP4B 3DDLA 5H2JA 2CAKA 4JKNA 1ZPUA 4W9ZA 1ET8A 2BP8A 2OV0A 1HZXA 2VSKB 1PCSA 2BP0B 2EIMB 2H5UA 3COCA 4QIDA 5AZDA 2HRHA 5D4JA 7PCYA 1AIZA 1JFPA 2FQDA 1NDTA 1NWOA 2GIMA 4BWTA 3HB3B 3NP4A 1PNDA 3UAAA 1FBKA 1IW6A 3AG3B 3QPKA 2IAAC 3S8GB 4A68A 3ZBMA 2WJLA 4DKLA 5JJNA 1S51A 2G87A 4E9VA 3ZIYA 1GYCA 1S52A 1AP9A 2PPDA 1HFUA 3FSVA 1MZZA 2BW4A 1EZLA 1P8IA 4XXJA 4HCGA 3ABMB 2IH9A 1JXDA 3T45A 2NRDA 3PDSA 2AFNA 1PZAA 1RKRA 1A8ZA 1IBZA 5H2KA 1NWPA 3C75A 3WKQA 4BEZA 2KSYA 4QI1A 3ZPRA 2QT6A 4YSUA 1JXFA 1SHXA 1PLCA 4G72B 2FQEA 4EA3A 4L35A 1ASPA 4DPBX 3ERXA 1CURA 3U25A 1JVLA 3NSYA 3UADA 7PAZA 4MD1A 3FU7B 4BWUA 1R1CA 3NT0A 4DP9X 5I6PA 3V2YA 4BWWA 1KG9A 1GW0A 1CWQA 2ZZLA 1HAUA 4QRYA 4QLWA 4GP5B 3AY2A 4KO6A 1ETJA 4YSPA 3AZUA 3CDZA 1HAWA 1XB6A 3C9MA 1P8HA 1N68A 2QPDB 2CUAA 4FBZA 3L45A 3UONA 1OCRB 3FS9A 3FYIB 3OQRA 5H2HA 1ILSA 2PP9A 2ZONA 3FSAA 1SFHA 2Y04A 4GPOA 4EF3A 3SQRA 2RH1A 1BXVA 2HZHA 3QAKA 2HX8A 1E5ZA 1L9SA 2YAHA 2UXVA 1PLAA 3JT2A 4A2DA 4YSSA 2IDFA 3TBCA 2UX7A 2HXAA 2BWIA 4FAAB 3TASA 3UTVA 4DP4X 3PAVA 2UXTA 3ZPQA 2Z55A 1RZPA 3NJNA 4UHRA 1OV8A 1A4BA 2MTAA 5I26A 3CVDA 3RZEA 4AZUA 2Y02A 4YVUA 4N8UA 1NIDA 2YAQA 4LDOA 3NSDA 4YVNA 4MD2A 4YSDA 5B35A 4X1HA 3UZCA 2GB2A 1GS7A 3PWHA 2YAOA 4MFHA 3T9WA 5LWEA 2AVFA 4KNTA 2XXGA 4A2EA 2J57A 1VGOA 2F93A 1S8JA 5B1KA 9PCYA 1GR7A 4KO5A 4KO7A 1BM1A 1X9UA 5B1BB 3UACA 5JJEA 2R4SA 3EH5B 3HAOA 3NYAA 5B34A 3UG9A 1L9QA 1WS8A 3AW5A 2XX1A 4FA7B 3T6WA 1QHJA 4LDLA 3IBOA 2XVBA 3CZUB 1J9TA 5I5JA 2PCYA 2VT4A 2UXGA 1R2NA 2KSAA 1SF5A 3QJQB 1MDAA 1V54B 2OJ1A 4DPCX 1CYWA 1ZDSA 4F2FA 2YDOA 2XV2A 3FQ2A 4QKTA 4DP1X 2AT9A 3HARA 2FJSA 3GDCA 3MX0B 4A4MA 3SBPA 5ANHA 4BUOA 3QJSB 2B08A 1OOWA 3NSFA 1NINA 3VI0A 1ET7A 2J56A 3FT0A 3FU8A 3ABLB 4TXVB 2RACA 4GP8B 2M3GA 1A4AA 4Q89A 3VG9A 1W8EA 3PLYA 3WIAA 4YSOA 1BXAA 2FT8A 2X87A 2ZWNA 1SF3A 1BEXA 2W8CA 3VW7A 4IARA 4ENZA 5J7AA 1X0K1 5B6YA 2IWKA 4E9YA 1AAJA 1UCQA 2J5WA 2GI0A 3OD3A 4KOCA 3EH4B 3ZX1A 2XYBA 3NJFA 4JKVA 2Z73A 1AZRA 3HAQA 1N70A 1JVOA 1J9SA 1ADWA 1B3IA 3DKHA 1ZV2A 2E86A 2VMJA 1R84A 5EHFA 3X1EA 1ZIAA 1UAZA 1KYAA 5D4HA 1TU2A 5LDUA 2XX0A 4E9SA 1PXSA 2QDWA 3IN0A 2YAMA 1X0SA 2B3IA 1NPNA 4IB4A 4HHWA 4BXSV 2VW4A 4E9TA 1JGJA 3S8FB 1FBBA 1MZYA 1A4CA 4HHGA 5B1AB 3H4HA 5B1JA 3FU7A 4DP8X 2EI4A 4DP5X 1BQ5A 3X3CA 3GXUB 1L9HA 3D4SA 4W1TA 3NJHA 2AANA 1Q5JA 1IBYA 5I5MA 3PQRA 3JTBA 1VJMA 1AS7A 1KMEA 1M57B 4WTQA 5H2NA 2H47C 1J9QA 3V9EA 2I85A 3QJUB 5I6OA 1JZJA 3VHZA 1BRDA 3HAPA 5ITEA 1RZQA 3QJTB 4N4WA 4BVNA 1XB3A 4LDEA 3DTUB 3S3CB 4BWBA 4DP6X 3T6VA 1BXUA 3CAPA 2JAFA 5B6VA 6PCYA 2EIJB 1KCBA 3V2WA 3WKPA 5PAZA 1IW9A 2PPFA 4HALA 1GY1A 3D12B 1EHKB 3QBIA 2I20A 5I6MA 5F7AA 5I6LA 1QM8A 4NB7A 2NTWA 2DY2A 1S53A 5H2IA 4GY4A 4G7RB 2DYSB 2XLLA 2AZUA 3T71A 5A7EA 2YCWA 4HYJA 2WO2B 3N2JA 3OE0A 1PAZA 4WW3A 2I21A 4GYCA 2FNWA 4MBSA 1W6LA 2VM4A 4TL3A 2ZIYA 3OMNB 3FQYA 4AKQA 4MQSA 4Y9HA 4K5YA 2R7EA 3AYMA 1KBWA 3KW7A 1QKPA 1AQ8A 2BZ7A 1SHWA 3PAUA 1H2SA 5DHGA 1BYOA 2HRGA 3FPXA 1L0MA 1GUEA 3FPYA 3RYMA 1E67A 5A44A 3SBRA 3WG7B 5B3SB 3X1NA 3DQBA 4AMJA 3OMIB 1E0PA 1AS6A 4XTNA 4DAJA 5AX1A 1URIA 3NJGA 2XXFA 1O0AA 3NJKA 1NPJA 1JERA 4KNSA 3P0GA 2QDVA 2YQBA 2YCZA 1Q5IA 2HPYA 4WKXA 5B6ZA 4KNUA 2YAPA 4XTOA 2YXWA 3EHBB 1W6WA 4DP7X 5I6NA 1AR1B 4G7QB 2GBAA 3IN2A 5A45A 3X1BA 4E9WA 3QBGA 5H2PA 2JFCA 4L6RA 3NS0A 2VN3A 3ZDWA 4L0PB 3AG2B 2IH8A 4IAQA 3MBVA 2H3XC 3N55A 1C8RA 4HCFA 1PZBA 1M0LA 5TGZA 4DJHA 1M0KA 3HASA 2VW7A 2OCCB 3OM3B 4EIYA 2ZXWB 3PPSA 4PXFA 3ODUA 8PAZA 2BHFA 3CDZB 1P8UA 4DPAX 1PNCA 2GHZA 4CSPA 2PEDA 4X32A 2EINB 2LLNA 3OMAB 2DV6A 2BW5A 3BVDB 1XMEB 1BAWA 1F88A 1UATA 2PP7A 3REYA 2PLTA 3UAEA 5ETZA 4OV0A 1L9TA 5TK4A 1RCYA 3UABA 4GRVA 4J4QA 2BP8B 2FQGA 1JXGA 2Y00A 4K9JA 1L9RA 1T5KA 2PPCA 2FT6A 2BP0A 1OCCB 3HANA 2FTAA 1PY0A 4E9QA 1L9PA 1M0MA 1C8SA 4FPDA 5G53A 3UTYA 5AHZA 4AI7A 6PAZA 4YSRA 3X1FA 3PAZA 5AHYA 3X3BA 3H4FA 4KOBA 1AG6A 1FWXA 1OE2A 2HX7A 5TK2A 1FA4A 1CUOA 1L9OA 1PF3A 3EF4A 3X2QB 4JR8A 3VVKA 2UXFA 4HZ1A 1V55B 4G71B 4N4YB 3NJJA 3WNIA 4GXFA 2P80D 4UF7C 4EJ4A 4G70B 2PCFA 3G5WA 4BEYA 1WA2X 1X9RA 4BV0A 1MG3C 5H2MA 5I6KA 2TSBA 1KG8A 2GC4C 1C3WA 3QAPA 5FC9A 5B0WA 3RFMA 4YSAA 1AOZA 3UTWA 3NY9A 1GZMA 1J9RA 2PP8A 3EH3B 3UGEA 4DP2X 3CODA 1ET5A 4HAKA 3NJIA 1IXFA 4M3HA 5G2DA 2EIKB 1BQRA 3NSBA 1JV7A 5G2CA 1VLXA 1XJIA 1OCOB 1ID2A 2YAEA 2CBPA 2BZCA 4WAVA 3EMLA 1TN0A 5B6WA 2EILB 1WAEA 4KLYA 4BXVA 2FWLB 3X1GA 4PCYA 1S54A 1JZEA 2R4RA 1NIAA 1PLBA 4M4RB 1KBVA 1OE3A 2IDSA 5AFAA 4ZK8A 1AZNA 5B7FA 2L6XA 2CCWA 4JHUA 3ABKB 5H2OA 2DYRB 2FT7A 4NC3A 5EN0A 3NJLA 5ITCA 1PXRA 5AWZA 2J4YA 1I53A 1NIEA 2BWDA 3IEAA 5PCYA 1QHQA 3OAXA 4A2HA 1TEGA 4F2EA 3NJMA 4PXKA 1S8LA 1JZIA 5AKRA 3BQVA 4JQ6A 3KJ6A 5KKHA 1TN5A 1J5CA 3ZEVA 1E65A 1JOIA 1CC3A 2R7EB 4G7SB 1DYZA 1NTDA 3NSCA 4AKOA 1AS8A 3UTXA 1GSKA 3FSZA 1AZCA 1A3ZA 2N0MA 2I7SA 4KNFA 4HWLA 2GSMB 3IE9A 4AX3A 2X72A 5AZUA 4A67A 2WJKA 2IWFA 3SN6R 4UANA 5H2LA 5A8EA 3A7KA 1F56A 1NICA 3PXOA 4NERA 4YL4A 1MGYA 3QQXA 3QJRB 4KO9A 4AKPA 3NP3A 3V9CA 1GY2A 1WS7A 4RH4A 1AANA 1JZFA 5BR2A 3QBKA 4YSQA 2IDQA 1ZDQA 4XTLA 4HCIA 5E9NA 2YARA 5G54A 2Q9OA 1KDIA 4P5RA 4BDVB 4GBRA 2KS9A 2AZAA 3T6ZA 1IKOP 5B1JC 2KSBA 2YXVA 2JKWA 1AG0A 1MG2C 2XU9A 2XV0A 4A66A 4CSZA 2HLEB 4MQTA 3AG1B 2YAFA 2ZFEA 3WNJA 3NY8A 2WSDA 1BRRA 1ASQA 3KW8A 1PY6A 5I28A 2TSAA 1GS6X 2CJ3A 1M9WA 1AZBA 1WA0X 2WO3B 1H68A 3UZAA 3S3DB 4NAJA 2BO0A 2FQFA 2X88A 1JZGA 4X4KA 1KCWA 4UG2A 1NIBA 1SJMA 1FFTB 1OE1A 3AYNA 2XV3A 1ZIBA 1QLEB 1E12A 1IC0A 1SNRA 5DYSA 1IUZA 2PPEA 3ABWA 2Y1AA 1NIFA 1JZHA 5IY5B 5B6XA 1SDDB 4P5SA 2I7OA 1F50A 5F8UA 1AZUA 3TBBA 1BYPA 5C1MA 1YLBB 2YDVA 1KGYE 3GYRA 4YSCA 4XT3A 1ASOA 1PZCA 2YCXA 4N6HA 2UX6A 3ABGA 2Y03A 1WA1X 3WQJA 5D4IA 2QPEB 4DP0X 4F7KA 4A2FA 5FJGA 1E30A 5B7EA 1GS8A 2IDTA 2PPAA 3WI9A 1JV6A 3DIVA 3HEIB 3CG8A 4HYXA 4PAZA 1BRXA 4BK5C 2VW6A 3AM6A 1KGBA 4YSEA 3TA4D 1GU8A 4YSTA 4E9XA 4GYBA 2HX9A 1SFDA 3FU9A 4XT1A 1BQKA 1QKOA 1J5DA 3FSWA 3MBWB 5I5IA 2J55A 2P80A 3H56A 1XIOA 2Y01A 2DWSA 2MRYA 5BR5A 1TKWA 3ASNB 1TEFA 2A3TA 2Q5BA 1X0I1 3QJVB 1XB8A 2CALA 5DHHA 5AX0A 3CVCA 2IDUA 3SBQA 2Y69B 3PXLA 2I1XA 5G28A 2I35A 1CYXA 1OCZB 1V10A 1LN6A 1ILUA 3TU6A 5B7MA 1OF0A 3CVBA 3PBLA 2IWEA 1KV7A 3QDCA 1KDJA 4E9RA 1AT9A 4A2GA 2DWTA 2YCYA 5B2NA 2NTUA 1A65A 4JHVA 3OE6A 3ASOB
chains in the Genus database with same CATH superfamily
3K0WA 3RWCA 4M62H 4PEEA 3CUPA 4LSRL 2XWZA 1T6VN 1TVBA 2ZOOA 4M6NL 4NQCB 5EZIH 3ZGIA 2XUWA 3GSUB 3MYJB 4WFGD 1BF5A 2P45B 1MFBL 2JXMA 1DZEA 1FSKB 2AXFA 5TE7H 3C6EA 5DJ0A 1XGYL 3ME0A 4KZDH 1OAYH 1XIWC 4LGRB 4RGNC 1M56B 3NCBB 4WI2A 2XTJB 2D0GA 1HINL 2JKNA 1ZPUA 3G6AA 4HJJH 4TOYL 4WKZB 1A4JB 3SDCB 4XNXL 5LBSL 1HOCA 4K5PA 3TBSA 2HFEA 1CGUA 1N64L 3BEVA 4FYRA 4RMTA 4XHJD 3ZL2A 5IGXH 4MQXC 3BZEA 4JDTL 4L4VE 3SQOH 2ZAGA 2YXFA 2XN2A 3CD4A 3LMJH 2MMXA 3HB3B 3ARQA 4FL4B 5TFSL 1IW6A 5LAXB 3H7BB 2WYIA 1GGIL 3N9GH 2EXWD 3GJEB 4GBXA 3P4LA 4XXJA 3DOIA 4HXBL 3ABMB 1A3QA 1HT6A 1BWMA 2FRGP 2WWKO 4XMLH 1BF2A 2YA1A 4WFHE 3WU1A 1HEHC 4TNGA 1AXSB 1A8ZA 4OKVB 4Q6IA 1Z66A 4K0OA 4UMGA 3ZPRA 4JW3A 4FXKB 4MBRA 4IQHA 4DWHA 4L35A 1ASPA 4NO3A 3V4PA 5GGUB 3D39E 1E6JH 1HKLH 1WVZA 5I6PA 1I3GL 1GW0A 1IGTA 2ZWKA 2WIMA 4UT6L 3OR6B 4A55A 5GGSA 4FZEL 2A1WH 5AW7B 3KWWB 4R5VA 2MHAB 3WEOA 5KSBF 1JYWA 2BIIA 3DSFH 5GIRA 2EH8H 1A5FH 1WZLA 4ONGL 3LQZA 3CHQA 4MMYB 3UBGA 5TF1H 2HPOA 3NRPA 4GMSL 1SLUA 4H13C 4X4ME 1GIGL 4KTEL 4I7ZC 3Q1SL 4ZYKB 1H3GA 1TQCB 2YEQA 3QJHB 1IBHA 4LDCA 4Q9QL 3UEQA 4I9WD 4V1DA 4FCAA 4UM9B 1B4RA 1HKFA 5I23A 1CWVA 1RP8A 2LAAA 1P69B 3C9NB 3W11C 2IH1B 2VRAA 4QRRA 5AB9A 1AHWA 2FIRT 3II3A 4PLJD 4DKEL 1CDCA 5IQLA 3BXNB 2AI0H 1GZQA 4HEME 4KJWD 4Y5VC 2AXWA 5CINL 4A2EA 3FB5B 2YMXL 1TDQA 2L0DA 4P2AA 2VDPH 3ZMEA 3BIKB 4H5SA 3MROA 4F7PA 3P0VL 3LEYH 2WZAA 1KTLA 2P44B 1BVKA 5IHZB 3CZUB 4PJCB 3VI3F 5IW6A 1UACL 4JKWA 4P23A 1MREH 5E4EB 1CYWA 1FORL 3NCMA 3IDJB 4HJGA 3OKOA 1U8IB 2GHWB 3IGUA 4LHUD 4UOJA 3IKCA 4A4MA 2IH3B 4QKXB 2D7QA 4OFVA 3ZYJA 3NSFA 4KV5F 4U6XB 3KPLA 1B0RB 2Y1ZA 4JRYB 3LRMA 4ACPA 3L7FA 3LN4B 5CHNA 5GZOC 4KTYA 1YUHB 3EOYG 4MSWB 5H35B 2KZ1B 2ZWNA 4R7XA 5SX4I 3RNQB 4HAFA 1AE6H 1A02N 1JF1A 4JFEA 4PJEB 2ZX7A 4PJCF 4TUOA 3VI3B 1QSFA 5B6YA 4BCZA 1UCQA 2GAZB 1CDHA 2ED8A 4JKVA 4XP5H 5HDQL 4PRIA 1UGKA 4D0BB 4R9HA 4OLVL 3LNIA 1ZANH 3ATEA 3V5HA 1K8IA 2H6OA 5FYLL 4Z7WB 2J1KA 1NDGB 3PWJB 3TYGL 5C0RH 5JTWA 3ML8A 4XO9A 5FGBA 5D1XA 2EUZA 1S9WB 4PVMA 1G6RL 2O72A 5C0IA 1MHCB 2CCLA 2Y4SA 3IMRA 2B2XL 4HHGA 2LU5A 5BS0E 1MFDL 1RJYA 3T77A 2EI4A 1OK0A 3FCUB 2VE6A 4WAFA 1AGCB 5JXEA 2VLJA 5L4MA 1BFVL 3NQKA 4Z5RA 1AVAA 3PQYB 3VUAA 4MJ6A 4WFFD 1R0AL 3ERXA 3ZSTA 1J0HA 3FFDA 3IDNA 5EBGA 1T4KB 5DLLA 3T6VA 4L1DA 4QHMB 4DUXA 4KKLD 1E3ZA 3PDOA 4B6ZA 3S37H 3UAJD 1S78C 1NUGA 1ZJBA 3HUJB 1CL7L 1HHGA 4D0DA 1AOHA 3G6JE 1TJIH 3D48R 1NJ9B 4UTBL 5I6LA 4KQ0A 3SOTA 4M6OH 3FW6A 3D25B 3JV6A 4BELD 3B3IB 2YCWA 4LBAA 5DK0A 4ZUTA 3GXPA 1PZUB 3F04A 4OD1H 1O9WA 3NIFE 3QSKB 3VWKB 4JFTA 3DOHA 2D4FA 4R90H 3MNDA 1A3RL 3KPLB 3U9UA 3AYMA 1KTJA 1NKRA 2Z4QA 3HE6A 4RFNB 3Q1SH 1BYOA 2CDEA 3IBEA 1CFSA 3EFDH 2Y2WA 3V4UL 4FGMA 4G6ML 1OAXL 2GW5A 4Y16D 2KDGA 1KYDA 2E74C 2MQCA 4HWEL 4JL1A 1RZ7H 1F41A 1IGCL 2C3WA 3CXFA 2FLMA 3VQMA 4KJQD 1HINH 4P5MA 1JS4A 2EC8A 3WD5L 2A4EA 1RL1A 3O6FA 1MQ8A 2J8UA 3L5HA 1ERNA 1NPUA 1UWYA 4XVSL 1ZXKA 2P5EE 3DECA 3GRWH 3HKZA 3QFJA 4L3ED 4Y4FD 2HTLD 3P30L 4AV4A 1Q1JH 1C8RA 3HNTL 5D1XB 4ZX5A 4RAVA 1M0KA 2VW7A 3PNWA 1MHCA 4KDTC 4AQAB 5J6HB 1MCOL 1P5UC 2BHFA 3HC3L 4J8QA 3FUJA 1BMZA 1WAAF 4DFIA 4M8UA 3FUIA 4LLUA 5EA0H 1ITBB 4JFFA 4YHZH 4K3JH 4WF7A 2WGXA 2VLJB 4LLQA 4TSCL 5GRJL 4GW1A 2MTPA 1P1ZA 3IETB 5GGRA 4WIQA 1KIQA 2V3DA 1GW6A 3ULVH 3LZQA 2YPVH 5DHXB 5CLYA 1OT2A 1WFNA 3HANA 4JFQB 3FTGA 1DL7L 2Z7ZA 1F45A 3WN5C 3RVVD 5K9OA 5AHYA 4KOBA 3L3GA 4IGBA 2R59A 4D0DB 2C1OB 1QSEE 3N40P 5GZOD 2YLKA 5F0LB 4AMXA 5CS7A 3K1KC 1RI8A 4GKLA 4LNRB 1B9ZA 1FVCA 3D0VB 2QKIA 1Z5HA 2IOIA 4DKDC 2GIXA 4G70B 3E6FB 5T3ZL 4KI5E 2OTPA 2WXFA 2ICEC 4K07A 4P2QA 3EH3B 1LL1A 2IJ0C 2DLFL 1QEWB 1Y7VA 2DMGA 1MCFA 35C8L 4LARH 3EXLA 4FFYA 4OJFH 3C60D 3C6LB 1HC1A 1EEUA 1TQVA 1HNFA 4G6JH 4JQXC 5IHUL 4KLYA 1E5AA 3FQWA 4H8PA 4QXUH 4ADIA 4Z8FH 2VOTA 1SLVA 1WHPA 3LRSA 4FNRA 4WI0B 4C56E 4RQQB 1CICB 5KYNA 1KIPA 2IDSA 2EC9U 5B7FA 1XH0A 4NC3A 4UV4L 4B3EA 1BIIA 4GLRI 1I4FA 5H37H 1OP9A 2BSEA 2LHAA 1RH8A 1OSPH 2EIZB 2H1LM 1U42A 4MLSA 2NY2B 4HT1H 4YDNA 2W0LA 3SE8L 4M7JH 2OYKA 2XKSA 4UNIA 4AKOA 1AS8A 4DF9A 1MFNA 2UZXB 3FSZA 1XSOA 4ZO7A 1AR2A 4U1HA 4YC2C 1J1XL 4HMEA 4M5SA 3QA3A 4NCC2 1DQLH 4AX3A 1M7XA 4EKXA 4JM2C 4DN4L 3ZR5A 3KS0J 1RJCA 3RI5F 3UDWA 4JQVC 2IXQA 1HK6A 1UKTA 2IDCA 2V5YA 5T1MB 3OKKB 4QRSA 1T2XA 3WNLA 1KIQB 4DH2A 1H6EA 3VCLA 2CA4A 5A6LA 6FABH 5I24A 2XKNB 2F19H 1KCSL 3DXAD 3NCWA 2JH2A 3WMQA 1FH5L 3NIFB 4P9HH 1KDIA 1R3JA 3U4AA 1U8KA 2FYYA 5I66B 2PTTB 5F9JA 4GKOA 5FYJD 3C5JB 2Y36L 1AG0A 2XFGB 4Z1PA 3PWNA 4HAGA 2IQ9L 4MQTA 5I6XB 2VR9A 5CP3H 5IM7B 2A83A 5F7DA 4L9LA 4NZRL 3ZQWA 2Q3AA 5DJYB 3RG1C 2TSAA 5EO0A 1Z3RA 1M9WA 5HDLA 1WA0X 1GJWA 1KTKE 2HLFD 5DS8B 1HDMB 1UD3A 2VXQL 3LKNA 3BSGA 3RFRA 4AMKH 4E42B 1P84K 5T3XL 2VYRE 4K9EC 1ZEAH 3O45B 4QCIA 1NFDB 4QRTA 3WFHB 4UQBA 1NIBA 4K7PL 2EH7L 1OE1A 1YEGH 2PETA 3DDGA 4FKKA 3VXSD 2ZZUT 5IR1B 1IUZA 4OCNC 2ADFL 4OQTA 1JGEB 2BFVH 2E27L 3Q5OA 4HIQA 5ESQB 1NIFA 1ETA1 4FL4C 2F8OA 2XNAA 3MNWB 3V4UH 3UIZA 4HUUA 1NA8A 4NC1E 1PLGL 4HZLB 3V0VB 3QZPA 3I3DA 4BH8B 4XWGL 1FLRL 3D4ZA 3LS4H 5I8KL 1BEYL 4L37B 3LRLA 4FJZA 3O4OB 4OUUB 3SKOB 4YE4L 2J1ZA 4F92B 4NM4H 1OIOA 3EGDA 4WTZA 2EKSB 1VPOH 3AU1A 1Q1PA 1JK9B 1WZ1H 3MLXL 1M2OA 1KGIA 3PGDA 3C08L 2NY1B 2VITB 4OGZA 1IL1A 1BDYA 3WS3A 2DWSA 4RNRA 4I1RA 2O61B 4U1HB 3FRPA 3ZTEA 1F3DJ 1S9VA 15C8H 4UM8A 2XWCA 3QJVB 5DHHA 2AEQL 2FZ3A 5AYUL 4H88H 2B59B 4L0YA 3OAUL 2ADIB 3VI3E 1XGPB 3WTYA 4XC3L 2IWEA 1E4HA 4WSKA 5TE6H 2OMVB 2IXQB 1AT9A 1UTDA 4EI5B 3M45A 2WZPD 2WZ6A 3UBXI 3IDIA 3TJEH 4BV1A 4IKLA 3Q6FA 4KY1L 2WB1A 3QDGE 3FQ1A 4GRLA 2WAHA 3HMWH 3A4EA 1BBDH 4XXWC 4YXLL 4HIEA 4MS6A 5CUSL 4JN1H 4XN7A 1U19A 2LNLA 3ETBF 4KROC 5HHQB 1DANU 2WINA 4JCMA 3C5JA 4UTBH 3UP6A 1SHMA 4CN4A 2NY5H 1KLGB 3I50H 4JKPH 3DURB 4Q74A 3MLTA 5H2JA 5I1JH 2V2WB 1MFEL 1OAYL 1TLMA 1ZVSB 3IPFA 4WO4C 1INQA 1ET8A 4X5PA 5T33H 5FUZH 1GC1H 3QUXC 1EERB 4QO1B 1OSPL 2G2PA 5I0VA 5D4JA 1NGXA 2JKTM 4Y4HC 4H2AA 4B9IA 1C1EH 3VWJB 2GIMA 1D3CA 4P2OC 3UAAA 4R8WL 1JGEA 3QZWA 3FFCD 4I2XB 2VLRA 3W9EB 5DEGB 1TO4A 2P9RA 4TPRH 4U1IA 4FF9A 2JQZA 4DGYL 4B0MM 4KH9A 5EF3A 1P8IA 2Q10A 4GPVA 3P40A 2IH9A 2P42B 3R0MA 1NMBL 3PL6C 4D9QD 1R9FA 1L0XA 2WLIA 1KGCD 3KWTA 5IV2A 4PW9A 3K6SB 2BY3A 4EVNB 4BEZA 1LWJA 3IDMB 2G2RA 3LSOB 2X1WL 5DHDA 2FJUB 3RVTD 4URKA 3QORB 3RTQD 4K3GA 2NY2C 4PN6A 4BWUA 3UTTE 4AEHH 4KUZH 3QQ4B 4N5ED 2F5AL 3PGDB 1E3FA 4PS8A 3THML 4LEXH 1ETJA 1K2DB 2Z8SA 3QUMA 4IMKA 1DO6A 3MNMA 3W57A 4L8DA 2ZCKL 5HYQA 4OQTL 1JV5B 3O3UN 4P49A 4FD0A 2B59A 4PTUA 5DS1A 5D70L 4LCCC 5JHDE 1ZLUK 2FX7L 2MEJB 2OMVA 2F6AA 2NZ1A 4ZMWA 2RQ8A 3CXHK 4HKBA 4L1TA 4MCYB 4A2DA 4KKPA 5HP5A 3EH2A 2YPVL 4I3SL 1RZPA 2DMKA 4GRWF 2OTWA 2ZNXA 5CP3A 1M7IB 2HUEA 1CTNA 3EJYC 4WK2B 1PEWA 3NSDA 4ECNA 4NEHB 5GZND 5K59E 2Q86B 4MFHA 4PP2A 5FHBL 3MI6A 3QHZH 5C8JA 3P1VA 4J12A 1SMAA 2OR9L 3NACL 2VDPL 1KPUB 3FOMA 1VB9A 3NSXA 4D8PA 1KT2B 3KXFB 2XX1A 3JYCA 1K4CB 5JW3H 3F83A 4X6DF 1NGXB 4Z7UA 2PCYA 2NY6D 5DD0H 5C0JA 1DQKA 1A1OA 3IJHA 2ZQKA 1MRFL 4DOHB 3GO1H 15C8L 1ZDSA 4LSUL 5KYUA 2EDFA 1UOKA 2VL5A 1ZT4B 1U8OA 1G7JA 2QHRL 1MFVA 4ZS6C 5F7EH 3VI4A 1KJ2B 3FTVA 1ZLVH 4QHUA 5FHAH 2R4SL 3PIQA 4L18A 4O51A 4I18A 1T0MA 2NSQA 5F7NC 4YE4H 2UY7B 1CGTA 4Q9BA 1A8JH 5CSZA 3QORA 1IRAY 2F18A 1X5LA 3MZTA 1XF1A 4AJ0A 1G7HB 5DLML 4OCYH 4OF0A 2BVTA 1CD1A 1P2CB 3QUXD 2Q8BL 2XYBA 3TYFB 5DJXA 4X9BA 1ZLSL 3TVMC 4P3WA 1TZIA 3DO7A 2RD0A 3QDGB 5FDWB 2WQSA 1HYSC 4I48A 3GXNA 4AZ8B 1IQWH 5IIEB 3QWQB 3NCJL 1ZIAA 4KKZA 1RQ5A 3D39B 3NDYE 2G9HB 4PD4K 2YAMA 3TBTB 1F6FB 2LT9A 1AYRA 2QQNH 4KTEH 1FFOB 1ZS8B 1LE5B 1CFQA 4E9TA 2VMCA 4RX4D 1JPST 4ILDA 1WHOA 4JREB 4O2EA 3M1CA 5DUBB 1KJVB 1WTGT 3JUYA 1DVTA 3TA3C 1O7DE 1BZQK 4L2YA 4JM2F 1HWGB 2FJFA 4KRPB 5DHYB 5GSRA 1EHXA 2AANA 1Q5JA 3CFNA 3MRHA 4WI6A 1SHSA 1VJSA 5KJ4A 4HSQA 1LILA 3WXWH 5I6OA 3UTTD 3DTUB 3QQ3A 4B60A 3N42B 3V7MA 2H3NB 3FUEA 1QPKA 5D1XD 5FYJL 32C2B 4JFYA 5HY9A 5MENE 5B6VA 4Z7OF 3V2WA 3PGCB 2PO6C 3TC9A 3X12B 4GUOA 4UTCA 5ANME 5DRXB 2PF6A 5F89B 5JPMA 3DPDA 5KOMC 3IS0X 3AGWA 2WUCL 2WXIA 1RURL 2VLJD 2QSCH 3V4VL 1YEDB 1J8HD 4MAYB 1A6VL 2ZCKH 2WO2B 2WZ0A 5IB1A 3KPRA 4MKMA 1MJJB 4EI5C 5BVPH 2AAAA 4NN6B 3O2DA 1LGVA 5I30L 2O5ZL 5JIQA 3CSTA 1MKFA 4W70A 2FIKA 4YDLC 5EN2A 3BUQA 3TIDB 2YFNA 1TQWA 4OZIA 1QKPA 5D9SB 3QUXA 3S97C 3L4YA 4Z7VF 1PQZA 4FXGB 3QXVA 4UQIM 3DX8B 4RIRB 1UKQA 5HI5D 2DWDB 2R1YB 5TDOB 1WEJL 1QQDA 4X5WA 3LN9A 3NPSB 1HL5A 2H6PB 3DOSB 4ZMTA 3EJCA 3ULSA 1TTBA 3QIUA 4KNSA 3ZE2F 1HWHB 3MSPA 2K45A 2YQBA 2WXNA 1VACA 4TN9A 5FDWA 2BSBA 4LVEA 4MA8L 4OCRL 5B6ZA 4C54A 4U1NB 1F4YL 3VDAA 4JO4H 1BVOA 5IIEA 8FABA 2QPFA 3LEYL 4ODHL 1BQUA 3OGCA 2BIQA 1A1NB 5D93B 1P4BH 2HTKC 5AG9A 2QQQA 2XWXA 2W9EH 2GVYA 1QLRA 3B9DA 3FAWA 1HOEA 3HC0A 1SY6A 4WW1A 4ENEC 2BNUB 3PPSA 1U92A 5FPIA 3P3YA 5HGBA 5I75C 2CGRH 3CDZB 1JF6A 3V6ZA 1LP9B 3QEHA 4KTDH 1JHLL 3DARA 3ULAB 5BV7B 5D2NB 3V0IA 2FJFB 2BW5A 3H0TB 3LYRA 1OK8A 2XN9D 1ADQA 1X7QA 1SM3H 2BP5M 3CDCA 1GGCH 3HUJE 1RCYA 4WW2C 2BP8B 2VDPB 2H8PA 3X11A 1JXKA 2YJQA 4WWKB 1T5KA 2EXSA 2BP0A 2BWQA 1DDHB 5C0AE 2H32A 5FA4B 3I9IA 3S6CA 4GXVH 3QXAA 2J6EA 3LZFH 4M5ZH 1JE6A 3KVQA 2YK1H 2X6CA 5HYSB 3K72B 5I1IL 1XF5A 3KL0A 2RALA 4G5ZL 3HZMB 4H1LG 4HZ1A 5I1EL 1EAPB 2FAUA 1RIUH 2PCFA 4NS0A 3RLSA 3V6FA 5I6KA 3VXSE 1NAMH 3NCJH 2GC4C 3U1PA 5FC9A 3AS2A 1XZWA 5JQHC 1GZMA 4OTXH 1U3HA 1HH6B 5IMMA 2YQ3A 2FIKB 3TIDA 3WAJA 4Z7QB 4MNQD 1DQTA 5T5FL 1ADQH 1BQRA 3QNXA 3NSBA 1S4IA 3KPSD 1OCOB 1ID2A 5JOFB 2BZCA 4WAVA 2DM7A 4WUUE 5ISZA 3TO2A 3CHOA 2NY7H 1WBXA 2Z6FA 4LQFH 4OM0H 3Q6GH 5E4OA 1KYUA 1NIAA 1UB6B 4BFIB 2C3GA 4UQ2B 5AFAA 4NZTL 3QDJE 5FO2A 4NQXB 1EHLH 3IEAA 5IK3A 3SPCA 1OGSA 2G5UA 2ZX8A 4F1SA 2IOOA 3QPQC 4U1NA 4Y0GA 4IEFB 3R1GH 3ATBA 1G6RA 3PE9A 2EVIA 4Y5YB 4N6RA 3MV7D 3GXTA 1E65A 2R7EB 1N2RB 3LS5H 3VXUE 1C7SA 4E36A 1HX0A 2AQ1A 2CR0A 3GO1L 1ZWIA 2WTPA 1U92B 3I9GL 3TO4D 5ADOL 2N0MA 4KNFA 4BD4A 4DQOL 3F58L 3FHAA 1LVEA 1M4KA 3Q01A 5KSAD 1C12A 4Y19E 1V7NL 2MPVA 3ARFD 4UQEA 3L4ZA 3BAIA 4ZDHA 2KYIA 2WCSA 3TP4A 4OAWB 3QT2A 2UUDH 1KPRA 3SE3A 3FTUA 3FT2A 5EU7E 3QRFM 3CVIH 4LPVA 2IV9A 1ONQB 6FABL 1USQA 5KSVA 3BDYH 3BOVA 3WKMH 5AZ2L 3SDAB 3LQAH 3Q5TA 4K7FB 2ZUQC 3DK0A 3AS0A 3OXSA 4OY9A 2OULB 5IVNA 1XO8A 1W80A 4HV8A 3HZMA 1MUJB 4XPFH 3IWVA 4G42B 4UBDC 3OLDA 1TZOA 3TN0D 3UH8A 3EGXA 3QYMA 5T3ZE 3FH5A 4M93B 2CNYA 4GRMB 4PJAB 2XETA 1YY8A 2WLLA 1A6WL 1NGZB 4U1KB 4ODHH 4Y7MA 3KZ8A 4M7JL 2E5EA 3S5LB 4C56B 2AGJL 3SKMB 2KLSA 3ZJAA 2EE3A 3RZCA 4PGDB 1WAPA 4G43A 1A6PA 2BNQB 1P7KB 1I1RA 4LGSB 4UQ3A 5AUMA 1JZHA 2L04A 4PW3A 3OB8A 1XD1A 3CCHB 5C09B 2NXZD 2AV7A 2FECI 3A4DA 5I15H 4BZ2A 4I3RL 2Z8RA 3SODB 4YSCA 4NSKB 1RU9L 1EEZB 4QTIH 2B20A 1CD9B 4H8HA 5D4QA 5D7LA 5H37G 4NM8H 4J4PD 4JFPA 1M7DA 5DQJA 3HEIB 5DC2A 3FCGA 2OMXA 1XCWA 1TQCC 1OW0A 3TH3T 4NLAA 1KGBA 1HSAA 1KEGL 1FUNA 4TVPH 4GYBA 2ETWA 4QF1A 3MBXH 2YR3A 4JZNB 5BR5A 1SJEB 3II2A 4TS6A 2F74B 5C0AB 5CJ5A 4Q56A 3NABH 5HI3C 4AC2A 3I2CH 1KV7A 1RERA 2H2SD 5BRZA 1IT9H 1UD4A 2R2HA 3EJUA 1X5FA 1F00I 4JRXB 3HRZC 4NQSA 5CEYA 2V7NB 5C9KA 4XMVA 2JKSA 2H0JA 4JFOB 1KPRB 5CJXC 1HH9B 1ZTXH 4ZFGL 3KPRE 4P59H 3JVFC 5IROC 1N8OE 1P6AB 5KSVB 4ABQA 3MRMA 4DCQB 1C8PA 4Y16C 2BVPB 1BBDL 4JG1L 1WICA 1WWWX 1JMXA 4N0UB 3HE7B 3T3ME 3WJMB 1KJMB 5HHNA 3ROOA 3BUDA 3OE8A 1DLFH 1YEKH 2AEPL 1F4ZA 4KJQC 4QHPA 4OI8A 3O3BA 3DMMC 5DUJA 1BMWA 4LSTL 3VXRD 2ADGA 1E4JA 4I8DA 4ELKB 1OHQA 2VB5A 4JPIB 2EDNA 4BFNA 2BSCA 1FBIH 2LLGA 2EXYC 4APQA 5F72S 3G04B 3WXVH 4QJ3B 1NANI 1MH5A 3MJ6A 3P02A 2G3MA 3K74B 3QK0A 4PBDA 3VFUB 5AOZA 5LWYL 5B39A 1WIPA 3QPQD 5CSBA 2WVVA 3DIDA 2AV7B 3BN9D 3S34L 3RWEA 2DM3A 2IADB 3FFCB 3OHMB 3WFDL 3UTTA 5DJCB 5I1KH 5IB5A 4N8PA 4LLDA 3TJEL 2JB6A 1XGRB 3GMOA 4YSUA 3CSPA 1A3LL 1KB9J 3M1BB 1LM8V 1V27A 5C92A 2WMPA 4ABUA 3QO1A 4KMQA 2A9NL 4OJDH 1CK0L 2ZUWA 2HJFB 4DO5A 1XGUA 2ZZLA 3Q8AA 1DCLA 3UYRL 1BD2A 4PGBB 2B15A 3QQ9C 1T1ZB 4R5TA 2TRYA 5CJOH 4F2ME 4PGEA 1UURA 1VFBA 5AZEL 3BSZA 1AHWC 1B2WL 1A66A 4JFDB 4EIZC 3S4SB 4G9FE 4LPYA 2JKXA 1LNUB 1U8NB 1LK3L 2UXVA 4WDIB 2IDFA 3BZEB 3NIGF 1R3LA 4GOSA 3L9BA 1KPVB 3BZ4B 4ZPVA 1CB4A 3H7BA 1UM5H 1P4LB 1EXUA 1N18A 2XIDA 5A2CA 2JIXD 3UTZA 4DK5A 1U3ZA 4P3CL 2XN1A 4P46B 4D3CH 5ILTL 3FSOA 4JLRA 2HSIA 3PRZA 4KRPC 5JHLL 2ERJC 4F91B 3WJMA 1CF8H 3T0WA 1KTRL 5JNYA 3G08A 3E3QC 2YSSA 3CZKA 3BVNA 2B5IB 3HNVH 3VWKC 1K3IA 1ORQA 4KXCA 3MNVB 1URZA 2ADGB 3CVHH 4KO7A 5B39G 5I71B 2XN0A 2R4SA 3HAOA 2X4TA 3B37A 5B34A 3K6NA 3OJVC 4GAAA 5A6IA 4FA7B 4QIRA 2CO7B 1GOHA 5E8DH 3M7OA 5F3HA 3FT4B 4Y5XB 5ICUA 5J8OA 3CUPB 2R29L 5D55A 4IKJA 1NAKH 1Y6NR 1A6AA 2RB8A 4KHTL 4LEBA 2DQIL 3TA3D 4LHUG 1MVFA 4Z0XB 4AL8L 5KVDE 4WV1B 2WLHA 1OT4A 3C09B 1VZIA 3AXLB 5E6ZA 1A25A 3GDCA 2VZVA 3ECVA 3TF7C 4GI8A 5DD5L 3ELQA 1NGPL 4OR1A 3GIZL 5IHWA 3KPRD 5CCHE 3OJ2C 3N0PB 2WXMA 4H26B 2X42A 1MHPL 3A67H 2X87A 4P07A 3I3BA 4HJSA 1HOCB 1MI5B 4HMCA 4PJ9D 3HC2A 5CJ8A 5DUML 4HIJA 4Y19A 4ZFZA 4U6YA 4P59L 3AQZA 5J7AA 1IQDA 2ITCB 3H9SB 5KS9A 2XVKA 1OAQH 3QE5A 3TN0B 2Z73A 3BXNA 2WBJA 1N70A 4E41A 4YDKL 2DTSA 5A2FA 4S10A 1J9SA 4DNLA 4PGEB 2ZYRA 3RIFK 1E27A 3WELA 4EMZA 1I8MB 4PRHD 5EHFA 5E6IC 2BPBA 3ULUF 3MCKB 3BW9A 5GS2D 2MKWA 1PXSA 5F71A 2K9FB 4WZ9A 1KJ2L 3OL2A 2DTML 5B4MC 1BVKB 2JV6A 3CK0H 3GLZA 4YLBA 4WGVB 3T8VA 5IHZA 1W0VB 1XL4A 3NTCH 4FXKA 3TM6A 3MRCB 3ROLA 1D9KD 1M6OA 3QHFL 5GGUA 2NY1D 1BFTA 1EXUB 5GJSH 5FGCB 2VH5H 2AJVL 4R2GC 5EBLB 3CDYA 3OHXC 4H1LA 3SPGA 2YMOA 1OLZA 1U8PB 3FQUA 1EGJL 4YNYB 4Q6KA 1B0RA 4M00A 4TNEA 4DVBA 1C16B 2YKLH 3VRJB 2Z1KA 3MV7E 4FOMA 5JZ7D 5GIRB 3S3CB 1ZANL 3MNVA 3US0A 1OWRM 3GTTA 4LSDA 6PCYA 2EIJB 1MRDL 3TXAA 5J57B 4HFUH 4AIXA 2ARJB 4TL5A 5F0MB 2X6UA 1W72H 1Z3GH 3WFZA 2BP3A 3MLZL 5J1AB 2DIEA 2V9RA 2GI7A 2DY2A 1R5VA 4X6FB 5EIIA 4PTTB 3VQLA 5KVMC 4NKIL 5JXED 2ERJB 1KTDB 4QRPE 1ED3B 1UFGA 5SV4A 3CBJB 4FQIL 5E8NB 5EF0A 5DI8B 5LCVL 1RK7A 5FYKD 3TX4A 3ZR6A 1GA2A 3A22A 3EIFA 5IBTH 2N1TE 3VNYA 4YWGH 3FB5A 3SPIA 1H2SA 5B8CA 3HOGA 3OKLB 2EABA 4H5SB 4APQC 1E67A 1QACA 3V0WL 2CMRH 5CEZH 3KYNB 3DX1A 5AAWC 1I1CA 5K39B 1EO8H 4WJ5B 4XP1H 5IBLD 4HSAC 3ARBA 3QIBD 4HJGB 1IJ9A 1C7TA 1XXFC 3MPCA 3EOTL 3POCA 2QADB 4NN7C 4AIZA 3HPJB 1YN6A 2Y5EA 2XQBH 1T0PB 1HILB 2FUTA 3DWTA 5DZJA 4PUBL 3LXAA 4D0CB 3ZDWA 5ACZA 2J43A 3BWUF 5CHNB 3ZTJH 4D8OA 3ISWA 4G83A 1TIUA 4F8LA 3ZKMD 2ICWB 5HHMD 3HZKB 2ISDA 4QT5B 4KVPA 3ROLB 5DK3A 1PNCA 1HEJC 1M2VA 1S7XA 3T0AA 5IW1B 4OVUA 4L4TD 1FN4B 2Z7WA 4QGYA 4XOCA 5HTSA 3M7FB 2A74A 4Z7UE 4LVHC 4WK0B 1UWEH 3U9UB 1JNLH 5B21A 2Q8AH 3CNKA 4EN2A 3ECBB 3BKYH 2PNDA 5DMJB 3FU5A 1MW0A 2XICA 4MNQE 5CN1A 4Q2ZA 5EU5A 1E5BA 5KN5B 4PJBF 1L0QA 2FT6A 1I1AA 2ZE0A 3MFFA 3WIIH 5LNGA 4XMZA 5J13C 3MN8A 3DBXA 1Z9OA 5GGRY 3RL2B 4AI7A 3UJJL 4YSRA 1P84J 3H4FA 1OWWA 5DZOA 2CDGB 3DUHA 2XA8H 3QIWA 1MVUB 3KNBB 1IFGA 5EUOE 1M6UA 4I9XA 3MV9D 2J8UB 1ED3A 1YPZB 4LSSH 3TWCL 3S34H 2XPGA 1RIUL 2VDKB 2ORBL 4K8RC 3WNKA 4YHIB 3F5WB 3BQUC 4GQ9L 3O6ML 3REWB 4F57H 4K23L 1IE4A 2A7BA 1JTOA 4LDEB 3CGTA 4N2OA 4X6DB 4HF5L 3S48A 1E5CA 1EPFA 5C07B 3KE0A 3X1GA 4ZMYA 2XZCL 1T04A 3GXDA 2NTSP 4NUJA 2FH8A 3L08A 5I1HH 2CRIA 4F1ZA 1Q0XH 2W38A 3HPJA 4AYDC 5E95B 3D5OF 3B34A 3MA7A 1YEEH 2DMHA 1FIEA 1TR7A 4OD2B 3EUDA 5E8DL 3LJ3A 5INCB 3UZEA 1NEUA 2ZUXA 4F37K 3KGTA 4NKDA 4YZFF 2BRRH 1U95B 3NSCA 5G55A 4Q6YA 1AZCA 1A3ZA 3MRDA 4MXWH 1FVCB 4I0PB 3P2BA 3IDYC 3D4CA 3GIZH 4UANA 5JHLH 1D9KA 3RE0A 3EG9A 4LO9A 3QJRB 1QSEB 3RDTD 3SYQA 3NFPA 4J4PC 1WS7A 4RH4A 5E6IA 5ID1B 2G3XA 4U6VH 5IFHH 1MY5A 3ZTNL 4XNMA 4PJHF 4YLQT 4HW6A 4FQLL 4JFDE 1Q72L 5AW4B 1CXHA 4JAMB 4NO2A 3TCTA 3QDHA 4R4BB 4XRCA 3VJ6B 4GT0A 4BQBA 4PRHE 5I8CA 4JM2B 2XV0A 1N5AA 2AKRA 2HKFH 4PWHA 1K4DB 2DJMA 3EJPA 2YGVA 3QIWB 5DVLA 5LB1A 4A66A 3O4LD 3AG1B 3KNBA 2X4PA 1T83A 4UB0L 2UWEF 1MIEL 4QYOB 3U48A 4BUGA 1F8TH 1S3KL 4FQ2H 1AH1A 1PY6A 4X9GA 3DMMB 5F93C 1NDMA 4ZZFA 2ODHA 4HIIA 1H68A 2OYMA 2XFXA 3HG1D 5GRVL 3KEDA 3WIHA 1BECA 2RAMA 1CDBA 3WOVA 1WBYA 1WZKA 3WUWG 1CXEA 1FFTB 5K9KB 4WNQB 1WFJA 2E27H 4JFQA 1KYOK 4JRYD 4HU2A 5C07A 5E8OB 1KYFA 3O81A 3KBEA 3KHQA 4R0LB 3SDXF 4BKLA 1QW8A 5E0FA 4KXDA 3V8OA 3RVXC 1PZCA 2FGZA 1FFQA 3WQJA 1JNJA 3UTPD 2OTUA 2QPEB 1FF5A 4G1EA 4JN2B 4MNHB 4TTDD 5I1CL 1E30A 4MJIB 3UYOD 5DFVC 3MA7B 1AGDB 2OMTA 4GSQA 2OZNA 4OD2A 2DN7A 4RX4A 3MLZH 5GGSY 4U7SA 1W72L 2YD7A 5JW4N 2WSKA 5E8EA 1FRGH 5TQ0L 2L8AA 4MRBA 4AVIA 1F90H 4KBPA 3MRDB 1JGVH 3KPTA 4LPWA 1TYJA 4GAGH 2IDUA 4N2CA 2DKMA 5G28A 1ZTMA 3ARBC 4RFOH 3IDGA 3PBLA 3MOBH 3LRKA 4IU3B 1MWAL 5D1QA 2NW3B 5EZOL 1COBA 3OE6A 3C8DA 3ASOB 3GT6A 4ELMA 1ZRUA 4PJIE 3AU0A 3Q13A 3G3LA 4KTGA 3X14B 5G36A 3P77A 3QNYB 4KZEL 4LOFA 1H0DB 4J6RL 4JAMA 2WY3B 4UAHA 2VXUL 2MNUA 5B3JE 3HS9A 1ZV9A 4BH8A 3PY9A 4JFVA 5I8CB 1QUNA 2WN2A 1EHLL 3WV0A 3ZHLA 2XT1B 3VG9B 5JIPA 4QMEA 2G75A 3FQXA 4NQCD 1OAUH 4FLOA 1YC7A 4CGTA 2KI6A 2A73B 2ZP8A 4YDJA 3D85A 3LIUA 3MV9A 4LLVA 1F0LA 2B4CC 2W94A 2VITA 3MXWH 3ZLQC 4YAQB 5I1DA 1LO4L 3B5GA 3P54A 4NQDB 4W93A 1TJIL 5CU9A 3UERA 2VXSL 5E8OA 3IMBA 4P5TC 3APFA 3D4GA 3FMGL 3BPOC 1HFUA 3ATAA 1MZZA 2PMZA 2WXPA 1IT9L 1T1WB 3FTXA 2EDLA 2OMBA 2XCMC 5DHVB 3ESOA 2NRDA 1MFMA 2HVJA 3A21A 3O0LA 3L3OA 4JL2A 4X99B 3T0XA 2C3HA 3NCYS 1NBYB 4QXVA 3AT8A 3LZNA 4Z7QF 3TS8A 5IJVB 3UTSB 3RY6C 1BZ9A 3FCTA 5KZCD 2KQMA 3STBA 4I0KA 1B6UA 3Q43A 3B2VL 4ZG1A 4QLRA 4KO6A 2Y7NA 2WWMC 4PV1C 1S7UA 1VCBC 3N6YA 3WY2A 2CJUH 4HUWA 1WD9A 3UONA 3OQRA 3Q0HA 4O9HL 5H2HA 2JJTA 1IKNC 4HZLA 5FYLD 3V4PL 4EXKA 3R4RA 4IU3A 3QAKA 3TPKA 3UGUA 3TASA 1FDLL 2J2ZA 5BRQA 4P4KA 1C5CH 3K91A 3ESMA 4CVZA 5ITBH 3LNDA 3NZUA 1M05A 1QNZH 3X14A 1XMWA 1ZAGA 2FGWL 2GEEA 4I2XA 5I1GH 3VXMB 5LGJA 4WWNA 5ADPL 4DKFH 5F21B 4WLCA 4M7KL 3QIWD 1N67A 4HK0A 4MAYC 4ZXBC 2C9XA 3IJSB 1F58L 1S9VB 1WZAA 4UM8B 3D9AH 3EGSA 3I6LD 3IXAA 3O6KH 3IDMA 1DVYA 1DZBA 4QTFA 5EEUA 1U9KA 1S8JA 5C0EB 5B1BB 3CVHB 4EUPB 4XMPH 4DTGL 1T20A 2VJXA 1UD6A 4LDLA 2X40A 4XCEB 3AQXA 1J9TA 2Z3FA 3AREB 3GSQB 2VT4A 3LEVL 4LPCA 4MJIE 2OJ1A 4NQDA 2FCBA 3PGFH 1JGVL 5EOQH 3F6JA 1KBPA 4HVBA 1X5MA 1U6AL 2FJSA 3VXUD 1RJZA 3FB7B 4LVHB 5ABDE 2VN7A 4M4RA 2QHRH 1MFUA 3SBPA 4G6AC 3FH7A 2R23B 2K3HA 2A2QT 2DDQH 2X3AA 4XBGB 3BGFC 2RACA 1ZLEA 4WW2F 2CSPA 3T4YB 4NQTA 4X9YA 3GQFA 5BRZD 5TJWK 2NX5E 2AMGA 1XSJA 2FT8A 4MJJA 4QXGH 5ERWB 4Y88A 3OXRA 1KB5B 1SF3A 4KX7A 5E2UL 3DROA 2I25N 4Y1AE 4XCYB 4O5LH 5JW3L 3FCTB 4ENZA 3TJPA 3BPLC 4MRCA 1T89A 2UZYA 4L8BB 3HJEA 1PJWA 2V33A 1QBMH 1AXTL 4MCZB 5J3HC 2EE0A 1CF8L 2OX5B 2VR5A 3OJDA 5CP7A 2YD2A 2YEVB 1UADC 5T1KA 4KRLB 3EOAA 4C47A 5E5RB 4BK8A 1EFQA 1UT9A 4QNPF 4J5VA 3VAEA 1HHHA 1CE1H 1JPFA 3U7YH 1UH2A 5DRWA 4L5FL 4P3DB 4XX1G 3HIZA 4K8RH 4X5RA 3CFJB 5EUOF 1TJXA 1U8MA 2PW2A 2B3IA 2VXQA 3GKWH 7FABL 4PJIA 4KVNH 5B1AB 3B7RL 4BHUA 1ROWA 5MP6H 4U1MB 2XWRA 1QZ1A 1JZDC 4K15A 3I02B 3X3CA 3GXUB 2FJHA 3KLHD 4HOWA 1CT8A 5GRJH 1ZA3B 5FXCH 5D6DA 3S96A 2E7CA 1KJ2A 1NKOA 3IJSA 4XHJC 3JZYA 3K6DA 3V9EA 2AITA 1XGQB 2K6WA 4HD9A 4FCHA 3TTYA 2CHXA 4Z3GA 4PGCB 5C7ZA 4P8QA 4OZFG 2BVUA 3CAPA 2FNBA 1X5AA 3WUWB 2OL3B 1T20B 1YCSA 2EXWC 1FH5H 4M4PA 3H3BC 3ZZLA 1CD1B 2PR4L 4EZLA 2JJUA 2P46B 3LV3A 4NHCL 5GGVY 3TIEA 1ZHLB 2VERA 4Y2DB 2P28B 1Z3GL 3UZQB 3UTSE 3OC8A 4KHXH 3HMXA 2B39A 2KZBA 2Z34A 1G4MA 4XOEA 1J8RA 1F3DH 5AVYB 1RJZB 3FB7A 4O9HH 4HFWA 4D7PA 4FTVB 3G6AB 3TCXA 2YD9A 4XCFH 3ZK0A 2FNWA 3D39A 4F9LC 4CDGC 5JIIA 5IMLA 4M8VA 2WN3A 5E08H 4UT9A 3SIKA 5GGQL 5L0QC 2L7UA 2ESVB 3DGDA 1AQ8A 5TE4L 3REVA 2ZP9A 3NZ8B 2P5ED 3R7QA 2IEPA 4JM4H 1KPUA 2A6JA 2D31A 1QFUH 1KB5A 1KJVA 5LGYA 2FGWH 4P9HL 5I1GL 5A44A 3KEHA 4NPYB 4PW4A 5LAXA 2NY3B 3FTWA 4XCYA 1EMTH 2NCEA 2C4FU 3UBXB 1WC7B 2L7JA 4DAJA 1URIA 3FQNA 1MCDA 3VFWB 1O0AA 2AJZA 4UT7L 3MO1B 1QRNA 2G4EA 1VESA 3IFOB 4H2CA 4JO4L 4F8TA 5A2JH 2BSDA 5E00B 1AXSA 4G9DA 4Q6IB 3EHBB 1KCKA 4RGOL 4TVUA 4KKQA 1AR1B 1JPFB 3DVNB 5A45A 2WWKT 3RWDB 4E9WA 4L6RA 5IREA 5DGRA 4EZMA 1BP3B 1S7WA 2ZSWB 5GXBB 5I2IA 3OR6A 1HHKB 4M5YH 1RD6A 4CSPA 3V5KA 1PX3A 2D3JA 3QC6X 5FLUA 2PTVA 2FR4A 5DJXB 1QLEH 3M8OL 3OZKA 2KZWA 4F9PC 5DUPL 3RGVB 1OZTG 1QHOA 4OV0A 4AYEC 5HI4C 2CK2A 4NOBA 2C9RA 2NY0B 1L9RA 5L2KB 1N9PA 3MMEB 4IRJA 4WUUA 3WUWA 1QFWH 2HG5B 4E9LA 5EEYA 4N8VG 1WZ1L 2H6PA 3DOSA 2FATH 3MLXH 3MRQA 5JIDA 1CFQB 3PAZA 4MXVF 5FWRA 1ZLVK 1AGEA 4C4BA 3FF7A 3SOBH 1EK3A 2CXKA 1GZQB 3CV5A 2BOBA 1XZ0A 2DL9A 3BPNB 3DVIA 4JX0A 1TSRA 3LB6C 4PRNB 3BEWA 3G5WA 2XQ0A 3BWSA 1EA9C 2ARJQ 3ECWA 3PWVB 1E8YA 5GSRB 3KH4A 1BQHB 2DMCA 2YUZA 3UTWA 3C6SB 5I9QC 3BCDA 2DJUA 4NGHL 2VDNL 4HAKA 2HTKD 1YG9A 1G9MH 4PJCA 32C2A 4JFYB 2YAEA 3H9YA 3CBRA 3LD8B 2X1QA 4R4FL 5D7SL 5SWSD 1TN0A 3GEFA 3KR3H 2DL2A 4KK6C 3RZWA 2F53E 2CO3A 1RZJH 3D0LA 5H8DA 1LLAA 5DJDB 3D09A 4UINL 4DKEH 1OE3A 2DF3A 1PIGA 4LHQB 2DYRB 3H2PA 5D8JL 4ZW3A 5ITCA 2EUWA 3AAZA 3D3VD 5IP4A 3UAJA 3L95B 4YMPA 5IB1B 5DJ8B 1AO7A 1S8LA 5FV2A 5KVEE 4YHPA 3KBHE 4IIZA 1ND0B 3OZ9L 3SCMC 5KKHA 4Y8DC 5EU4A 4HLZG 3W3BA 2R69H 3SYAA 1CC3A 4MA1C 1GIGH 2AQQA 2EP6A 1EEYB 1JPTL 4FFZL 4MA3B 2HPTA 4X0KA 3P3SA 1ZHBA 4ONFH 1OCWH 4BZ2L 3CSYB 5A40E 4WU5A 3UTPE 2EYRA 3T3PB 5JA9A 1VSCA 4PRIB 3INOA 1AI1H 4CKQA 2V17L 2YMTA 1TXKA 1E9PB 5H2LA 1Z9MA 2VM9A 4HJ0D 3NJVA 5AW9B 1FGNL 1E5UI 4M29A 3RHWF 3C87A 3HHSA 5AL8A 1AANA 1S9WA 5IUSA 3QBKA 3SGDI 1ZTXE 4HCIA 1EO5A 3SHSA 5IFHL 3ZE2E 5G54A 2OK0H 1IBGH 4OLUL 2V5RA 4TL4A 1D7DA 1DBJL 5FB8A 5ALCH 4MDRA 4DAGL 3QI9B 3CHSA 3NESA 3HZ3A 1S8DB 4XP5L 5DLMH 2NYKA 4MWFA 2XU9A 1FYTE 3AWEA 8CGTA 1FFPA 1CXFA 3MUHL 4OB5H 2YAFA 4PJDA 3QEHB 1Z1WA 3QHZL 4MJ6B 4IEFA 2CIIA 2CG9X 4JPVH 1F8TL 1S3KH 4FQ2L 4CJ1A 1GS6X 3LZOA 1Q8MA 3TV8A 1T22A 2UYLB 2ZCHH 3QUKB 4OLWH 4QRFA 3MRBA 3MXVH 2BO0A 4EOWH 1NMAH 5IKCA 4DT2A 2X9ZA 2NXYB 4X4KA 3QNZA 5E2TH 2XZZA 4WWKA 4HUVA 3QR1A 3SGJC 1E12A 5KVFL 5FA4A 4QXTA 4BEIA 1AYOA 5BV7H 1UG9A 3ZXAC 1M71A 5FGSA 4BCXA 3JV6B 3SE9L 4I3RH 4XPAH 4WVRA 3ARGA 5KSAC 1YLBB 5J9PA 2CXGA 3K72A 2FHBA 5IJCC 3V7AE 4UF7C 3OHXB 1BV8A 5FW8A 2QLYA 4V1DD 5D4IA 1IAKA 3EYUH 4HMDA 1JGLH 3WHXB 2E7DA 2HT4C 3NDZE 2Z8VC 3QWRD 1GS8A 4HBQA 1OQXA 4AEFA 5A7BA 1YMMD 4NXKA 3B3BA 1ND0A 1KXVA 4YSEA 3WJLC 4J3OH 2YD8A 3FU9A 4E5XB 5HYJE 4K7FA 5AOMA 3L3JB 4JGJA 4LIQH 2J55A 3SY0B 2X0WA 4KKAC 4HV8B 4W9LC 1NEZA 1SBSH 3ECUA 3DYMA 4G42A 1K3ZA 4OIFA 3IXTA 3PXLA 3OKMB 2EYRB 4UBDD 2GTZB 3TN0C 5L6YH 3H3PL 1ZE3H 1MLBB 3ULVE 5JIMA 3QDCA 1M9SA 3O4LE 3QFJB 4L4VD 1NCHA 1XT5A 3MLWH 5SWZE 3S5LA 3T5WA 4C56A 4NM8L 1S7SB 2O4EA 5IT2H 2NY0C 3ZE0E 2JTYA 3GBDA 35C8H 4LARL 3H53A 5A3ID 2BHYA 1G94A 2XTJE 3CHXA 4Y5YA 2EVFA 2YBGA 3NYKA 2P8LB 3QAQA 4EKJA 2E56A 1PKOA 4RRPM 3KL5A 4KZEH 4LLUB 5ILTH 1EEZA 1ZWIB 1I3RB 2NZ9C 5D1QE 1KLUA 4ZOCA 5F7BA 4AYMC 1AFVL 4G7YL 2ZUQB 5ID0A 2WVSA 4EBQH 5BCAA 5F96H 2B7DT 3D69A 1DEEA 4J3SA 1T2JA 1DANT 4PS7A 4PJ7A 2HRHA 4Q7DA 3FN0H 3VFRB 5A2LH 4QF1B 3TH4T 3DDFA 3SJVD 1RUPH 1EJ8A 2NY5C 2F7QA 5F7WC 3EDJA 2UZIL 3IMVA 4ICXA 4MD5A 4ZAKB 3RAJH 4HUVB 5F6IB 1WG3A 3CZFA 3TFBA 2RBLA 3UG3A 4JRWA 4E9VA 2J5LB 5EZJA 2BNRE 4D3CL 5EU6E 1UYWL 2AABH 2H2SC 2ZYHA 2FLRT 4WI7A 1N10A 4KU1A 2J6EH 3MOAL 3TTSA 1O0VA 1JYVA 4I4WB 4CN6A 1QBLL 1J0ZA 2NW2B 5IQ7H 5MHSE 3AADB 3U1QA 1SOKA 3ZDYE 2AV1B 1CE6A 2I5YH 3AT9A 3BC9A 4NYLB 5D7IE 3J8F7 5DMGD 3LTVA 1EAQA 3MREB 4N0UA 3BUIA 5SX5K 4E5XA 5EZLB 2Q7YA 2BNQA 3GHPA 5AUMB 1P8HA 1FNSL 4L8CB 3DGGB 3DUSB 5C6TL 3DLQR 4RRPA 3BO8B 4Z0BL 4ODXA 4F27A 4EF3A 1N3NA 5BW7A 2YWYA 3HI1A 1OP5K 4NN5B 4L9DA 4RAUA 4P2QE 2XG5A 1RZGA 1U8HB 5FLVA 4ZPTA 3L3DB 4G8EB 4L4TA 1DJYA 1G5AA 1KJ2H 1H9DA 4K2UL 3QEGL 4H25A 1EJFA 3ARDC 3VQ1C 5D5MA 1F42A 2DQFA 1KCSH 2UZXA 4JS7A 4UQAA 4UHRA 4H8WL 2D0FA 3HMXL 4KY2A 3MUJA 3HAEA 4KDVA 1JN6B 1CI3M 4YFDB 1R5WA 3LKOB 4E68A 4DKFL 2VKWA 1MHHB 3BN9C 2X4SA 2GJPA 4EE2A 1D5ZA 1P9MA 2OXHB 2J8OA 3OMZA 5AL0A 4KZDL 2MOVA 1XGRA 1AIFA 2AVFA 1GGBH 2LU3A 5DO8A 4CVXA 4GG6B 3C5SB 4NM4L 3RWGB 3ZSSA 2CCVA 4OJEH 2VLLB 4UQ9A 3BMVA 5IB2B 5FYJU 2HJFA 4LKXA 3SE8H 1NGYB 1SLXA 4FA6A 2VXVL 1LEGB 4MB3A 3LEVH 3A23A 5IOPA 2NX5A 2PO6B 4OT1L 3OR7A 3HARA 3FXIC 4FKHA 2OSXA 2C3VB 1MCBA 5F7DB 1TQTA 4FMFA 2P7TA 3S4SA 3GZKA 5I19H 3WO3B 2WKOA 3CSFA 4TSBL 2VDQH 4FI7A 4L9LC 4PIBA 4WDIA 2E4FA 3Q2VA 2DM4A 4FHJA 1W8EA 3O3BB 5HPMB 4RMVA 4YSOA 3UMTA 1ZSDB 4PRAA 4F93B 3O45A 3F7LA 4PJFA 3U6XA 4HSCX 1XQ4A 2P49B 4NNPH 1BEXA 3WKYA 1XSIA 5KTEH 1CGXA 1G9HA 3AXIA 4A38A 5ICYB 2OPCA 3U6RA 1OGTB 3BH8B 4E9YA 1ZT7A 4AITA 4XMXA 5EZPA 3SDXB 3K0YA 2VN6A 4W9KC 3V0VA 2AJSL 4TQEL 3BVNB 1YC8A 4S1QH 5L2JB 5D71L 3U2IA 1L0PA 3GBNL 4JJ5B 4L8SB 5F88A 2DQJH 3NRFA 5BS0B 1QYGH 5AAPA 5DJZA 2VO5A 4G8FA 3QVAA 4FTVE 1TU2A 1HVXA 3FCBA 5IB5B 5MEND 2F5BH 4JFXA 1RZGB 3T2NL 1RZKC 3P4MB 4L4TB 1FGVH 2DB8A 3NIFF 4RBPK 4BK5A 2SODB 3WEXA 1F3RB 6TAAA 1G7MA 2ZUSA 5ELIA 1E2ZA 4MNQA 2WP3O 1MVYA 1D2OA 1YJDL 4TVSa 2FZ3B 5D7JC 4UI2A 1L9HA 3RTQC 4RGNB 1R5WB 4GH7B 3RWJB 3KPNB 1CD0A 5C0AD 1JGLL 1FLRH 3F7KA 1ETB1 1YA5A 2XWBB 5H2NA 3U0PB 5E2VH 2FVNA 2OL3H 3ZN6A 1AY1L 5ITEA 3ZTDC 2CNZA 4DN3L 1KY6A 5DMIH 4PCKA 4JMNA 1NBVL 3OKEB 3BUYA 3ZMNA 2R1WB 3MRPB 4PJ9C 2VLLA 5F3FA 3QEQD 3BRGC 2R0ZH 3UXFA 3WKPA 2PCPA 2PYED 4PJ5D 5E24E 5JUEL 3SN6N 1EHKB 3N85H 4U1JA 2PWDA 4XXWA 3X3FH 1XCQB 1JPSL 1LHZA 4JY5L 2H2PD 1E90A 1WT5A 3F7YA 1PY4A 4ATTA 3QZLA 4OD3L 1DBAH 1JBJA 3N2JA 2E47A 4GYCA 5FUCC 3HCVA 3KPSE 3LZRA 2IIJA 4HH9A 2I27N 2DWEB 2DBLL 3HNSH 4UDTA 4Z76B 5DRNB 1IU1A 3WIFB 2GUYA 3BKYL 4JO5A 1ZSDA 4PRAB 3T65B 3VXOB 1SHWA 1H15B 5GRUL 1E9QA 5I18L 2M8XA 4JM4L 1L0MA 4DW2L 1F2XK 3IF1A 5EBLA 1D6VH 1QFWM 5ESAA 4ODTH 1H6TA 3SGEI 3O3AA 5DEGA 5AX1A 2E7MA 4PI2A 5T1LB 4HIHA 5I74B 3HZYB 2F0CA 4WKXA 4WV1A 1ZVYA 2OP4H 2DLTA 3D39D 4P5KA 5SX4H 1I7ZA 3IGAA 3VXTA 1WD8A 5DJZB 4PUBH 3VFNB 2KL6A 3X1BA 2VWEC 3D3VA 1I9RL 4HC1L 3QCUH 1S2EA 2PR4H 2Y5TB 4R0LC 4FXTA 3RBGA 1EO7A 1OTUC 3ARTA 2O6EA 3QEGH 1DQMH 3H7LA 1YEHH 4I0CC 3KLAB 1YAZA 3EBHA 1KTDA 4UU9B 5LNDA 3NABL 3DETD 1JV5A 2DWYA 4M5YL 4RWHA 4X8XA 4JG0H 2VSCA 4AJVA 3FRUA 1GC1C 1HXYB 1UATA 4IMLA 1EXGA 3ME0B 1BFVH 3EFFB 4MMXB 3LH2H 3QWRA 5LVEA 1E27B 4HKBB 2Y00A 4N90D 3R06B 2YD4A 1HYSD 4N87A 1PD1A 3DSNA 4H20L 4N2LA 4ANUA 5FEBA 5E4EC 1C8SA 1NSNH 1SYSA 3QUML 4TNVK 3GMRA 5AHZA 1KZQA 1IEHA 3M1OA 4GI9A 4L3EE 4OBSA 2J73A 3ARBB 3VD9A 1R4XA 3N44F 1RMFL 2FK9A 2XVGA 3LCYA 3UBXG 2B4CL 2MQ0A 3ESUF 4H1LB 3WNIA 4Z6AT 2P80D 4WTXA 5AVXB 1MG3C 1OAZH 1KG8A 4D0CA 4X4YA 3QR0A 3B5TA 3QDJD 3RFMA 3MZGB 5CMAB 4DVBB 1HQ4B 3NY9A 4Z76A 3PXJA 4R90L 4D8PB 2FWOB 1K4CA 1IAOA 1KZYA 2OQJB 4RGND 2WYTA 3ZKMC 2ZCLH 4CC1A 3UZEC 4RA0C 1TT6A 4BXVA 3MCLH 2ARJA 1YO4A 1X4YA 1XTMA 2Z31C 3CHPA 4MA7L 5D2NC 1PLBA 4Z3HA 2R56H 4NC2B 4JR9L 2CCWA 3GIVA 3NSJA 4X6FA 4BE6A 3VXTB 1G7IA 5KJRL 3KG5A 5DMIL 5D2LA 2OSWA 5I0DA 3HKFA 4YDZA 1P7QB 5FM8A 2K8MA 4I18C 4J8RB 4GUPB 3BKCH 4MXQC 1J8HA 1T1YA 2CDGA 2B3RA 3NJXA 4HJ1A 3S88H 2OR7A 1TZIB 1O6TA 2MSPA 1MXGA 3U1SH 1PD0A 1RVFH 4IBQA 5DRZA 3DC0A 2QHLA 5K39A 3U2SA 4A7GF 2IH1A 2DOCA 2XACC 5F0PB 2DZEA 3IRZA 5TH2A 3S35H 5A8EA 2Y3NA 1KG0B 4ORGB 4DKTA 3REWA 2NZIA 4TSCH 4Z7WF 3NN8B 4G11A 1X4ZA 1FFOA 4NRYA 1BPVA 4XTLA 2B77A 1DFBL 2HWZL 4EJ1C 3VB9A 4KC3B 1FPTH 4O2EB 3ZOAA 2WHVA 4P5RA 2XPZA 1GL4B 4YC2B 4ZW5A 3RZCD 1QD0A 1RIVL 1KLFA 4HHAA 3W0WE 5J13B 4I89A 2YXVA 3Q44A 1NKGA 1NGQH 1UT1A 2BINA 5A16B 1S7XB 4UDUA 4M43H 3IKCB 3K2KA 3W1ZA 2LR4A 5HHOD 1Q94B 3EO0B 1N4XL 3GMPA 3QQ3B 4XNYH 3M46A 4P4KD 3TPUA 3IK2A 4BFEA 1Z2KA 1VENA 2YO3A 4NJ9H 4QGTA 3ATFA 1CBVH 3PGCA 4Q2ZB 1H3XA 3LPFA 4NKOA 4WEBH 3RNKA 1ZIBA 3HRPA 2XY1A 4DW2H 3EZJB 5LN8A 1N6QL 3PDGA 1V5JA 1ETZA 3I75A 1EEQA 1E4WH 3VFTA 2AXHA 4PRBB 3TBBA 1GJIA 2LW3A 3ZRFC 4JPWL 1KGYE 2AK4B 1T7ZA 2MIZA 2YXMA 2JIXA 2YCXA 2DLHA 3G5YB 5E2VL 5H94A 3RIFF 2ICES 1NCUA 5F7LB 1RJLA 2N56A 1J5IA 2XDHA 2AK1L 4B9JA 4U0RC 5HVHC 3K8LA 3GI8H 4Z7IA 3DO4A 1NC4D 4LOUD 4K5OA 1E3XA 4AXWB 2NCMA 3DETC 3I84A 4JG5A 2OK0L 4NO2B 1DSFH 1RULL 2PW1B 1RK0A 1MCRA 2YGPA 4JJOA 4YSTA 5TDOA 3X3FL 4E9XA 3LKPA 3N85L 1J5DA 2CR6A 3OLGA 2X4UB 1XIOA 3L2MA 4RMQA 5MI0C 4GO6B 4RFOL 3MV7A 3MNZA 3PQYE 5EA0L 2I35A 1RZKL 2R8SH 2V17H 4HIIB 5J6SA 3QDMA 3QUYA 4XMKL 5C3LD 1U8CA 4EZKA 1JHTB 1S7QB 4AM0B 9CGTA 4QWWC 1T4KA 4FLHA 4YHLL 4NRYB 1UGNA 2N3JA 4PJGB 1CFMA 4C58B 4R0LA 1QLFB 4L48A 3H9SD 4YIQA 5KVEL 2NLJA 4LMQI 4BZ1H 4U05A 4LXFA 3C9LA 3B9AA 2ED9A 3WE6B 5FCUH 1T66D 2CMRL 2E9GA 2XHNA 3D87B 3UX9B 3AG4B 4AQOA 2K4AA 4FRWA 5GJTH 5I6XC 1XGTA 2IQ9H 3KJ6L 4G1EB 1F58H 4JN2A 3M86A 5A16A 5JQIB 3DDLA 5F7HA 5CCJA 3TZVA 1OT1A 3QUHA 4FFYH 3MJ7A 3EG9B 2OV0A 3IYLW 2VSKB 3VXNA 2CBQA 2Z4QB 3LAFA 5DZVA 4QRPD 1IVTA 1EBPA 4JZJC 3D18B 5HGAB 3PWUB 4GRLD 3BDBA 1AR1D 1DUYB 3JVGC 3IRCA 1ODUA 2LTQB 4N9OB 1R24A 3RAJL 5HYJD 3KDPB 2G87A 2Z31B 3VXSA 1XTLA 3FSVA 5KYWA 2GBTA 4GINA 1F1AA 5D7IA 5C0BB 2AFNA 3F05A 5C2BH 3DO3A 5H2KA 4HWZB 1JXFA 3UG4A 4M6AA 4TOYH 1A9EA 1K8DA 3T0ED 1MJUL 2ZOWA 1M1SA 3BT0A 1R1CA 2WUBH 4BWWA 5ISZB 4P4KC 5AD0A 3C60A 4Q0XL 3SSGA 2IPTL 4QRYA 3LKPB 5HHOB 1RZ8B 1FNGA 4FTVD 4LCUA 3ZHKA 3PUUA 1V05A 3SQBB 1UXLA 3GHBH 5E56A 2HN7A 3DSFL 3EOBA 3ARWA 2NDGA 3V4PH 1AKJA 3KH3A 2FEDC 5LAPA 5FW7A 4Y5VA 3QUYB 4N0RA 1KMGA 2OTUB 1O5DT 3MLWL 1XH3B 3HJ0A 5DC9B 4MMZA 1TMQA 4FG4A 4OLYH 4AM0A 1OGAE 2NT0A 1K5WA 2VDKH 5CBEB 3BRDA 3PAVA 2D0HA 5KVFH 3CN4A 3DX2A 3Q5YA 3EFOA 3K1DA 4HCRL 3TCLA 4PJGA 1FZJB 3DX7B 2CUMA 3AMLA 1BA9A 4P23C 1CGSH 5E9DB 4DGYH 4DGVH 4TPRL 1C12B 5DHVA 1DN0A 3MLUL 4MD2A 2IALA 5GS1B 5FKPA 2GB2A 2YAOA 3INUL 4S1RL 3ZTCC 5LWEA 4KNTA 4BSWA 4AGLA 1CZ8H 2BNRD 2X3BA 5DO2C 1ZK5A 4H8QA 4DOHE 2F93A 3ETBJ 4YHYC 1I8AA 3MTXA 3UTSA 4UIMB 3STZA 5JJEA 4XN5A 4XO3A 3H2WA 1QVOB 3QORD 1QEWA 4X8CA 2ICCA 1I3UA 2Q6WB 2RGSA 4GG8A 4WJG3 1QI5A 3S36H 2ZWZA 2CHNA 2PYEA 2KSAA 1S5IL 3AITA 2JLPA 4ZUWA 5AYUH 5GSVA 4DGUA 2LQRA 1L9MA 1I9JH 4G3YL 3FQWB 4UOW0 2F08A 4QKTA 4GJTB 1GTNA 4JO3L 4K3DH 3RUGA 3DX0A 4YO0B 3BPCA 5CBAA 3QO0A 1RV6X 5BUPA 5IBTL 1DBKL 1E6OL 2VJ8A 2R0WH 4GRMA 4XZUB 5C0BA 4GP8B 1BIIB 3U4BH 7TAAA 3VG9A 1JFQL 1ZD6A 2VLMD 4HWZA 5CCGE 2HMID 1LP9E 3BN3B 2DWXA 2CO4A 2ZD0A 3QZNA 1J12A 5K93A 2P5WB 2JCCA 4GFXA 4DUVA 3WLBA 2EDJA 4ZNEE 4U31A 4NSKA 3I6GA 3SQBA 2A0LD 3U6XS 2E86A 4AVJA 3N0AA 1WV7T 5D6DC 5C0EA 3VU2A 4R3SA 4KFMA 1CLZL 3N1GC 3WFCH 4HOMA 4JFPB 1AKJB 1IZKA 4TSAL 5T1MA 4ZFFA 3APMA 2V0AA 4Y5VB 4NJ9L 4FC3E 1JMZA 5KW9H 3ARZA 1XCTB 4OZHF 3N43F 3GKWL 5D5ME 2ZAHA 5BO0D 1QSED 1NOLA 2AJYH 4NUQA 2D3NA 4F33A 2I07B 1WSST 5TPWH 2GSGB 3SBWA 1JHKH 1GAFL 5CWSB 3EXJA 2CR3A 1RIVH 3EUUA 3TESA 4UAOC 2WVUA 3T0EB 5DUPH 2ITEA 4UQDA 3IJYA 1AS7A 3EDKA 5GGTL 1KMEA 4JDVA 3E9TA 5FF6B 3QJZA 2K8QA 5KBPA 4PQXA 2I85A 2V7NA 3M07A 1OO2A 4GIAA 4N4WA 1MJ8H 4X9HA 2R15A 4DP6X 5F9OL 3FFOA 4JFOA 1FZMA 1VGKA 4AW4A 5IJBC 3N43B 3FOLB 2UZYB 1PZ5B 4WI3A 3ZO9A 1IW9A 2FATL 3CZNA 3O8XA 4L3CA 4AYFB 4NDMB 1JUFB 2Q8BH 1NFAA 4NQVA 2LFEA 5I75B 5IR1A 5JPNB 2PYEB 5GSVB 3S0PA 4Y16A 4X8JB 5EOCJ 5H2IA 1KJMA 3ROOB 2DYSB 2AZUA 2FEEL 3KHOA 3GHBL 1GZHA 1J11A 1OXYA 1UM6H 5CFHA 3FN9A 3HRZB 2WM0A 3IFPB 1P4IH 2Y6TE 1G0XA 4ZNCD 4NIKB 5CBAB 3JQOB 4X7SH 5IWLC 4AVHA 4AKQA 3SKOA 1LQBC 1HXKA 4HUCA 3QG6A 3NCFB 4EIBA 4YHOH 1QSFD 1O6VA 3PWPB 4PWFA 5IROD 2HFFA 1X5YA 4FQLH 1QTSA 2YSTA 1KEGH 3HB3C 2X7LA 1YAIA 3DHUA 4NFCA 4G9FA 2BVOB 4OJAA 1NPJA 3V4LA 2YPLD 5DZLA 4KROB 4F80A 4RGOH 2XRAL 3FH8A 4UZGA 4KQ4H 4R3SB 2VLJE 5D1QD 2I9TB 5H2PA 3MRGB 4YPJA 2A9ML 4NP4H 2WMPB 1PSKL 3QIBB 4IIQB 4F7CA 1ZY9A 5D7LE 4LLMB 1PZBA 4YUEH 1J5OH 3TIEB 2FLBT 4EN3B 2CA3A 2ICWI 4QUOA 4Y2DA 2GFBB 2JE8A 2FH6A 1E28B 5IBUB 5KZCB 3GXMA 2CKBL 1EJOH 1VFBB 2JELH 1YJDC 2NT1A 3FO9B 5DD3H 1BZEA 2AXJA 5BOPA 1NC4B 3LY6A 1YPZF 3REYA 2V9TA 2PLTA 1G43A 2ED7A 4LLAA 4MQSB 2MOQA 5DZ9A 2ZF8A 1FGNH 2V2WA 3ILQD 4YS4A 3BT2L 4Y4KA 1TFPA 4XPBL 3REVB 2P8MA 3HR5A 4HS8L 4HKXB 3LH8A 3V8CA 4XWOC 5AW5B 3O41A 1Y6KR 3APCA 4X80L 2XBTA 3MJ9H 1KIRA 1N6UA 1E8WA 3MRKB 2WD0A 1JGIA 3UTZB 1P5UA 3UBFA 3VWJA 5DMGC 1HN1A 2WQXA 3X3BA 2XWEA 5F9WB 2IPUK 5BS0D 5B4MD 1FQ9C 2ESVE 1KXTB 4G8IB 1FNEA 1D5XA 1Q9KB 3VGGA 3W9EA 2AJ3A 3E6HB 1I1FB 2CD0A 1S7VB 1N6VA 2HKAA 4F20A 4TSAH 1S9KC 1N12A 5B1CA 5EOTA 5I1KL 1J9RA 4BSVA 4I88A 3RPIB 1JGUL 5KS9E 3V0FA 1IM3A 3GNMH 3U7WH 1YNTA 1LO4H 5KYXB 3J7HA 1R3HB 1XJIA 1S3RA 4DZ8A 5KG9B 3KR3L 1QFWL 3KJ4B 1THCA 2EILB 3DV6A 4FQXC 2VKXA 2VDMB 2XV6B 3QQ4A 4NWUL 3FRPG 1TPXB 4U4IA 4JRXE 4N2NA 4B9FA 1RZ7L 5TPWL 5K59F 2VIRA 2W0FA 1QFHA 3LV3B 4QDGA 4Z95L 2IMNA 5J11C 2BVOA 1XBDA 4BGDA 5LO7A 3AXHA 1D5IL 4NENB 2DAVA 1I9IH 3MA9H 2DQCL 2J4YA 1I53A 2B1HL 4DQAA 4JFFE 4GKSB 3UCRA 2V9UA 2VR4A 3WEBA 3LXCA 1IGML 4S1DC 4B9CA 2AJUL 2J3SA 4ZX4A 3KJ6A 1E6JL 1HKLL 1XF4A 2WLZA 3DV4A 3MRQB 2E7LA 1IAII 3QIBA 4IIQA 3NA4A 4HKZA 3A24A 3LNEA 2H45A 2QQKL 4LLMA 3VG0H 1A9BB 3OTTA 2ITCA 4ETYA 2JXMB 2NY6C 5ISZD 2FBOJ 4LRIA 5FO7A 1C5DA 2JJWA 3UTQA 5IQ9A 1EZSA 2NYYC 4R96A 2WJKA 3SN6R 4N2EA 3OWRA 1UEYA 2BOLA 2O5XL 5L4JA 5CGTA 1CDGA 3DX3A 4AKPA 2XIBA 4G9DB 1N0LB 3CC1A 5GRUH 2F53D 4IRSA 1JZFA 2P8MB 2QPUA 3NH7H 4WFHD 5EC1A 4XNDA 2BFVL 1E7VA 1KIRB 4FQCL 2F8XC 4KK6D 1A47A 1NCNA 2FO1A 5MERB 5A2IH 5I2IB 3C08H 4ABVA 1S5IH 3I9PA 4TNVF 3WGVB 4KAQL 2C8NA 3PWPE 1F4WL 4G8IA 1FNEB 2K4WA 3ARGC 5KSAA 3WNJA 3NY8A 4J3XA 5J06A 3KW8A 2WTRA 5D7HA 1JGDA 3MTRA 1TYRA 5C0GA 1WQVT 1SQMA 4D9RE 5C0CD 1OTSD 1BVLB 2ITFA 4M6MH 2CBMA 2YD0A 5AKVA 2NY4B 3POHA 5EMYA 1R3IH 1SNRA 3ZW3A 1Z9SA 2HG5A 1BM3L 1JJUA 2G3NA 2DJ4A 4NRXB 1BYPA 4R7NB 5MEPA 3MYJA 1TJGL 3GYRA 2AW2A 2PWEA 2R56L 4EI0A 4N6HA 1A2YA 3FULA 2Y03A 3KPMB 5KANG 3L3IB 5K1NA 3ARFB 1T7VA 2H0FA 5DQ9A 3EJJX 3BEWB 1BZOA 2VZOA 5CJQL 4XN4A 5LXVA 3S37X 4R4NC 2G9HA 3TBTA 4CBPA 1LO3L 3MXWL 1DE4A 1GU8A 3BUBA 1AJ7L 3QR2A 5AVUB 1H3UA 4K8RD 5B8CC 2HX9A 5IFJA 4EDXB 4GRLC 1V3LA 3LQAL 1QKOA 5E1AA 4P2OB 4WJ5A 3L5JA 5CLZA 3II1A 1TKWA 1X0I1 2FD6H 1U4FA 4KFZC 4QOKB 5IQ9B 4XVJL 4Q9RH 1NLBL 4UOZA 3ALWA 2P5WE 1TVHA 3GJEA 3QUKA 4X7DC 4HJTA 1U36A 3BWAA 4NUPA 5KSBA 2DWTA 1HNYA 4N9GB 5IKCB 5AW8B 5JQ6H 3CH1A 5ACZB 1DVUA 3QG7L 4HUXA