3QJQB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjqB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjqB02
1M9WA 2WJKA 4K5YA 1NPNA 1SFHA 1IBYA 2YAOA 3V9EA 2DY2A 3NJJA 1JOIA 5H2JA 1BEXA 1BM1A 5D4HA 2IDFA 1VJMA 5JJNA 3S3DB 2XV3A 4NC3A 1RKRA 4WTQA 5A7EA 4KO6A 1KV7A 5H2MA 1WS8A 3UG9A 2BHFA 3CDZB 4XTLA 2P80A 4YVUA 1OE3A 5B0WA 4QLWA 4HAKA 2YAQA 3T45A 2FT7A 2BW5A 2UXFA 1N68A 1X0SA 1OE1A 1GYCA 2B3IA 2L6XA 5A44A 1GU8A 2YQBA 3T9WA 5I6NA 1KDIA 4DPCX 3CVBA 3HEIB 3X1NA 4GP5B 1J9TA 1V54B 1PLAA 4BUOA 1AZNA 4X31A 1HAWA 2AFNA 5AX0A 1MDAA 4UF7C 4YVNA 2H47C 1URIA 1AOZA 1E5ZA 3MX0B 1PNDA 1JV6A 2YCYA 1F4ZA 4GRVA 3SBPA 2Y1AA 4YSEA 4PCYA 2XX1A 2I21A 5B1JC 2YAFA 2F95A 4LDEA 2I20A 4GYCA 4BVNA 5A8EA 3AY2A 5IY5B 4BWBA 1MGYA 1PZCA 3H56A 4QIDA 4JR8A 5EN0A 3UZCA 5JJEA 1C8RA 2HX9A 2KSAA 5TK4A 3MBVA 3KW8A 3OQRA 1V10A 2RACA 1M0KA 4E9RA 2ZONA 4AX3A 4E9XA 1GUEA 9PCYA 2UX6A 1PY0A 3X1FA 4BEZA 1J5DA 4BWTA 3H4HA 4DPBX 3T6VA 5AWZA 2M3GA 1A4CA 5B7MA 2R7EA 3VVKA 1AP9A 1HAUA 1PXRA 2DYRB 1M0MA 5B6VA 2ZWNA 1M56B 3DDLA 1GS7A 5B34A 2AVFA 1BRRA 3OMAB 4N8UA 2YXVA 3S3CB 1N70A 4YSQA 4BDVA 1S8LA 3DIVA 2HLEB 2IDQA 3PCYA 1AANA 2XVBA 5H2NA 2EIKB 5AFAA 3NSYA 1IW9A 3UTYA 1JGJA 1L0MA 3ZPQA 2HRHA 4HZ1A 3QDCA 2FTAA 1TN0A 2GI0A 4BK5C 1CC3A 1MZYA 1MG3C 3WKQA 1NICA 3IN0A 4YSCA 2J57A 3D12B 2GIMA 1E67A 2R4RA 4EJ4A 3QPKA 1UCQA 4IAQA 2PP8A 4DP4X 3QJSB 1ET5A 4MFHA 2YAHA 3OAXA 2BWDA 7PAZA 3G5WA 1OCCB 5I5MA 1PXSA 4NB7A 1X9UA 4JHUA 1H2SA 2VW4A 2W8CA 1SF3A 1NIFA 2AZAA 3FYIB 1XJIA 2IAAC 2BP8B 5I5IA 1IUZA 3ASOB 4OV0A 1S53A 2ZIYA 1AAJA 1IXFA 2Y69B 2ZOOA 1QKPA 3AYNA 5ETZA 4XT3A 1L9RA 3RYMA 4TL3A 2PPAA 4G70B 3WG7B 4MD1A 3VW7A 4KOCA 5AZUA 1UAZA 4JHVA 4P5RA 5I6OA 5D4IA 2HZHA 3NSBA 2QDWA 3JTBA 3NT0A 3QAPA 5H2OA 1RZPA 3WIAA 3TBCA 1W8EA 1OCRB 3AG1B 1M57B 1XIOA 2QT6A 3WNJA 3NYAA 2IDSA 1AG0A 1ASOA 4KLYA 3FU7A 2JFCA 6PAZA 2E86A 5B6ZA 2FT6A 1QNIA 2VMJA 4KNUA 1KDJA 2EI4A 4L0PB 2JAFA 1JXFA 4YSDA 4AMJA 5I26A 4YSPA 4W9ZA 2JAGA 3QJVB 4KNFA 1TEGA 1XB8A 2I85A 3ABMB 4AZUA 3EH3B 1JZFA 3NP3A 1WS7A 3D4SA 1OV8A 1RZQA 5H2PA 1XB3A 2UXTA 2JXMA 3UTWA 3QJTB 5B6XA 4X32A 3OMIB 3EHBB 1AG6A 3KJ6A 4JKVA 5G28A 2GBAA 2TSBA 4N4YB 1J9SA 2P80D 4HALA 3ZDWA 1L9HA 5AHZA 3PXLA 2GSMB 4CSPA 5LDUA 1X0K1 1PLBA 4KNSA 5B1JA 1XB6A 4F7KA 2FQDA 3NY8A 2YCZA 2FQGA 2Q5BA 2WO3B 2Y00A 1NDTA 4JQ6A 1NWOA 2OJ1A 1S51A 5BR2A 2R4SA 1BQ5A 2KS9A 5DYSA 1YLBB 2GC7C 1WA2X 3ZPRA 4XTOA 2CJ3A 1DYZA 2HX7A 1L9QA 1P8IA 1B3IA 1VLXA 4DP8X 2QDVA 4A66A 2Z73A 1HFUA 5B7EA 4KO5A 3CVCA 1ZDSA 1ZIBA 1CUOA 2JKWA 4XT1A 4X4KA 1JXGA 1O0AA 3TU6A 4CSZA 2KSYA 3COCA 3BVDB 3UTVA 3NJIA 1S52A 4YL4A 3NJMA 1PNCA 1J5CA 4F2EA 1IC0A 2YAMA 5LWEA 4E9VA 5I6MA 1L9OA 1BQRA 2XXGA 1BQKA 1JZJA 3U25A 4YSAA 3C9LA 2YCWA 1OE2A 1SF5A 3CDZA 4L6RA 2YAPA 2YDOA 3REYA 2BZ7A 1PF3A 2N0MA 2X72A 4E9QA 3S8GB 5H2LA 5G54A 1X9RA 4DP0X 1QHJA 4AMIA 2FQFA 4DP7X 3QBIA 4DP5X 1KGBA 4MQTA 3WQJA 1NPJA 1E0PA 1MG2C 1PZBA 1IKOP 4YSSA 2FNWA 4A2GA 2Y01A 4MQSA 4ZK8A 1OCZB 2Y04A 3RFMA 4A4MA 2CUAA 2PPCA 3NJLA 3OMNB 3T6WA 5H2HA 4PXFA 1KBVA 2HXAA 3HAPA 1ZPUA 3IEAA 2I7SA 3ZX1A 2R7EB 1AZRA 5G36A 4BXVA 1ILUA 4AKQA 4BEYA 2AANA 2YCXA 4DJHA 2I7OA 3OD3A 4G7RB 2UXGA 3CG8A 1PY6A 3QQXA 2XV0A 1CYXA 4HCIA 7PCYA 2PPDA 4UG2A 1GS8A 6PCYA 1JZIA 2WSDA 1LN6A 1PZAA 3EF4A 4E9TA 1FBBA 4N6HA 3OM3B 5J7AA 3AG4B 3NSDA 1SJMA 4HIPA 2DV6A 2BRDA 1KBWA 2H3XC 3ERXA 5F7BA 2J5WA 4K9JA 2AT9A 1TKWA 3UZAA 4FA7B 1PCSA 2OV0A 3FSAA 3AYMA 5B1BB 4HHGA 3WKPA 4Q8BA 3ZBMA 1VGOA 2J4YA 3FQ1A 1Q5IA 4GBRA 4W1TA 1R1CA 5F7AA 1ID2A 2KSBA 1A65A 1KGYE 1GY1A 2FQEA 2ZXWB 4F2FA 1AS6A 2PEDA 1T5KA 3TASA 5PAZA 3UAAA 4IB4A 2I1XA 2VW6A 3CVDA 3ZIYA 3FPXA 4L35A 4E9SA 3TA4D 4N4WA 2PPEA 3UTXA 4E9WA 3ODUA 4Q89A 4DP6X 1DZEA 2NTUA 4GY4A 4M3HA 3QAKA 1ADWA 4A2EA 2TSAA 2VSMB 3BQVA 5I5JA 3X1EA 4PXKA 1TEFA 5AHYA 3QBLA 2DWTA 2EIMB 3HB3B 2CCWA 2IH8A 1QLEB 5B1KA 4HCFA 4YSUA 4UAHA 1P8UA 3C9MA 4A68A 4J4QA 1SDDB 4Y9HA 5G53A 4FAAB 5E9NA 1GS6X 1BYOA 3NYKA 2XV2A 1FA4A 1R2NA 3V2WA 1SFDA 1BXVA 1IW6A 1L9SA 3EH5B 3OE6A 4G71B 2HX8A 3HAQA 1TU2A 2GHZA 5B1AB 3VGAA 1OOWA 2PPFA 3NJKA 3AZUA 3OE9A 3OE0A 2BP0B 1SHWA 3UACA 4BWWA 3T6XA 4KO7A 1GW0A 1ETJA 2EINB 5FJGA 2LLNA 3CODA 2FWLB 3UAEA 2EIJB 1NIAA 2NRDA 3GXUB 4DPAX 3IBOA 2LNLA 3NY9A 3FPYA 4HYXA 1RCYA 5G2AA 3FU9A 2BWIA 1JZGA 2BZCA 4KOBA 1NIDA 1QKOA 5B6YA 2QPDB 4BXSV 2VM3A 1EHKB 1F56A 1L9TA 3N2JA 3PBLA 2PCFA 1C8SA 3C75A 4A2FA 1R84A 3IN2A 2XX0A 3FQYA 1NWPA 3X2QB 3X3BA 1ILSA 2IWFA 1MZZA 4HHWA 2PP9A 1H68A 4YSTA 1KCBA 3SBRA 2YXWA 2ZZLA 3FS9A 3DQBA 4A2HA 3ABKB 1AZBA 2Q9OA 1JZEA 2DWSA 5AX1A 2IDTA 4GP4B 4X1HA 3AW5A 4AI7A 4GP8B 3QBGA 3PPSA 1ET8A 1ZIAA 3HARA 5ANHA 4WW3A 1E30A 3S8FB 2PLTA 2HPYA 3H4FA 4JKNA 3RZEA 2WO2B 2OCCB 4YSOA 1ZDQA 1U19A 2W88A 3L45A 1F50A 4FBZA 5B6WA 1UATA 4GXFA 4HYJA 3DKHA 3ABLB 5I6KA 2VSKB 1BRDA 4EIYA 4QI1A 3NJHA 2MRYA 2Y02A 1FBKA 3NSCA 1WA1X 3TBBA 3FSWA 2BW4A 2CALA 2Y03A 1F88A 5B35A 5A45A 5JJJA 3PAUA 2XLLA 2PP7A 3T71A 4EF3A 1AR1B 1CYWA 5G2CA 3NJFA 5ITCA 1V55B 2RH1A 5H2KA 5H2IA 2CBPA 1PAZA 5AKRA 2Z55A 1PLCA 4E9YA 4NAJA 3V9CA 2VW7A 4YSRA 3ABGA 5PCYA 5F8UA 1A4BA 4BDVB 5I28A 2YAEA 1A8ZA 3NJNA 5EHFA 3FT0A 3PAVA 4ENZA 2AZUA 1CURA 1BAWA 2PCYA 5DHGA 5TGZA 4IARA 1S8JA 1GSKA 1A4AA 3QBKA 3PWHA 3T6ZA 3NSFA 4HCGA 1BRXA 4KNTA 5FC9A 3PAZA 4GPOA 4DP1X 3P0GA 1KYAA 2NTWA 1KG8A 1NINA 3DTUB 2UXVA 1P8HA 3HASA 2F93A 1JZHA 2J56A 1FFTB 2IH9A 5ITEA 1GY2A 4RH4A 1J9RA 1AZUA 5G2DA 2EILB 4WAVA 4PAZA 4A2DA 4KO9A 3MBWB 2XUWA 3CZUB 2I35A 1AZCA 3VG9A 3GYRA 1M0LA 3X1BA 1AIZA 3SQRA 3HAOA 4DP2X 1IBZA 1NIEA 1AACA 1ZV2A 2VN3A 4XXJA 1S54A 1GR7A 5BR5A 1NZRA 4UHRA 1W6WA 5B2NA 2CAKA 2VM4A 3FQ2A 1ASQA 1NTDA 3FSZA 4WKXA 1ASPA 4G72B 3V2YA 1FWXA 1SHXA 4NERA 3QJRB 3VI0A 3PDSA 1E65A 4MD2A 2IWEA 4M4RB 2X87A 1ET7A 3FYEB 1PMYA 3UGEA 1WAEA 3FU8A 2MTAA 2GB2A 4DP9X 4FPDA 4G7QB 5KKHA 3QJUB 4AKPA 3N55A 2X88A 4A67A 4DKLA 1XMEB 3S3BB 2BP8A 1W6LA 2IWKA 1HZXA 5TK2A 1BXUA 3NP4A 2WJLA 1CWQA 1EZLA 3FU7B 3HANA 1E5YA 3ABWA 4BV0A 2A3TA 3EH4B 1JV7A 2ZFEA 3A7KA 1BYPA 1JERA 2G87A 3OE8A 4XTNA 3FSVA 2XYBA 1E12A 4MBSA 1OF0A 4UANA 4EA3A 3QJQB 1WA0X 3PQRA 5C1MA 3SN6R 2XXFA 4DAJA 5B7FA 4QKTA 3NJGA 1AS7A 1OCOB 1BXAA 1JXDA 3VHZA 3WNIA 1DZ0A 5B3SB 5I6PA 3NS0A 3JT2A 1L9PA 1I53A 2GC4C 3KW7A 2XU9A 1SDDA 3WI9A 4LDOA 4GYBA 1JVOA 1C3WA 1X0I1 1KMEA 1GZMA 5D4JA 1AT9A 3UADA 4TXVB 1TN5A 4HWLA 3SBQA 1JVLA 3AG2B 2UX7A 3AG3B 1QHQA 2H5UA 5I6LA 4G7SB 1Q5JA 3GDCA 2J55A 5DHHA 5AZDA 2HRGA 2QPEB 3X3CA 2BO0A 3ASNB 4BWUA 4QRYA 1A3ZA 2FJSA 2B08A 8PAZA 4P5SA 1AS8A 1SNRA 3UABA 3UONA 2BP0A 1QM8A 3EMLA 1J9QA 3X1GA 2YARA 4AKOA 1NIBA 3IE9A 4LDLA 2FT8A 2YDVA 1KG9A 3ZEVA 3CAPA 2IDUA 2VT4A 3PLYA 1AQ8A 1KCWA 1JFPA 3AM6A 2DYSB 3PXOA 2XWZA
chains in the Genus database with same CATH superfamily
2NYYC 1RJLA 1A66A 1WGOA 2Z65C 2VLMD 5H2JA 3KM1A 4IBZA 3RVXC 3S3DB 1TG8A 3QQNA 1P7QA 3VWJD 5A7EA 1LM8V 3BUIA 3ZDZF 3TA3B 3UG9A 2X6BA 3WN5A 3EGDA 3PWVB 1E9OB 3FH7A 3SE6A 1AE6H 4XOEA 4HIXH 1T21A 4JPSA 3NCYP 1P6FA 1QLEH 1OHQA 1OQOA 4KMQA 3SDXB 4ONFH 2XBDA 1M05A 1BYNA 1QFWM 4U1GB 3ARBD 5GGVL 2XWDA 2H47C 1S9VB 2FEDD 1P0SE 1F4ZA 5FGCB 1KN4H 1DR9A 1PYWA 1TJMA 2VLRB 1BIHA 1A6VL 1J8SA 4OTXH 5IY5B 4BWBA 3CN0A 4QGTA 3TIEB 2W9EH 1WFMA 5IB1A 5BXFB 1B0GA 1GGYA 5LQBH 4UUJB 1R3IH 3KJ6H 4R8WL 3TIDB 5C07B 5LN8A 5D2NC 2JCCA 3WFCL 1U8PA 3GIVB 3VTAA 4W4OC 1EZVX 1J5DA 2FBOJ 4ODHL 3OZ9H 5EBMB 1A4CA 1AVAA 1PZ2A 1RZKH 3TFKC 1R47A 1ZJAA 4HHAA 4XP1L 2O72A 2WWKO 4A04A 3SGJC 1Q38A 4J39A 1GAFH 1EQWA 4Q58C 5AFAA 5L9DL 3QR0A 2HFGL 3CUPA 2M1KA 4F33B 5FYLL 4YPGA 1BZEA 1PQZB 4JFOB 1ADQL 2IANE 4GXVH 1RVFH 1MW0A 5LBVA 5CKGA 2VDRL 5IKCA 1QKZH 4L1LA 4QHUA 1FH2A 2D03L 1FYTD 2D8KA 4R7DB 2N1KA 3AREA 2GKIA 4HKZB 3FO9A 3I9GL 3UROR 4YFDB 4QXUL 1P4IH 3ZVVA 5D4QA 4URKA 3DOHA 4UTBL 1EHAA 4AC4A 3QFDB 1R3HA 1PKQB 1WIPA 3EW3B 4RGMB 4GAGL 5I0WA 5CFHA 3AXLB 1L9RA 3TNNB 1G84A 1MCWW 4HJSA 1SQMA 4QRQA 3SQOL 5IR1A 1U8OA 2NTFB 5K1JA 2Y07H 3F12B 5T1LD 2WQSA 3BD3A 4FNLL 4ENEC 4P2RB 4ADIA 4LSUH 4GMSH 3ZE2F 4Y9BA 4ZS6D 1R3KA 3Q3GA 5C09E 1Q90A 1RLWA 2ZUYA 3JYBA 4PRHA 4PH8A 1XIOA 1I8LA 4H8UA 1MLBA 2Y5TB 1DFBL 2RMNA 4W81A 2OLDA 2EI4A 3HC3H 2FIKA 3OKOB 1WCBB 1S7VB 4XMTA 4PJDE 4ZQTA 4KQ3L 2A1WL 5D1QB 3K2UH 4YAQB 2FHFA 2BP5M 4KKNA 5D96C 4DERA 2JXMA 4LLQA 3RWGB 3QB7C 4Y19B 2CO6B 3MLSH 4G6MH 2GCYA 4XN1A 3T0DA 5D71L 4L1HA 4JKVA 3ZT6A 1RJCA 4FQJH 4W6WB 1HCYA 3GZQA 5AHZA 3NCYS 2XFGB 4A63A 2A6JB 3HZKB 1MJUL 2OYKA 4ZXBA 4X5PA 4KDTC 5KVDL 4JDTH 3U0WH 5BZDB 4NJAH 1CR9H 1IGCL 1OPGL 4PD4K 2XCMC 5MENE 1S7WA 2AGJL 4J6RH 4R7XA 1P5VA 3IK2A 3DRTB 3IU3A 3B2XA 2CJ3A 4G6FB 1PS3A 2O6CA 3JV0A 3P77B 2OK0L 5FYLH 4S0HA 2A6IB 2FB4L 5LNGA 3V4PL 3VSVA 4QHPA 4PYHA 3OKYA 5B39B 3IGAA 2BNRE 2N59A 3UJIH 1QSFB 4JRXE 3RDTA 3BAEH 2FX9L 3D9AH 3MJ8A 4BK8A 2K1MA 2EP6A 2YIHA 3LEVL 4G6JL 1BFTA 4HUXA 3U4EB 4Y2DA 1G7HB 5AKVA 2BC4A 3F7QA 4UIKH 5IHHA 1F4XL 2YAMA 3BP5A 2ARJQ 1XSIA 4CVXA 1IGJA 5T1DL 3RI5K 5IVXA 3MRBA 2EDJA 1S3KL 1PF3A 4PCKA 2NLJA 1RUQH 3S35X 4KI5E 1F6AB 1FJ1A 2APFA 4MAUH 3SQOH 4O9HH 5E4OA 1E27B 1LO3H 4XOBA 2LU7A 4PJBE 3HE6B 1NGXA 1FNHA 1MCRA 4OFYD 3SEPA 2Z35B 1FFPB 3B56A 3KZ8A 5KBDA 12E8H 2JB6B 3BN3B 3G6AB 3FTVA 1NAMA 4CN6A 2KL6A 1JRHL 3ZDYE 3CVHB 3IEAA 4WI9A 2C1OB 2X05A 1T03H 1DFBH 2ZKWA 4POYA 3LRSA 2NDFA 3VRIA 1OGTB 5IQOA 4GT7A 3DTXB 1VFBA 1A14H 4Y4KA 1PY9A 1KN2H 2A1WH 1UJTA 2OA9A 3BPNC 3RGBA 4Z7VF 3RX9A 2CLRB 4KJQD 3R7QA 3UAJA 2BXZA 5SWSA 2VC2H 3K6DA 4DZBB 2VZ1A 1MUJB 1TJHH 2GEEA 1EEZB 1AC6A 4JY6A 4RNRB 2YSSA 1S7RB 4AYDC 3FSAA 1TOXA 3PJSA 4GSXA 1IL1B 1RZFL 4GSDH 3MUGA 4JKPH 4YHOL 3VFVB 1TQWA 2QHLA 3QJFB 3VXUE 2J4WL 3FHQA 4JY5L 3FQ1A 4OF3A 5D7LA 4PY8I 3UZEC 4UV4H 4PRDB 4M9PA 4PRNB 3VA6A 1BVLA 4JRFA 5MERA 3CLFL 3Q7JA 3L9EA 4YBLC 3ZIYA 2GTWA 3FPXA 3QXAA 3ECUA 4AIZA 3MV8A 5FEBA 1IEHA 5BCAA 3WTTA 2Y36H 3GHBL 4U0RB 4BSWB 3O81A 4M5TA 4P2QE 3K4DA 1CF8L 2FX9H 3HS8A 4PJGB 3VTTA 1QVOB 2VLLB 3QIUD 3MRFB 3C2AL 3BKJH 5HVHB 5C6PB 3OLIA 4JAMA 3ZDXB 4GKZA 1U33A 1E7VA 5DFTA 3NGBB 4XNDA 3L08A 3Q13A 5G53A 2V5SA 5KVGL 2LT9A 3BVVA 4JGMA 1KT2B 4KKBD 4QOKB 2GJ6D 2KC0A 1ECYA 2X4RB 2HMIC 5IROC 4OD2A 4TRPL 3KLAB 5GXBB 4A1RA 1C8PA 2W9DL 4FTVE 4IRSD 4TUKL 1A6UH 2ED8A 2QZQA 5JQ6H 1DLFH 4YDLC 2VZ3A 3MCG1 1SPDA 3OE9A 1TQCC 2HKFL 1SHWA 3FO1A 4XPHH 2F5BH 3MMEB 3SIKA 1KB3A 1FV1B 1ETJA 1E50A 1PEZA 4AV4A 2QKIA 3ISYA 3WS6C 4JPIA 4OBSA 3QRBA 2O6FA 3U4BL 5I9QC 5BOJA 2IAMA 1K3IA 3FH5A 5E6IA 3ET9F 3TJPA 2HJFA 1X44A 2CZNA 2BZCA 5DD3L 1SVCP 3DX8B 5T3ZE 3BH9B 2VGLM 1AGEB 1S78D 1T6WA 3NZHL 3B2UC 2G3XA 4XNZB 1D2OA 1C8SA 2EIEA 1EO5A 3IWVA 4LOUD 4YLCA 3KLHC 5EC1A 3LQAC 5J6SA 5FO9A 2NY1D 3F00A 3DMMC 4U2YA 3WLWC 2LFGA 2WKGA 1I3RA 5DMGD 2H1XA 3QO1B 4NAMA 4YQXH 4K94L 5E9DA 5HYFA 2H26B 5CP7B 3QAZB 4GG6E 1VACB 4FZEL 3F7VA 3SKJL 2ILLA 5CEZL 4L8BB 2Y1YA 5M7QA 2HG5B 3L4VA 2H9GB 2DPKA 4MD5B 3DX1A 4YHLH 5C0GA 5IFHL 5KBLA 4KTDL 2BS71 3V0AC 5ANMA 2WO2B 4LDEB 2OCCB 1N18A 1UWGH 2FLRT 1E9PA 1ZDQA 2J1WA 5KSVB 1UXWA 3GSNB 5B6WA 3L3IA 5ITBL 2C5DC 1N0LA 3GHBH 4MCYA 4DUXA 3EGSB 4TQHA 2O1AA 5ICZB 1TPXB 1QLRB 3DURA 1MRCH 4P23C 4DGUA 5EO1A 4IU2A 5C07D 4EKJA 1WA1X 2WVUA 2WN2A 3QUGA 1CFVH 1NUGA 1YY8A 5E24E 4W93A 1ZHBA 5F7FA 1A7RH 3V5DA 3C2AH 3LN5A 1TYEB 4YE4L 1AR1B 1I7TA 1OKEA 4BQBA 5G2CA 1KLFB 4PWJA 1CF1A 3GRWH 3GMRB 1CT8B 4Y5YC 2Z55A 5AOIA 2IBZX 5F7UA 5DRNB 1JK8B 2YD9A 3FF7A 4FNTA 5KVGH 2P52A 5DT1H 3LIUA 2R51A 3L5XL 4JO2L 2Z3FA 3N1QC 5D8JL 3SDAD 4GXUN 5LGYA 3UP1A 1GHFL 1LMKA 1XAKA 1BAWA 2PR4H 1U0QA 4XMPH 2ZSVA 3KL5A 2F15A 1ZGLM 2J88L 2DKMA 4IOFD 1IC5H 3TV8A 1GC1L 5CCKL 1P8HA 3FKUS 1RIVH 4K2UH 4NUQA 3VVVA 2ZOWA 3AXHA 3E6FB 3AU0A 1XH1A 5FCUL 2M83A 1BV8A 4KHTL 5HJDA 2G5BA 3NIGE 3AACA 4U3SA 4PJIA 3GYRA 1BVNP 5J3HC 3APDA 4G1MB 3RWDA 3ZR5A 4F7CA 1X7TA 3NA9H 2AJSL 4ZPTB 5F7LB 1BSIA 1OF2B 2VN3A 3U7AA 4NXSA 5HY9B 3TJEL 2CAKA 1U8NB 1ASQA 1BX2A 4ALAH 4HFUH 4QT5B 4AQ8A 3W38A 2NUTB 4IKNA 5E23A 1Z3GH 2AV1B 2NZ9D 2NQDA 5DO8A 4D9LL 1P1VA 5HI5D 4YIQA 4EOWH 4NZTL 1ET7A 1MCIA 3GXFA 4X42A 1IFGA 3BSZL 4DP9X 3GXTA 2ZE0A 3NTCL 1QFWH 3SKJH 4FZEH 2HLAA 4QCIB 1F4YH 1CGYA 4YWGH 4AL8C 2YPLB 1Q8MA 3VRLF 4P9HC 2FJHB 2ORBH 2ZOKB 1XO8A 3TN0A 4ATWA 3HVDA 3LPGA 4ODVH 1BJ8A 5ESAB 4PW4A 4PREB 4CAGA 4X6DA 3F58H 1FO0H 4YHZH 3DOSB 1Q9OA 1ORQA 1XGPB 4RSYA 4E68A 1RZIA 1B4JL 1BXAA 3AFLA 4M43H 4LCYB 4Y19D 5C6TH 3C5XA 3B9AA 2F74A 5AOLA 3KW7A 3PPEA 4TVPH 1U8LA 1SDDA 2J44A 3HN5A 5ALCL 2YD8A 4L0ZA 3WI9A 3IFNL 1GGTA 2QTVA 4TXVB 1TN5A 2E7DA 4EDWL 2WQRA 4PWFA 1N7ML 3DNKA 3IDMA 1GHFH 3L9RA 4K3EL 3E8VA 4OGYH 2F18A 4PJCF 4BFFA 1TSRA 1XGRB 1CFBA 2KPWA 5C2BH 4G6FD 1WTLA 1UH2A 2BP0A 3O45A 3B9DA 2C9RA 1J9QA 1GC1H 2X2JA 2I9LA 1TZGH 3GTTA 3RWIA 5B39G 4PU2A 4M7JL 5I71C 5I1CH 1QSFD 5EEVA 4G8FA 3LS4L 2AS5M 1AQ8A 4Z78A 2ERJB 2XWZA 4PJ5B 5D7JC 1ZK9A 2BNUB 3ESPA 4GQRA 2VOTA 1LNUB 4CU7A 2CGRH 3ILDA 5DVKA 1BZ9A 3SE4C 4HFWA 3DXAE 2XNAB 3V6OC 2ALAA 2PR9A 2DLFH 4NPYB 3JQOB 4AMWA 5I82A 1OQXA 3S96A 5EU4B 5HGAB 1X0SA 4LZKA 1MREL 2UVEA 5KSBF 2WP3O 3X1NA 4CA4A 3FZUC 3HBPA 3KPQA 2DQDL 3X3GH 2NUPA 2YOAA 1FGNL 3VA2C 1I7ZB 1A25A 3FQNB 3MX0B 5D1XA 5HGDB 3TPUB 3RKDD 5CGYC 4H4NA 2H32A 4JN1L 4JR9L 5B38G 2BSED 1VFAA 2MQGA 3N43F 3AY2A 3DPBB 3TZVD 5FKPB 4P46D 4ZUVB 2R83A 3EJJX 3ELAT 4FQPA 3UZCA 4NXKA 1NANH 5AVRB 2AMGA 2ZWLT 1KTDA 4PS3A 3NCWA 5JHBA 4C58B 3IDUA 1M0KA 3GPSA 5DMKA 5DRZB 3MRKB 4EBQL 3TLRA 1SYVA 1KTCA 5EBWA 1QWHA 9PCYA 5F96L 3U79A 3VFMB 4WSJA 5JXEA 2WN3A 5DGRA 1YN7A 3CX5J 3O11A 2ED9A 2HPOA 5JXAH 3LEXB 1U2HA 4FYQA 3RY6C 4CGUB 5B6VA 3K0YA 3K72B 1J8HD 3IFNH 4HBCH 5IB5B 4NKMA 5I1DA 3TV3L 3IJ9A 2XZQL 4NJ9H 3R8BB 3ZMEA 1S8LA 3L3OC 1SOQA 3VG9B 1GSMA 5GGRA 1SJEB 3CSYA 4D0BA 1DVUA 1TZAA 1SLVA 2EIKB 1QBML 4NQCE 5EZJB 2NY6C 1OARL 4X5WB 1MFBH 5L4IA 4DOHE 4NSKA 2K3TA 3QZOA 2VN6A 4PI0A 3C9NA 3O3DB 5LB1A 4EI6B 1JXJA 3LB6D 4FLSA 4HEMA 4LSQL 2UZIL 2DB8A 2Q6WA 2VKWA 3G6JE 5FOBB 1X7SA 1D9KA 1ET5A 5DZVA 1LP9B 3OAXA 1O9VA 5LBSH 2K9FB 4NB7A 5I30H 4XMKL 3TP4A 2IALA 3MJ9A 1H2SA 4F7MA 1Z5LA 1NIFA 4N85A 3OBAA 3H7BA 3ZKSD 4LEOB 4Q6IA 4DUWA 1S9YB 1H3XA 1QO3B 3HHSB 3QI9C 3WXVL 2FWUA 4X4YA 3MSPA 1WK0A 2OL3L 1QKPA 4KKAD 4I87A 2G75B 5B21A 3T3PB 1JYNA 1DVFD 3OAZH 1JPTH 1N59A 1ZA6A 5E2WH 3Q1SH 5EH1A 1XGZA 3US1A 5T1KB 2EZ0D 4PS4H 2HT4D 4O5LH 3U6XS 1EZUA 4L4VD 1TU2B 3QP3A 3PWLB 3SQBB 5K9QI 1FGNH 2X1PA 1GIGH 5FK9A 1E4JA 1JGDA 4YHMH 3DV6B 4QJ4B 4FYSA 4L9LC 4BZ2H 3OZLA 1JWMB 3GMLB 1IBFA 3FO2B 1DLHA 2A9NH 2EC8A 4PJ7F 2BJMH 4JG0H 5HI4C 2CLZA 3PDDA 2HJKA 2ICCA 4M00A 1T1YB 1ZLVH 3U36B 3LSOA 4JGUA 1XB8A 4AZUA 1KCRL 3DK2A 3INOA 2YPVL 4JZJB 1KTLB 5G4NA 5I8EB 2LE9A 1EFQA 3C5ZC 4HWUA 3UTWA 1HL9A 4QHKI 1GOGA 2W60A 3DDFA 1A1MB 5JHLA 2GBAA 4N4YB 4BE5A 2GJJA 2P80D 5TE7H 4FXKC 3M1BB 4RAUA 4F1ZA 4LDLB 7FABH 2E74C 1QHOA 5B1JA 4JFHD 1T2QL 1TVHA 3BAKA 5DRWA 2A4CA 2FQGA 2WQVA 3QDGB 3Q2VA 2EEFA 4KY1H 3SDDA 1IGTB 3CK0L 4DF9A 1DQTA 1YLBB 1L9NA 1ZXQA 1IILE 2OJZL 3ZPRA 4GS7B 3U7WH 4Y89A 4NWTL 4ZMAT 4TUOB 5C0AD 1AP2B 4N25A 3DJZA 2UZIH 4KO5A 4DGVL 1HSBB 2CDEA 2DDQL 3KPRA 5B22A 4R4NC 4XNMA 5AB2A 2KLTA 3UMTA 5F3FA 4RZKA 1OAJA 4XMKH 4QYOA 1JPEA 4KK6C 4ZQKB 5FR3A 1TLKA 3OL2A 1DANT 4KX8A 5FKAB 1AKJA 4KVCL 3QIWB 1PIGA 1SMAA 4D3CL 2ZYSA 1AR1D 1FFQA 4Z8FL 3KGRA 4J1UA 1OE2A 3TA3A 2KI6A 1SF5A 1CFTB 4YUEL 2V3FA 3NIFB 1OHZA 1BVKB 4TSAL 3VMNA 3VSQA 1JPSL 4WWKB 5H2LA 5LXGH 4OCYL 4HCRL 3QBIA 1E0PA 2P48B 2C3GA 3FT1A 3RRQA 3BDBA 3RFMA 4A4MA 3FT2B 3CFCH 4H0IA 3L4WA 2VLRA 1AI1L 4FP8H 4YMPA 3CZLA 2O6EA 2JIXB 3TIEA 4BEYA 3TH4T 2DLGA 1XSOA 4BQ6A 1UB6B 5BXFA 4AVHA 1OAKH 3EO0B 2YZ1A 4DUVA 3VFGL 4UUJA 2GJRA 3GIVA 4YLQT 5AAWA 1PX8A 4CC4C 2D9QB 2VL4A 4TTDD 2ZOTA 1DL7L 5EBMA 3RU8H 4ELMA 4P4KB 4PJ9B 5DZPA 4ELKB 2J5WA 3DO7B 5D55A 3D69B 3WEAA 3M7FB 2WKOA 1N5YH 1KWGA 4YNYB 3ZBMA 1FFOB 3QCTH 2XIIA 3NJVA 4AZ8B 4FA8A 3F83A 4PS8A 1GTNA 4AMXA 3LH2H 4M5ZL 3GKWL 3FFDA 5GS1B 1PQZA 1UZ8A 3IMSA 4JFOA 1IT9H 4U1JA 1E6OL 3KPSE 5KS9E 3K6NA 4HJJL 4MAYB 3PGDB 5I8KH 1TTFA 1R9FA 4HXBL 4GIOA 1DZEA 4A2EA 4R7DA 4R96B 5F71A 3H8NA 4NUJB 3QCVH 5EOQL 4PP2A 1UM6H 3FAWA 1UA6L 4H8WC 3QFDA 3WUWB 2I32A 2PCPB 1PKQA 4P5TB 4JJ5B 2ZUSA 5C08D 2IANB 5K9JH 4OI7A 3TNNA 2VT0A 4M3KB 4TLTA 3V0JA 1JPSH 2NTFA 1GZQB 2BCMA 3O41B 3F12A 1MHCB 1Z5HA 1XBDA 4LVOC 3RPBA 3HMWH 4P2RA 1HHJB 1L6XA 4K7PL 5EBGA 1HKLL 2OXHA 3IJHB 3I6SA 2EH7H 4JG1H 2O5ZL 3UX9B 1WBYA 5IB3B 2AAVA 4YHYC 4X6EB 2CO4A 4Y7MA 2MPAL 4AGQA 3JSSA 4I2XB 4NT6B 4HWBL 3OWEA 3ZJAA 1G9MC 2Y5TA 1KXHA 1PDKB 4S0SD 4Z7OE 3LZPA 4JG5A 2HVKB 4HYXA 5E8DH 3EYQC 1SHSA 1WAAF 3OKOA 2KLSA 3FU9A 4GUQA 1OAQL 3HAEG 4XB7A 4GUPB 5D1QA 5I19H 3SE3C 2X12A 4YAQA 4ZUWA 1KBBA 4CADB 1UT1A 5BV7H 3RWGA 1V7MH 1U3NA 3N2JA 3IN2A 3WKMH 4CN4A 2R2HB 5F6IB 5F88B 5C09B 2Q7YA 4ZO6A 1VFUA 4DS7E 4JANB 5GGVY 3ZQXA 2PP9A 1A1OB 3EUDA 1FE8H 2A6JA 2YXWA 4DK5A 3HZKA 4UTCA 2DN7A 3LPFA 3V2AR 1I3VA 5BZDA 1OANA 1AGDA 3V0IA 1TJGL 4XP9H 5IW1B 4DKTA 2VQTA 1CL7L 3P9LB 4GW5A 2WGNB 3P77A 1ZHKB 3F84A 3GKWH 4MQXC 5EEWA 3K6SA 2A6IA 4YHNB 5JOPD 1K5WA 4KTEL 4AYSA 5B39A 1QSFA 3R1GH 2ENQA 2RBLA 5I18H 5GGTH 3MLXH 4GSRA 1TTBA 2ICWJ 2WZAA 4AIOA 5HDLA 3QIBA 2ZP8A 2AI0L 1KTJA 3ARRA 1PZUB 3KJ4C 2VW7A 3ECBB 3PF2A 4QY8A 5T33L 4CDGC 1F6AA 2BNRB 2NR6D 4Y4HD 4YDIH 4WHYG 5L8LB 7TAAA 1SBSL 1Q0EA 3HE6A 5TGZA 2Z35A 1GSKA 1FFPA 4LSTL 1QUNB 4OIFA 2CR3A 5FC9A 2CHNA 1RJYA 2JB6A 3DYMA 4XPAL 3JVGA 3GMOB 4F80A 2BH0A 1YECH 5KBNC 4MMZC 2C1OA 1SQ2N 1YEIH 4PG9B 2RH0A 1OGTA 2EILB 2ZICA 1E42A 1JNLL 2EXSA 3E7JA 3OXSB 3MBWB 4XBGB 4Y1AD 3FRPG 3DTXA 4YGVB 3RE0A 3MOAH 4XVOA 4E2OA 2GT9B 3VFWB 2ENJA 2CLRA 3SPVB 4AEIH 4DP2X 1FZKA 4DVBB 5KANI 3UMNA 4FABL 1YDPA 3QFJE 3FQ2A 5IBUG 1NZRA 1K8IB 1JPFB 4DZBA 1MUJA 2WINA 5A2LH 1J0JA 1S5HB 1I9JL 5DVOA 5CAYB 1MIMH 4RNRA 1MY5A 1S7RA 4JFDE 3ZDYB 3FQUA 3INUL 4M4RB 2EE9A 5EU7C 2EDHA 4JHZA 3QJFA 2LTQC 4RX4D 1F11A 4B95C 1JMXA 3HKZA 2CNYA 1WEJL 4PRDA 5GZOA 5LGHL 2JJSA 1RMFH 1G7LB 1QATA 1KXTA 1YPZF 3QEHA 1BXUA 1RUPL 2COVD 1EZLA 3WSQL 3HR5B 4OFQA 3HNVL 2A3TA 3EH4B 4QRRB 3RUGE 3OGCB 5DD5H 1GGCH 4GQPH 2XG4B 3QXDB 2ATAA 5DWUL 3LPOA 1KJ2H 1MJJB 1QVOA 2E8YA 4K71C 2VLLA 2Z8VC 3MRFA 3FU3A 1C1EH 5I6PA 2DKSA 3RB5A 1C7TA 4ERSL 4XNYL 2VDNL 3GLZA 2VKXA 2XY1A 1AT9A 4QOKA 2X4RA 5D93C 4P2YA 4FS0A 3KLAA 4XP6L 4P2QB 5HGBB 4L5FE 4N1HB 5D7SL 5DR5L 1IAIL 1A3ZA 1TO5A 2FJSA 3B6SB 4MB1A 1NEZB 1SNRA 5EG6C 3P54A 3ZGHA 2RFXB 3MMEA 3X1GA 1JE6A 5JYLA 1FV1A 2F53E 3Q48A 3ZKQD 3FDWA 4D9RE 1OP3K 4WEEA 1I7RA 3WEBA 1BCIA 1S8DB 1QOKA 3LH9A 2YDVA 2RR3A 1YUHB 2QV4A 3L13A 4R2GC 1R0AH 2LQRA 4FL4B 2B16A 2NX5B 1M9WA 1NUNB 3DX8A 5CR8A 4PLKC 3BH9A 4FTVB 2EYTB 3EOAA 3D18B 4RFNC 4KKZA 4K73A 4K8RL 4DFHA 4U6XA 1RFDL 1KV7A 3IJSA 2P80A 1EH9A 2PYEA 4HAKA 1HL5A 3B7TA 3LZOA 3QJOA 3CC1A 1YEGH 5FYKL 4HKBB 4XPGL 1NAML 4DPCX 1A7PL 2IGFH 3MLZH 1V54B 5CP7A 4IMKA 4QRAA 4R4FL 4U1MB 4IW4C 3V9FA 1KLGB 2HG5A 5LGHH 1E5ZA 3MOBL 3UC0L 4IKJA 4YSEA 1PY4A 1RUPH 4HIEB 3WO4B 4LDEA 4XVTL 1DDTA 1FG9C 2DQHH 4LLAA 4AE0A 3MRHA 2C3HA 5KSVA 1J7VR 1KBKA 1ZVSA 3GSNA 3TONA 3ZN6A 1U8HB 5GS2D 2JIXD 4YBLB 1S9XB 3WV0A 1QFUL 4FFZH 1BDYA 4FQQB 4JX0A 3LRGA 4OVVA 3EGSA 5DC4B 1HQ4B 5ICZA 1QLRA 2APTA 3W37A 1Q94B 3U9PL 5GGSB 3D50A 3KNBB 3UTZA 4B0MB 4E9XA 4GG6B 2IG2L 1MCDA 3HI1B 5DEJA 5LCVA 3ZE0F 4XT1C 2ITCA 2VJ8A 4Y4FC 3WFEH 5C9KA 1KLFA 3SGKA 3FUNA 3GMRA 1CT8A 4Z7VE 1A02N 1MCEA 4XNYH 5DRNA 1JK8A 5J57B 1IM9B 1TTUA 2Q10A 3F3HA 1A5FH 5B34A 5D9SA 1BRRA 3QXUA 3ROOB 4PW9A 1YYLL 3FH8A 4LQFL 1FVCA 4G1EA 1KJVB 4G6KL 4RETB 4L3CB 1RY7B 3WL9B 3SGEI 2E7BA 2JLLA 3NCXA 9CGTA 4HZ1A 1JXKA 3ZR6A 3CPUA 3QUZD 4N0YL 1J1XH 1H15B 3EJUA 3UJJL 1AO7E 2XZCL 4DQAA 2J73A 1LVEA 2PP8A 3HBQA 4IJTA 3N42B 3VD1A 3HMXH 3VXMD 3AVEA 1E4KC 1NOLA 4RWYL 1IQDB 3IMUA 1IGIH 3MYZA 4MJHA 4ZPTA 1XF5B 2IAAC 5I9QB 1IUZA 1J8KA 2BRRL 5HY9A 2ZIYA 2Y69B 1U8NA 4JFPB 2NYYD 1UHVA 1YVLA 4QT5A 5DSCB 2NUTA 4XT3A 3WO3B 1S7XB 4HUUB 4XC1L 2AV1A 3G5VA 3RI5F 1PG7X 3RVXD 3UPRB 2Y4SA 4U33A 4XPGH 1ESOA 5F0PB 3GZOA 3SBWA 5AZ2H 5AAMC 5KYNA 2YHGA 2WVTA 3QQ4B 4QCIA 3HRZA 1CGSH 2YPLA 3WMPA 5KSAC 1MNUL 4LGSB 2CDFB 5H37G 3WNJA 2FJHA 2J8UF 2XQBL 2JJUA 3VD2A 4KLYA 1GA2A 3D08A 2VR7A 2AQTA 4JO4L 1NAKL 2FUTA 4PRPE 4L0PB 4XMWA 5ESAA 4YSDA 4X9YA 4UQ9A 5F7YC 3EH3B 1UM5L 2IQAB 3DOSA 2E75C 4R0LC 4MCMA 1LJMA 3LKRB 2YK1L 4LCYA 3T1FA 4Z3JA 4MMYB 1Y6KR 4FF9A 1F97A 3AMKA 5C0CE 1NC4B 2YMXH 3GDBA 4UT6H 3BLBA 1JCKA 1U3ZA 4OCSL 4ZO8A 4CSPA 3RLSA 4L3FA 3AU1B 3LQZB 2EXTA 4F7KA 3TEZA 3TX4A 4MRBA 2L4OA 2A74A 3D2UD 2J1ZA 3TFKD 5K1NA 5BR2A 3EAKA 4G6KH 4AGNA 2ZXCA 5HYJB 1PPIA 5DD6B 5T5FL 1L9QA 1YUKB 2QSCL 1WYJA 1VLXA 2JCCF 1XL4A 4C47A 1GGIH 2NCEA 2HFFA 2VH5L 5JIPA 1CXFA 1OIOA 4WDIB 1MLCB 5FLUA 4KPHL 4ZTPH 4R9HA 1JXGA 4HH9B 2ODIA 2BOLA 1LO0L 1ACYH 3HAEA 1OT1A 1P4BL 1F2QA 4PJ5A 2YGNA 4RWYH 2BNUA 5D5ME 1LNUA 4K15A 4E9VA 3ARTA 4AMKL 1BQKA 3H0TA 1JGVL 2XNAA 2XTLA 4NPYA 3LHPH 2P45B 1CFSB 2A9BA 3QRLA 3PV6A 4XC1H 5IQ7H 1QRNE 2C7FA 4ZMXA 4DN4L 4KRMB 3A0OA 1ZWIB 4LPCA 2BNRD 4HG4K 3VB9A 5CCJA 1KGBA 2UY7B 3JZ7A 1N9PA 3LZQA 1RPKA 4GFXA 1J1PL 4OFIA 1I7ZA 3FQNA 3MX0A 1H3VA 4M6OH 5HGDA 4CNIA 3SGDH 2CM6A 3T6WA 3ZE1E 1MNUH 3L9BA 2L04A 4NQXB 4PUBH 1F00I 4J8RA 3BIAX 3DXAB 4YEEA 2R7EB 3DPBA 3WNLA 2O5XH 4ZUVA 5HI3D 3RQ3A 3RIKA 1XD1A 3BZ4B 4L4TD 4O58L 5DUPL 3VRJB 4KWUA 1K4CA 3HTLX 3QQXA 2XV0A 2H7WA 4OQTA 2Y7QA 5DFAA 3U30B 2PPDA 1JNJA 4HPOH 1A22B 2J1KA 3MRKA 4N6HA 4AGOA 2QGEA 5J7AA 4P4RB 3NSDA 3VFMA 1OO2A 1S7TB 2N7SA 5BO1L 1DDHB 3SJVE 1OAUH 1V5JA 3LEXA 5EB9A 5D1ZC 3FONB 3FUJA 3HRPA 3K72A 5IB5A 4AGPA 1OTUC 4HWEL 1W9XA 4QRTA 4GBRA 3WY3A 4IRJB 3QDAA 4GSUA 1ID2A 5CINH 1A65A 3WNKA 3BRFA 1ZTMA 2PEDA 3ELQA 4X5WA 1KUMA 4OLXL 5CZVH 3TCTA 2VW6A 5J8OA 2W07A 3VX0A 4EI6A 3O3DA 4YR6B 3RX7A 4ABUA 5F9WC 1K72A 2IPUG 4NQVB 5I1JL 1QSED 3ODUA 3EG9B 2WXGA 4OCMC 4QRRD 3OAYK 2J6EH 2WOBA 3J7HA 1ADWA 1XGQB 1N12A 3FRPA 5F7MC 3U9WA 1LO0H 1WITA 3BISA 4BUQA 4DO6A 4ZOAA 5IQMA 4Q9CA 4WFFE 1T0MB 1T2XA 3GBNH 4M7KL 4LEOA 1IAMA 4NQCB 4TVUA 1S9YA 2VDPL 3HHSA 2EO9A 3LKOA 3DI3B 5CD3A 4W70A 4DOHB 5FECB 3ZHFA 2ADGA 1IAKB 1HT6A 2G75A 4HULB 1F8TL 4N2OA 3G6JB 1YMME 2ROYA 2ZUQC 4MXQC 5T1KA 3MR9B 3MV7B 3A4FA 4RX4A 3D7PA 1CDCA 3TH3T 1TU2A 2GHZA 2OR8A 3E8UL 4MA7L 2K6ZA 2PPFA 5DI8B 5FV1L 3LN4A 3SQBA 3VVWA 1MAJA 3I02B 3NZ8B 2VE6A 1JGLL 3GMLA 2CLVB 4XCFH 3FO2A 3VFPB 3O2WL 4P5KB 5JPMB 3IF1A 4DPAX 4YDVA 3RTQC 4ZUUB 1T1YA 4XZUB 4ILDA 1TQVA 5DEGB 1PAMA 1KC5L 4JZJA 2NX5D 4UQ2A 4WHDA 1KTLA 5I8EA 5C0RH 1EGJA 1SY6L 3NMEA 3NFSH 2JTDA 5CIPB 1IGFL 1J1OH 2VL5B 1A1MA 1I1CA 2APXA 2E76C 3QXVA 2QPFA 2EKSB 3M1BA 1ZEAL 1UC6A 2ZCKH 4M61A 4NO0B 4I9WE 4YK4B 4U31A 1JK9A 4HT1H 3BP7B 3QDGA 1AH1A 5AUMB 4W9DC 1IGTA 2EKJA 4JZOB 4WW3A 5BRZD 3HJEA 1DQDL 3L3OB 1NEUA 1A6ZB 3ZTJG 3RIFK 3MLRL 3GS7A 3D39B 2VLJA 3L45A 4NQED 5I1JH 3K4AA 5CS7A 3LX9A 3FT9A 4GKNB 2E7MA 2Q8AL 3GUTB 4KXCA 4P59H 1XV8A 1FBKA 3KWUA 4ACPA 3TBYB 4O51B 4ZQKA 4NIYE 3TBBA 1MFEH 4R5XA 4MJID 2VSDA 3T71A 1B3JA 3QIWA 1CYWA 1F90L 3I84A 5JIHA 1V55B 5H2IA 2NY0B 4FOMA 4BFRA 1NMBH 1PAZA 4G8GE 1AXIB 1WZLA 1BVKA 1TMCB 5HPMA 5F8UA 2DQCL 4POZC 1YEDB 2V8LA 4WWKA 1UWEL 4XO9A 3SDCC 3QQDA 2YAEA 3MPCA 1F3RB 4Z95L 5LAPA 5IMMB 2Q0ZX 1LHZA 4G9FE 4ONOA 2HMID 4KNTA 2Q87A 3N6YA 3FT2A 1ZLSH 3MJ9L 1MHPL 5KVEH 3VG0H 1ETB1 1RUAL 3MNZB 5I1GL 1U4FA 2XN9B 2UV3A 1U8IA 3O2WH 2JIXA 2OS7A 2GI7A 4A2DA 1UB6A 4PAZA 3EO0A 1ZE3C 3HUJB 1MRDL 5I73C 4XBPB 3D0LB 2G9KA 1YG9A 3A67H 5F44A 4JFEE 4NEHB 4P4KA 3D0VB 4PJ9A 3RWCB 1Z0NA 4PJXE 5DHVB 3C5ZB 3FNKA 4HPYH 4EDXB 4ELKA 4NHCL 2RHEA 4GQ9L 3B2UD 3J2PA 2DYPB 3DVFA 4Y9GA 3VSTA 3S88L 3ULVE 2EYSA 1RIHL 2X4UB 4MS8C 1TXKA 3D69A 1WLHA 1PEWA 3KLHD 3MV9D 4YNYA 1FAKT 1LO5B 2GB2A 3TPKA 4WI7A 3DMMD 3WLWD 3ARFC 2NPLX 2XICA 8FABB 1NGQH 4K4KA 1ULVA 2B4CH 3AUVA 3WDHA 3PGFL 3TF4A 2PWGA 5GS0H 5IHZA 1A47A 3TEYA 4HF5H 1T04B 3EZJB 2ZFEA 3LZFL 4MAYA 4OZHB 1MOEA 2ZIDA 5L4JA 2Y2WA 2E59A 2MCPH 3OR6A 3BKMH 2C9QA 2F08A 4QHLB 1Y6NR 2OMVB 2VDKH 1T4WA 5E95B 3NS0A 3WUWA 4FTDA 1ZA3B 2K3HA 4P5TA 4JJ5A 2CH8A 2OR9L 3CV5A 2IANA 2XG5B 4N20A 2M2DA 1GC1C 1AXSB 1GZMA 2ZWZA 4MBOA 4HJ0C 4ODSH 3TO2B 3UADA 4B97A 5JDSB 1W72B 2YN3A 3B7SA 3O41A 4OCRL 4NBYB 1MHCA 4ZX5A 2ZXGA 1HHJA 1WJ3A 3IJHA 1F4WL 3ZZ1A 2K0RA 2B08A 1GPOL 4G5ZL 3GJFB 3TO4A 3FTGB 3UONA 5H37A 3WXWH 1CLOL 4JZNB 1SVZA 2A83A 2VMCA 3C8KB 1BD2E 1MHPH 5DJ2A 3HI6L 4OF7A 4X99B 4NT6A 5LNDA 2ZXAA 3V10A 5I15H 1SXZA 5DK2B 5J4MA 1MQKL 1VGKB 3G08B 3QEUB 1BM3L 4ODTH 3P40A 1UZ6F 2LOEA 1BZQK 5AD0B 4BBWA 4FQIL 1EAQA 3HS9A 2W0FA 1MCWM 4CADA 1N64H 4XN7A 5FYJL 2AK1L 1FNGB 2R2HA 1AQDB 4M7LH 4YO0B 5C09A 2VISA 5J3HD 4YVUA 3TVMA 4F8OA 4QLWA 5I1IL 3U2JA 1RD6A 3T8MA 1A1OA 1N68A 5JORB 4OCXL 2BCKB 1CLZL 3FJTA 4Z7OB 3OF6D 3K1DA 4TVPE 4DTGL 3DX3A 5J12B 2VUOA 1I8KB 4UF7C 4PJDA 2X3CA 2EVJA 4ZSOE 4MQSB 1EZVY 3S36X 1V3JA 2YCYA 2A4EA 5CSBA 3P9LA 3WJLC 3L3JB 5GJSH 4PJIF 5H8DA 2F95A 4GYCA 4TNFA 4WU5A 3MGAA 5C2UB 5CZXC 4XMZA 3PWNB 4QIDA 4WTXA 1N26A 2NT0A 1JUFA 5L88H 4MMXA 5JHLH 3MRDB 3EZ8A 4ACTA 1A9BB 2ADIB 1J5OH 2ZOLB 3IETB 3GSVB 3LXUX 1VAHA 5E00A 3O0RH 4DPBX 5AWZA 4K5LA 4NYLB 5G4OA 5MENA 2F58L 3IMWA 2L7UA 1UYWL 4P9ML 1PSKH 3UG4A 3T3MF 4AJYV 4P2OB 3ECBA 1JFQH 3O6MH 2RD0A 2BNRA 1KGXA 3DIVA 3QHTC 4JRXA 1MFMA 2IDQA 3PCYA 1J12A 4ZFQA 1QUNA 2JTYA 3KR3L 4X6DF 5FXCH 4LVOB 3EOTL 3U48A 4MNGB 2J7LA 3D12B 4AUYA 2KUTA 4HMCA 5TF1L 1ED3B 1E2VA 3VCLB 4PG9A 5DMJB 5DTFB 4YHYB 2R8SL 4U05A 4E41D 4PVLA 3CDCA 3FCUB 3GRBA 3MODH 4X0NA 4AW7A 1NLBL 1ZKAA 5C70A 3O4OB 2WNXA 4PJBA 3VFWA 3SPVA 1HZKA 1E5CA 2WBJA 5FYJH 1J05B 1Q0XH 5IMOA 2P3YA 4K7PY 3B2VL 2QQLL 1S5HA 5D7JD 1QR1A 4PMEA 3SKMB 2YD5A 3DUUB 4B9JA 4M4RA 3VW7A 4TYUA 4D8PB 1AMYA 3MV7D 3MREB 5D4IA 4N8VB 2ED6A 3V5HB 3EKCA 3VDCA 1H5BB 4JLRB 2ITFA 2BDNL 1BAGA 3RWHB 4MGXA 3MXVH 4YHKL 1OLZA 3UIYA 2ARJA 5E99H 3I2CL 4JRYB 2J5LC 2IDSA 4DEPC 3HR5A 4N5EC 4WHTB 1QNIA 1KDJA 4DPRA 4W9FC 3NCCB 2CBOA 3OGCA 5CGYD 4JFDB 5I26A 1MKFA 2R29H 2JAGA 4JE4B 1TEGA 2I85A 2XG4A 4XVJH 3ZHLA 2VB5A 3VXUA 4WNJA 3T4YB 1MJJA 4EIBA 4WI2A 2W0KA 5B3JF 1K8DB 4Y9CA 1HZHL 1PD1A 4IRZL 4LSVH 3B9EA 1N6QL 4BFJA 4K0OA 1K85A 4HGKC 3AY4A 3RPIB 3A47A 1XB6A 3QUYB 2CJUL 2WO3B 1JN6B 2E4TA 1NDTA 1F1DA 3KJ4B 4JQIH 3RJQB 4P2QA 1QYGL 4FZ8H 5HGBA 1DVXA 1AGFB 1J8RA 4MLIA 3QEGL 4FFYL 4HK3N 4YXKH 3B6SA 1NEZA 5EA0H 4UDTA 3WGUB 3T04D 2JQZA 4A66A 1HFUA 2PXYA 3HZVB 4OLZH 4BKTC 1HL8A 2NY6D 3D39D 4Q0XL 1S8DA 2DWYA 2C3XA 4HX1A 4X4KA 1YUHA 3RILA 3D4GA 4F8NA 1OP3H 2KSYA 1RZ8B 3BVDB 2D4DA 3HE7C 5JW4M 4OJAA 4MMZB 2R1WA 4X50A 1NLBH 1E3ZA 5IFJA 1OM3H 4PN6A 3CH8A 3EYVB 4FTVA 4MDIA 2HWZL 3FUFA 3BPLB 2DD8H 3D18A 5BPPA 1A6WH 2FO4A 4IJ3B 2NY0D 1V3LA 3CHRA 4Y5VC 2G30A 2YAPA 5DHYA 3RP1A 1JZ7A 3D4ZA 1TCMA 1G7PB 1RK1B 2F53B 4XRCA 3QI9D 5IBLC 4AQ1A 3QNXB 3GPEA 4HKBA 4IOSD 1THCA 1QHJA 3CVHL 4KV5E 1ND0B 4BCXA 5GHWL 4U1MA 4JJOA 5T3XE 4A2GA 2Y01A 3NPSC 2LTQB 1R3LB 3P0GB 1D6EB 1KBVA 1MCHA 4HIEA 1RP9A 5D70L 2V9QA 1EVUA 2I7SA 4RZCA 4U6TA 2X7LA 2XN9D 4Z7WE 1EJOH 1XIWB 3W39B 3K71B 1U8HA 5MEOB 4WNQB 2UXGA 4HCIA 4MCZB 1NBCA 1HQ4A 5I66B 1Q94A 5F3HB 5HI4D 5GGSA 1SGKA 5F0JB 4C83B 5L2JB 4GG6A 4KDWA 2FGWH 3BVXA 2X70B 2X4NA 3AAZB 1I1RA 3MLTB 1BMZA 3QHFL 4B5ZA 3C5ZD 3ULUH 4HZAA 4FA7B 1NL0H 3BQUC 1IM9A 2WB1A 2FH6A 3ROOA 1R5WB 3BVNB 2VUYA 4JFUA 3L54A 4L3CA 3WL9A 1P5UC 1QQDB 4O02B 4E36A 3WFDL 4LSSL 5PAZA 4IB4A 5F9OL 2P5EB 3F7LA 3GIZH 1I1FB 5I1AA 2E6QA 5I1KH 3BUQA 5FO2A 2WQAA 2NY3C 3KGSA 4MRCA 4Z7VB 5A3IC 3FUEA 2DL9A 5E70A 3MO1A 3TFBA 3T65B 4F58H 4LBEB 4PHZA 1JHKH 3X1EA 1RZ7H 1KEGL 5FFLA 2CG9X 1G0XA 2NYKA 1PG7L 1XF5A 2K78A 1QLEB 1ZJBA 2ID5A 3O4LD 3CN4A 4J4QA 5HYSB 4KK6D 5C92A 2P8LB 1VSCA 1T1ZB 5DSCA 2F5AL 1AO7B 4HS6A 4RQQB 4HUUA 4XP4L 4QJ5B 2RQEA 1A6TB 4YBQC 1EV2E 1S5IH 1SMOA 2FHCA 5EIIB 5AW0B 1BXVA 3FB6B 1KTKE 4QUOA 1FAIH 4XHQA 1BBJB 3QQ4A 1Z3RA 4PJAE 1QW8A 2E56A 3EFOB 2CDFA 3DX7B 1YNTB 1O6VA 4J3VA 2NRDA 5BMFH 2RCSH 1EA9C 3I9PA 4PGEB 2XHNA 5ACMA 1FIGH 3BZDA 2IQAA 1DP0A 5L4MA 3FAXA 1QKOA 2QHRH 4LSPL 1LL1A 2GITB 4HWZA 2AJYH 1UTDA 4NX0A 4Z77B 4A2FA 4UT9H 4WZ9A 4MMYA 4FQCL 3X3BA 1OW0C 4IGBC 4PY8J 3TYGH 2OZ4A 4KZEL 2MJWA 1NC4A 1H3PH 1UWXK 5ERWB 1ZLWK 2E9IA 2ZCLL 2IPUK 2JJTA 3AU1A 4OZFG 3LQZA 1CE6B 2FX8H 3FT3B 4A2HA 5EBLA 2NXYB 3GSNL 2ZP0T 4GP4B 1NGZA 3CFJA 1MCQA 4X6BB 4LLWB 4MDRA 3MUUA 5ANHA 4AVJA 1A1NB 1E30A 3E1F1 4LSSH 2ZG1A 2OP4L 4LXFA 2VM9A 4FBZA 2FEEI 1MLCA 4YPJA 5C0CB 3RY5A 1CGXA 4M6AA 2UUDK 3RKPA 5IJKC 2XN0A 4ES8A 3H2PA 4HH9A 1CPUA 2BOBA 2YEZB 3GSXB 3CLWA 3NJHA 4ELMF 1NJ9B 4QKXB 3QORB 4APQC 2ITDB 5L2KB 1KEGH 5DLMH 3ARPA 4KU1A 4AQOA 1R24A 2WKOF 1WUNT 4NENA 3NJFA 5H2KA 1TJIH 4ANWA 1CFSA 5EUOF 1X4ZA 4HIQA 1ACXA 4FYRA 4XTRC 4BDVB 1ZWIA 3H2QA 4ZW6A 3CPLA 5EHFA 2VWEC 1OB0A 3WN5C 2UY7A 2DTML 4YXHH 1JV2A 3CFEB 1U3HB 4F7EB 1RUKH 5D5MB 5IFAL 5MI0C 3DBXB 1BBDL 1PGRB 1S3RA 2TRHA 3DXAA 5CO1A 1FFTB 4GMTL 5KYWB 1WAPA 3ZL1A 4Z6AT 4XPTL 4EO5A 4FFWC 4HKXA 4KO9A 4S1SH 3VWKA 4GEJA 4MB4A 2EVIA 4X7CC 4DN3H 4BGDA 1AIZA 1UJ3B 3HAOA 4XWGL 5FO8B 5EF2A 1N8ZB 3CVIL 4P4RA 3EYQD 3FTSA 4XMLL 1S7TA 1WSST 3T77A 3QNFA 1DDHA 3ZE1B 4ZD3L 3SN6N 4DO4A 2IGTA 3RFZB 1NCIA 2X87A 1NC2A 1XAUA 2R0WH 4S1QL 3HFML 1JD7A 2R0KL 4IRJA 4QF1A 1AIFB 3DO3A 4N8VG 4PFEA 1U8KB 2PN5A 5FW6A 4UM9D 5EPMB 4DNLA 1NEPA 1KYFA 2WLIB 3JTTB 4JRYD 4UINL 4YR6A 4PGZA 3FN0H 3UDWA 1G5GA 1HXMA 2FJUB 5LCVH 1MF2H 3MCYA 4OD3H 2YD2A 4MQXD 3QWOA 3AS3A 2XXFA 5DF0A 4DAJA 3OAYH 3V52L 4W9HC 2EE3A 2OSWA 3VHZA 5CSZA 4PJ8B 2AITA 4NQCA 1DBJH 3L81A 3ZK0A 2Y2TA 3AREC 3WENA 5FECA 5E8NB 5D2LF 4OJEH 2ZCHH 5JPNB 1IAKA 4GYBA 3N9GL 1MVUB 4ICXA 4LASH 4I0PB 4WY7L 4X7EC 2FHBA 2ZD0A 1I85A 3G6JA 2IH1B 2UX7A 2DBLL 2Y25A 3MR9A 4AC2A 4Q9QL 3OJVC 1JZ3A 3X3CA 2DTMH 3BD5A 5DI8A 4BFIB 4JFFB 5EORL 1Q0YL 5IFAH 1QX1A 5A1AA 5AVZB 2CLVA 5C7XL 1DQVA 5F0MB 1LLAA 5FAAA 3VFPA 4Y7OC 1BZ7B 2HRPH 5JPMA 3GNML 4I7ZC 2LVCA 4YEFA 2VC2B 4ZUUA 4MSWB 1YMMB 4GLRI 3PXOA 4P8QA 4I4WA 1I8LC 4OLWL 1T7YA 2OTPA 4K3JL 1F41A 1S7SB 1CE1L 3WFBH 1F4AA 4LPYA 3OR7B 3PWPD 4H2AA 2VL5A 1TVBA 3HG0A 2BFVH 1OY3B 2FJGB 3TH2T 2EKSA 1JZDC 2B3IA 4NO0A 3T9WA 2IFFH 4J3OH 5CILH 4JM0A 3CVBA 3NCEB 4LIQH 3MA9H 4WGKA 5AUMA 1OGSA 1A0QL 2HCZX 4XP5H 1LDPH 5HHQB 5EU6E 4JZOA 2VLKD 4M29A 1D5MA 4UTAA 1A6ZA 1MEXH 1T2JA 4ZXBC 1FSKC 3DJ9A 2APSA 3MNMA 1XIWD 2BM3A 3UEQA 3OTTA 4FQLL 2HX9A 5ENWB 5IESL 4NQDD 1B88A 1QWUA 2RACA 1BJMA 2PWDA 3KYMB 4O51A 4OUOA 3G3LA 4GI9A 1D5IH 4QJ3B 4NWUL 3S48A 2OFQA 3CH1B 4Z3GA 1RIUH 1NCTA 3L17A 1GJIA 3RDTC 4TNGA 3WUZA 1LK2B 4Y2OB 3N9GH 3ESOA 4K23H 5DEFB 4Y2DC 2F7RA 3TYFA 1YEDA 1WBXB 5DK3A 3CDGB 1KIQB 1ZVYA 1EO7A 3GC3A 5IMMA 5SX4I 2EE0A 1QTSA 4Q9QH 2W65B 1U8QB 1WGVA 1CC3A 3C6LB 3P3TA 4PPTA 3HAEH 1MZYA 3QCUH 4DKFL 5C8JB 5FB8A 1OVZA 1ZS2A 2P5ED 4EUPG 1E67A 2JKRM 3MNZA 4FJZA 4HG4J 1UCQA 1ZLDA 4NKIL 4R4BB 2MSPA 5AKTA 2I24N 4G8GB 1VFMA 2UZXA 2GY7B 2OTWB 4NN6C 3SDYL 4PTTB 1T4KA 5CCHE 3SYAA 3ZDXF 2I9TA 4YHPB 2WZPA 3B7UX 3ZL4L 3RJOA 4K3HA 4MD4B 3TEWA 1JGEB 5L4FA 4X80L 2GVYA 2IOMA 4G9FB 1OSPH 4R2GD 4N3TA 2IEPA 5J6HA 2ZOOA 4LLDB 4MA8L 3ULSB 1L7TL 4BGLA 5KAQG 2PTTB 3D0VA 5BZZA 5HYSG 4Y4KC 4ABVA 4MDJB 3ZKNC 4EDXA 2OMWA 3UAJC 1YEKH 2DYPA 3O3UN 1UURA 4FGMA 3W2DH 1JS4A 4N6RB 4P3CH 4GO9A 3HC4L 1LO5A 5IBTH 1FH5H 1RZJL 3A4AA 1WFOA 5CGMA 3NSBA 1ZSHA 3JTBA 3VGGA 1QZNA 1NMAH 4OJDH 4OQTH 5I16B 2ADYA 2AQSA 3AG1B 4JFEB 2FAUA 1XGYL 3OHXA 4NN7B 1EGJL 4DT2A 4Z76B 3WEOA 1HIMH 5ID1B 3TWYA 3AUWB 3E2HB 4FQLH 4W4NA 3JXAA 5C0EB 1JZFA 1RPQA 2B39A 4QHLA 3Q1EA 1XB3A 2OMVA 3QRGL 1EXUB 3VI3E 3SSGA 2JMRA 3ARZA 1PLGL 2G0KA 3FRUB 3HI5H 3OMIB 1PBYA 1LQSR 4XCCL 5K5YA 3GHPA 1XMWA 2XG5A 5KS9A 1U91B 2YBRB 3KPSA 1AXSA 1MJ8L 4KNSA 1BIIB 1MH5B 4Y4FD 5IQNA 1W72A 4OW6A 1EUUA 4JQ6A 1EAOA 4AQEB 1S51A 4NUGH 1DBBH 2NXYD 4HSQA 3CX2A 4B60A 1SN5A 3WEMA 3IJYB 4WO4B 3GJFA 1TTAA 3FTGA 3OG4B 1A7BA 4OR1A 3C8KA 2ZOUA 3IM1A 1DVZA 2G4GA 5HHNA 5LKNA 4NKIH 3IVKB 2E4FA 2FBRA 1L6PA 3UFIA 4NZUL 5EWIL 4EIZC 2C9PA 3QEUA 2A9ML 4MA3A 2R69H 4PJFE 3HZMB 1A2YB 1PNCA 3H9ZA 4N0UB 5L2KD 4F2EA 2QKIC 1IC0A 2PNDA 2BMKB 4N2DA 4XCNA 1XZ0B 1OAXL 4DSYA 1QFPA 1BQRA 3EH1A 2Z4TA 1FNGA 2KS0A 1AQDA 4KK9C 2IAMC 4YO0A 5ALBL 1C8QA 4L6RA 1BD2B 3R7RA 2Z9TA 1IM3B 1AFVH 4OZFA 3ZUNC 5JORA 2BCKA 4AYID 1T7WA 5CEXB 2QLYA 4RGNE 3ATBA 5KUKA 3HPJB 2ATPB 3DSFL 2NMSA 3WQJA 2JKXA 1I8KA 4Z1PA 4MQSA 1U3HD 2PPCA 4V11A 3EBIA 1G7QB 3P30L 1EERB 3L3JA 4HD5A 3ZTDC 3D30A 3T2OA 1FO0B 1USQA 4ZUSA 3ZHKA 2YXMA 1EGJH 3KH4A 3O6LL 4JHWH 5I0VA 3PWNA 3T2LA 1NBVL 5KSAD 2V5YA 4OIIH 2AJ3B 2X53A 5AZEL 3D25B 1JAEA 3MRDA 4KZDH 1HXYA 2GSGB 1A9BA 1DSYA 2ADIA 2WM0A 3CHSA 5I75C 2EIZB 2ZOLA 3EO9L 2WWNA 1BREA 3IETA 3QRGH 3X3FH 3IE4A 3AG4B 4H8VA 2VDLH 1IQWH 3LKQB 1COBA 1YY9C 4NYLA 1R5VB 1UACL 2AJUL 1HE8A 3OKLB 4Y9EA 5E7BA 4G3YH 4P2OA 1AZZC 4TQEH 5C0BE 43CAB 1E9QB 5TDOB 3FHAA 4OF8A 1EBAA 3FCTB 5FYLD 5CM1A 3GEFA 1KGYE 4BV1A 4X7SL 2ZJSL 3UAAA 4UYQA 4C55A 3F8UB 2GK2A 3CC5B 2G3NA 4LCUB 4N4WA 1UCBH 3UTXA 3RIFF 1EXHA 1ED3A 1MRFL 3VCLA 4NZUH 4GY4A 1K6QL 5DDHA 3QG7L 1U2CA 3ATAA 2LVEA 2EUWA 3VFOB 3DIFB 5E2UL 4MZIA 3MRPB 2MEJB 3KDPB 2CCWA 5E08H 2WUBL 4NQSA 3ZZSA 1P8UA 1H8NA 2H1PL 3Q05A 4LDOB 2Y06L 3SKMA 4FAAB 3K2KA 3AGVA 1GS6X 1IEBB 1XF1A 1I1AA 2C4XA 1OAZH 2HT3C 3DUUA 4I0PD 5GISH 5HDBE 5C6WH 5MP6H 1CJYA 2ZWSA 2WQ8A 5TQ0L 4D8PA 1ZTXE 2R2CA 4A7QA 5I5RA 2D7TL 1E0OB 1LMIA 3MREA 2IPKA 4HUNB 4L1SA 3K46A 4N8VA 3VGAA 4AQ8C 3CXHK 1H5BA 2Z7UA 4JLRA 4RDQG 3UTOA 3RWHA 3KYKH 5I6XC 5AEAA 5M95B 4GKOA 3UACA 4JFFD 4APXB 3QFJA 3TBSB 5HYQA 3L5WB 1MJ7H 1UH4A 3V4UL 4FADA 4JFDA 3SE8L 1JZGA 1JG9A 1YMMD 3AJ7A 5AVXB 3N85H 2FX7H 4G5AA 3IGKA 3TN0C 1FRGH 3IPBA 4C56E 1F56A 1P7KA 2WLLB 3T8XA 5L6YH 4Z7QE 2R27A 1K8DA 2J71A 3POHA 1X9LA 5KSUA 3MTRA 2AJUH 4GT0A 3N0PB 5KW9L 4MBRA 1F4HA 4V1DB 3RPIA 5K59F 3PGCB 5B4MC 1BP3B 1T0NB 4ODBD 3QUYA 3HB3C 3RUGA 4J4PA 4XO4A 4KKCC 3MLUL 2DZEA 2DWSA 1XF3B 5EU3A 5D1ZD 5EC2B 2QVMA 1XH2A 4U3HA 3HG3A 1JFHA 1AGFA 3AADB 1OTUD 3LMJH 4H0HB 2J8HA 3HZVA 1KJ3L 3LZRA 1LEKB 4KKQA 2QV2A 4RRPA 1LEGB 3I3BA 4HYJA 1TQUA 1OT4A 2GTZB 1G6RA 1XVSA 4HIHA 2BY3A 4ZS6C 1CD9B 2Y02A 2C9AA 2V2WB 1XF2B 5E8OB 2QFPA 2KBGA 3FK3A 2CALA 3MACL 4FCHA 5JJJA 3EYVA 3OB8A 2PP7A 4EF3A 4YXLL 5I23A 2K8MA 4BKLB 4OFVA 1UOVA 2VAJA 3IS0X 4KJWC 3FMGH 4DGYH 3CZFB 1QG3A 1MFAL 4GQQA 5IJCC 4Y88A 4YOKA 5GPRA 1G7PA 1RK1A 2F53A 1Q1JH 5H37H 3QNXA 1HOEA 1A9EB 5BS0D 3BO8A 2VJXA 3T3ME 1A3LL 1ND0A 3BKYH 4FMVA 1D7BA 3T6ZA 3I50H 2F54E 4BSJA 4MXQD 4KAQL 4BA0A 1R3LA 1T6BX 4CC0A 3P0GA 3BC9A 1NINA 5I1HH 2NNAB 3BHBA 4QR7A 5LHDA 4PGDB 2X2YA 4HAGA 1NBZA 1XIWA 3W39A 3QDME 1KPUA 4G8GD 3OKNB 5G2DA 3BAXA 5MEOA 4WNQA 3V4UH 5D1XC 1F3DH 2F6AA 3T3PF 4N2NA 4WK0B 2VTFA 2FLMA 3TBVB 5I66A 5F3HA 3SQRA 3EO1B 4C83A 2NQCA 1SJXA 5L2JA 3RTQD 1ZV2A 1QZ1A 2UZYA 4L1TA 2X70A 5DU7A 1WTGT 3D4YA 3QPXH 2B4CC 2V7NB 1I7UB 1ASPA 1RZGB 5MHSD 4P99A 4AJ0A 4HUVB 4LPXA 3UO1H 5GS0C 4NM4H 4YDKL 3GXMA 1T83A 3NZSA 4F1SA 5JXEC 1HS6A 2WW8A 1R5WA 2NZIA 3K80A 3MA7B 3FBQA 5GRJL 2HTLC 3EOYG 4DKLA 1QQDA 1WE5A 3S3BB 5D7EA 1AYOA 5TK2A 4PRAA 5I8OH 3AWEA 4EUPA 3BPOB 3H42H 3PDOA 4PWGA 4GO6B 1CLYH 1I1FA 1I8UA 1RUML 3VXQB 5HYEA 1OP4A 1U6AL 4Z7VA 1JJUA 2R56H 5KEZA 5DJXA 3T65A 2F7PA 4LBEA 2OM5A 2IOIA 3VXSD 4D94A 4F57H 1D5ZB 3V7AE 1UT9A 3BN9D 5CJQH 3SGEH 3QULA 3NFNB 4WLCA 1D9KC 3QO0B 5EZIH 5HYSA 3A6BL 3VXNA 1CXKA 1P69B 1JVOA 1T1ZA 1AO7A 4ONGL 2D73A 4RQQA 4X9HA 5B3JE 1A6TA 3HNTL 4Q6IC 5DD1H 1YC7A 3TGXA 1QHQA 5DJ8B 5EIIA 5JW3H 4O4YH 4UQCA 2WTRB 2HRGA 2I25N 3W0WD 3BZEA 1BBJA 4TLUA 3CMGA 3UABA 2GBUA 2WHVA 3SDCD 2BVYA 2GSIA 3DX7A 4JFSA 3M1OA 4M8RA 1YNTA 2MQ0A 3NPSB 4AQAA 2QTEA 5M94B 3VXTB 3WMQA 4I77H 1E2ZA 1JFPA 5IFJB 5TD4A 3NIFF 1FVDB 3DJRA 5HD8C 4OJFL 2CMRL 3G6DL 5DGQA 4OM1L 4CVWA 4Z77A 3K0WA 5DZJA 4AK2A 4BSVB 43C9A 5G4MA 2BHFA 1CXIA 1IBGH 1KGCD 5ERWA 3T45A 1OTTC 5TDPB 2VXTH 2VR9A 2R1YB 1IM3D 3S5LB 1UWXH 4JO5A 5A44A 1BJ1H 1K9TA 1MCPL 1CE6A 1YEJL 3FT3A 3MROA 4PRPA 1ZPLA 5AX0A 4GRLA 3N91A 2FBJH 4WUKL 4X6BA 2I60L 4J3XA 4MS8D 4UOZA 4F5CE 1XCTB 2IPTL 2QQNL 5B1JC 2O4EA 4BVNA 3ARFD 4NUMA 3SDDC 5JW5B 3VE0A 1RUMH 1Z9LA 5C0CA 1AZVA 1KCLA 1BOGB 4LVNC 2YEZA 2B1HH 4MYPA 4U1SB 2OCFD 5BJTB 4HJGB 2QR0B 2UUDH 1V10A 1DQQB 2QFRA 3QORA 3W3BA 5E4EC 2ITDA 1A7QL 2UWEE 1L7IH 2NSXA 5TE6L 3P0VL 1PY0A 5E2TH 3E0GA 1G6VK 3VXRE 4PV1C 2R23A 3IXAA 1F18A 3UBXB 2EUVA 3PQYD 4LMQE 4YSQA 2X40A 3HNTH 5E1IA 4BDVA 3IAGC 2L7QA 1ZGLB 3SCMA 4F9LA 3F7KA 3M17B 1A4KB 3TA3C 4A7SA 3U1SH 4HJ0D 3CFEA 1QPPA 4A2LA 1TTCA 2H45A 2XPYA 4F7EA 5D5MA 3UAFA 3DBXA 3V5KA 5I8CB 4G2AA 3FTYA 4TLKA 2A6KA 3IGLA 1T22B 1IKNA 1N10A 5HVFB 5KYWA 5FA4A 2NT1A 5BV7B 4MFHA 4FKEA 3UOAB 3ZE0B 2K45A 4QD2E 1QRNA 3ZKMC 2DMCA 2W8CA 3NACH 1UJ3A 1F3DJ 2BP8B 5I5IA 5FO8A 1CFMA 5C0JB 2ZKHH 4WV1A 5ELIA 1H19A 3O3AA 2EH8H 3MNVB 5HHPB 2AQNA 4JL1A 5DVPA 5T3ZH 3ZTJH 2DICA 4DK6A 5AAWC 3X13B 3WG7B 5F7EH 5MEQB 3RFZA 2V9UA 3Q5YA 2LAGB 3LKSB 4L8SA 2FYYB 2HZHA 2EDKA 1NKRA 1AIFA 2WZ0A 1ANUA 4LOFA 5CJOH 1U8KA 3NT0A 4NRXB 5H2OA 4LCCA 5EPMA 3QDHA 4H88H 2F19L 2FJFA 3OX8B 4FXLA 5IK3A 1TETL 2WLIA 3JTTA 1Q72H 2Q7NA 3SJVA 1E7UA 5IWLA 1J0YA 1CDIA 4C8XA 1K2DB 2X44D 3EIFA 2OZ4L 2FK9A 4W9ZA 1TZIB 3UTTE 3ZHNA 4OB5L 1WS7A 5CZXD 4EXKA 1YYML 4PJ8A 4D9QE 1C08B 5AW7B 3NSXA 1P4UA 3EFFB 4V2BA 1AG6A 1ZV9A 4Y0GA 4PJDF 1NGYB 1J9SA 4TUJA 1SYSB 3MRJA 2DEWX 1M71B 5JPNA 3VXPB 1MVUA 1UWYA 2OCJA 2EECA 1IZKA 2HFEB 4I0PA 4KK5C 4V1DD 4AEHH 4P07A 1Y1DA 2J12B 2IH1A 2Q5BA 5F1OB 4ZBJA 3SPCA 4GW4B 5IMKB 2BXYA 3Q8BA 5KJRH 1H9DA 2OJ1A 1G7JB 4RGMC 4X9FA 1PD0A 2ZF8A 1RJLB 1GH7A 2R4SA 3NBNA 1E5UI 2WUCL 4K5MA 3T2PA 4QO1B 3MZTA 1VENA 3BP6B 5SX5K 2NNXA 1P7QB 2AK4E 4FQ2L 5EU5B 5C97A 3WN5B 3EGDB 3UPCA 5F3BB 5TPWL 5J1AB 5JLZB 1BZ7A 3LCYA 3IDGB 2JELH 1I9RL 3DETC 1HQRA 4H0GA 1CBVL 3R18A 4DAGL 2VXQH 4RFOL 3IWUA 1YMMA 5J1SC 5T8IA 1XGUA 4JPVL 4XXDA 4AJWA 4C57C 4JS7A 1OCWL 4G7YL 1S7SA 2Q3AA 1D5BA 4HSAC 1LWHA 3W9DB 3BVUA 3OR7A 1VHPA 4YSAA 4W9GC 2LU4A 4ZX4A 2FJGA 3ARYA 2N0MA 4JREC 4KTYA 2DBJA 4PCSA 5D1QC 2BIPA 2DOCA 3SPHA 1B0GB 2F2HA 4M48L 3EXJA 3GK8L 3MRMB 3IU4H 2Z8SA 4GBXB 1ZS8A 5KJ7E 2JCCB 3GLEA 4DP5X 4AL8L 3WTYA 1HE7A 3B8SA 1IKOP 5EUOE 5HHQA 3NAAL 1BJ1J 2C9XA 3VB8A 4CMHB 2CUAA 4KI5F 2FECL 3NDYE 1CD8A 4PJBF 1JI2A 1KJ2B 3VTMA 1ILUA 4E0RB 3GXIA 2YCXA 2I7OA 2XIDA 5A2CA 2VR4A 5TQ2L 5ENWA 1JNHA 2Q8BH 2WLJA 4N5ED 2Q3XA 4GRMB 1LN6A 3ZDYF 4AQZA 1VZHA 5FHBL 3BPCB 4MVBC 4QRPE 5EU6B 4YPGB 4NZRL 3JWOH 3BDXA 4DQOL 2JB5L 5GGQL 3US0A 3UGXA 1LK2A 4Y2OA 4DGIH 2V7HA 5DEFA 4H8PA 1DQKA 3AREB 4Q8BA 1WBXA 1BGXL 3CDGA 3QIBC 1KIQA 1R1CA 4RMRA 4Z7UE 2FQEA 1BEYH 1GY1A 4AH2B 2CGZA 1IKFH 2OULB 2XN1A 1CZ8H 5FW7A 3C6LA 1C5BL 3TA4D 4XHJC 2OMTA 3HE6C 2XTJE 1X6NA 2AEQL 4G8GA 5IR1B 1U8OB 2YD3A 4PTTA 5J6GB 1NCBL 3QZBA 4JVWA 4YHPA 5FM5M 2YO3A 4MD4A 3JVGC 1YEFL 4PS7A 2DWTA 1GW6A 1R3KB 1DEEB 3Q3GB 4GB9A 4Z0XA 2OW6A 4G9FA 5FUCC 5HJ3B 3X11B 2EO1A 4YSUA 3IFLL 4PRHB 5C71A 3B2MA 4LLDA 4N1EA 5CGBA 1MLBB 2PTTA 4TNWK 4FLHA 3K6OA 1MIEL 4MDJA 3QYMA 3Q6FB 2FIKB 4JDVA 1FPTL 5AW9B 1JYXA 1TZHB 3GK8H 4KK8C 4N6RA 1HEHC 3BE1L 4OGXL 5D2LE 5L8KB 5GSVB 3ULUE 5IBLD 5JUEL 1TF4A 2JXMB 4ZS7H 3LOWA 1E8ZA 4QI3A 3VFUB 4NZJA 1BQHG 3VGDA 5BUAA 2GCYB 4IBQA 4JFEA 5CEZE 3SPIA 2OAAA 3EH2A 3N06B 4PJXA 1UZGA 1YA5A 5GZOC 5FYKU 4ZXBB 2JJSC 35C8L 1I9IL 1UASA 2RGSA 5C0EA 3UTQA 1I75A 2R0LH 2C7UB 3DRQB 5F9JA 4XVSH 1EXUA 1P5VB 2WSKA 2OX5A 1DQLH 3MCLH 4M1GL 4FLQA 2D7NA 1NWPA 5E5MA 4M7LT 1ILSA 4I3SL 2COQA 1MI5E 5J7CC 3M8OL 1JGUL 4JO3H 3O2DL 4WKZB 2VXSH 1U91A 3FFCD 5IW3A 3KWTA 1JTOA 1BIIA 4UQAA 1MH5A 1G5AA 1XXDC 3MJ8B 4BKSC 2BVOA 4EZLA 3BCDA 4X1HA 1D2PA 2AVGA 1WWCA 3AW5A 4KKAC 4AQEA 4Y2DB 4X9GA 2BC4B 2BNQE 5D6CA 1KBGL 3GHEH 1OGAE 4P3WA 3CXFA 1D7DA 3BP5B 3IJYA 4MB5A 3MNWB 4XMUA 4WO4A 4NKDB 3T6QC 4MHHI 2QADB 4CVXB 3MRBB 1CDJA 4RISH 4GG6F 1GL4B 4K5OA 3IVKA 2NLJB 2YQGA 3B5TA 3L95B 3HZMA 2H6OA 4JFQA 1A2YA 2DIJA 1A3RL 3MFGB 3PP4H 1NGXB 1T89A 1NFDE 3FUKA 5DO2C 5KBMA 1N0XL 4LGRB 5A3ID 4L29B 4NN6B 3SE9L 3BAIA 1XZ0A 1NCCL 2ZUXA 1DQIA 1I31A 3UYRL 2HN7B 4E9YA 1BD2A 4IHBA 2KZKA 2YEQA 2LLGA 4H2CA 4ODXA 5PCYA 2YR3A 4ISVB 3D3VE 2YKLH 4XO8A 5CEXA 2WAQA 1RU9L 1CIDA 3GI8L 3HPJA 3STLA 3BE1H 4OGXH 2DQTH 5AVTB 1YJDH 3IDXH 2PCYA 2HH0H 1IV8A 3N42F 3PWHA 2DIEA 4YBQD 1GGUA 5JUEH 2HRLA 3VAEA 4FEMA 5AW2B 5FM8A 3L7FB 1KG8A 3CFBA 3HASA 2WLHA 2HP4A 3O3EA 4Y1TA 1SJHA 3QAZC 4IMKC 6FABH 3PJSB 1A6AB 3EYUH 4IBLT 1AZUA 4BK4A 2AJ3A 3D25A 4UAOB 5EF1A 2XRAH 4IDLA 2ADFH 5D7LB 1SXAA 4RGNB 1PL3A 5FHAH 4LCIL 1LK3H 2EIZA 1A6PA 4IBSA 3VNZA 1F1AA 1AACA 4J8QA 3HW7A 4M1GH 3LKQA 4ZSOA 2GTWB 3O6KH 4PTUA 4AIZB 1R5VA 3NIGF 3OKLA 1J87A 4G72B 1TPXC 1RULL 3PS6A 2DMBA 1HHKB 43CAA 4UTAH 4XPBL 1T1XB 1E9QA 3FYEB 2CD0A 4IGBD 4M62H 5IQ9A 5SWZD 5TDOA 3UGEA 1MFVA 2D31B 4HUKB 3FCTA 3WS3B 3QJUB 5CBEA 3WTVA