3QJQB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjqB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjqB02
1ETJA 3AG4B 4IB4A 5B0WA 1WAEA 1ZPUA 2BZCA 2CCWA 5G2AA 3PAZA 4AZUA 3UTYA 4RH4A 4BWWA 1ZIBA 1W6LA 4E9XA 1TEGA 3PLYA 4E9SA 1JZIA 1P8HA 2EI4A 4BV0A 2GI0A 3EF4A 2YCYA 2R4SA 4QIDA 3FSAA 1MZZA 4HIPA 3WI9A 3WNJA 1SF5A 3T6WA 2XV0A 1SFHA 2IWFA 3HASA 3SBQA 2JAFA 1GSKA 2ZWNA 4BDVB 1MDAA 3NSBA 1IBZA 4CSZA 2NRDA 3OMIB 1ASPA 1SHXA 2HXAA 4XXJA 6PAZA 1NIDA 1QM8A 4JQ6A 5H2IA 1VJMA 1ILUA 3CZUB 3NP3A 2ZOOA 4K5YA 2DY2A 3GDCA 3NJIA 2PP9A 1BXUA 1DZEA 3ODUA 5J7AA 1ID2A 3FSVA 1F50A 5H2OA 2IDSA 4PXFA 1SF3A 3FT0A 2BW5A 1BXAA 1AIZA 3HANA 1KDJA 2E86A 4JR8A 1S8JA 3PBLA 5AZDA 4L0PB 1XB6A 1S53A 4DP5X 4KO5A 1H68A 1J5DA 1HFUA 2VW4A 2XV2A 5AHZA 1GYCA 3QBGA 3CDZA 3DKHA 1KBVA 3ZDWA 1ZDQA 2XUWA 1AZNA 2G87A 3NJKA 5A45A 3ERXA 1S51A 2VT4A 3N55A 3QBKA 4DP0X 4E9TA 1AQ8A 1ET5A 3D4SA 1KYAA 1O0AA 3DQBA 3CODA 5B6XA 1FFTB 2Q5BA 2IDQA 2YAQA 3OE0A 5D4JA 1HAWA 3N2JA 3T71A 4JHVA 1QNIA 3AW5A 1BAWA 2VSMB 2VW6A 1X0I1 5AWZA 3WKQA 2YCWA 1JV6A 4IAQA 1SDDB 4G71B 3OE6A 3ABGA 4QI1A 1VLXA 4AKPA 2PPCA 4UAHA 4JKVA 1W6WA 2OV0A 1FA4A 5I6OA 2GHZA 3QAKA 4W1TA 3PXOA 5B1KA 4OV0A 2DV6A 1X0K1 5H2MA 5H2LA 3AYMA 4N6HA 3AG1B 2AFNA 2ZONA 3HAPA 8PAZA 3P0GA 5B35A 3QAPA 1GZMA 3UZCA 1CURA 1CYWA 5B6ZA 2VW7A 3RFMA 1AZRA 4F2EA 1PNCA 2PPFA 1P8IA 2Y04A 1BRXA 4Q8BA 3WKPA 9PCYA 1ADWA 1QKOA 5G2CA 2HZHA 1L9HA 3T9WA 3VI0A 1JXDA 4MBSA 2PPAA 2VN3A 3FU8A 4YSRA 3QJQB 3QJTB 3COCA 1UATA 2H47C 3FQ2A 4NAJA 2YAOA 3X1BA 4FPDA 3PAUA 4E9RA 3EMLA 1NZRA 2HX8A 1X0SA 4XT3A 2AANA 3FYIB 4DP8X 1PF3A 1FBKA 3VG9A 2LLNA 1RZQA 5H2NA 5DHHA 2Q9OA 5D4IA 2UXTA 3UONA 3CVCA 4XTNA 4HCFA 5BR5A 3ZIYA 4DP1X 5B7MA 2J56A 2XXFA 4X31A 2IAAC 4A66A 4YSQA 1IBYA 1RZPA 1GR7A 1V54B 2MRYA 2GBAA 2AZAA 3HAOA 2GIMA 5B34A 2XV3A 1PY6A 4P5SA 2RH1A 2OCCB 4DP7X 5F7BA 2IH9A 1NICA 4YVNA 2J55A 4GYCA 2Y69B 3JTBA 1JXGA 3NSDA 4MFHA 3X1EA 2N0MA 3FPYA 5TK4A 2Y02A 3BQVA 3X2QB 3NYKA 1J9QA 4UG2A 1OCOB 3PPSA 1R84A 1A8ZA 1E5YA 1PLAA 3L45A 4HALA 1J9SA 3IE9A 3PXLA 2JXMA 5B1JA 2BP0A 2YCZA 4A2GA 1IW6A 1NIBA 3V2YA 2BWDA 2DYSB 1GU8A 3RZEA 2PCFA 3GYRA 2NTWA 4GP5B 4QRYA 1ILSA 3ABMB 3NT0A 3OM3B 2YAMA 5FJGA 4HHGA 2MTAA 3UTVA 3S3CB 1AACA 1AANA 1QLEB 2XXGA 3UAAA 2PLTA 4A2HA 3H56A 3UABA 5A8EA 3AM6A 2BP8B 1M0KA 4AKOA 4DP4X 4NC3A 1NIFA 4KNSA 1IW9A 2ZFEA 1WS7A 2P80A 4BXVA 2FTAA 5B3SB 5G2DA 3REYA 3FU7A 4E9YA 2FWLB 5I6PA 1XJIA 1NPNA 5H2PA 5DHGA 4MD2A 3NY9A 3U25A 4XT1A 3AG2B 1NTDA 1JVLA 1C8RA 2OJ1A 3FPXA 2HPYA 2LNLA 2R7EA 3IN0A 3KW8A 5I6LA 5IY5B 2Z55A 2TSAA 1MGYA 2W8CA 1Q5JA 3PDSA 4LDLA 3UTWA 2WJLA 1URIA 1BYPA 4YSCA 4HHWA 2EIJB 2HX9A 5TK2A 2QPDB 2CAKA 4YSDA 1L9TA 4G7QB 2XYBA 2CUAA 3UACA 3QBLA 3VW7A 2X88A 4KO6A 4BUOA 3T6ZA 1NDTA 1HZXA 1TU2A 3HEIB 2EILB 3X1GA 2KSYA 1T5KA 4E9QA 4W9ZA 1VGOA 2RACA 4L35A 3ABLB 4YL4A 1NWOA 2YAPA 3MX0B 3ZX1A 3S8GB 1SHWA 4CSPA 3VHZA 3C9LA 3GXUB 4A2EA 4YSPA 2Y1AA 1AG6A 3FSZA 1A4AA 2L6XA 2YQBA 4MQTA 4QKTA 4YSAA 3OQRA 3V9EA 3DTUB 3FQYA 5JJJA 1SNRA 2B08A 3H4HA 4P5RA 1QHQA 4DKLA 5B1JC 2GC4C 3X3BA 2CBPA 3V9CA 2I20A 4EJ4A 5DYSA 4YVUA 5I5JA 1Q5IA 1F56A 1GS6X 1TKWA 1IUZA 2FQEA 1GW0A 4HAKA 1BRRA 2PPEA 2XU9A 5E9NA 3WG7B 4GPOA 3NJMA 4DPBX 3T6VA 1A65A 1NINA 1OCCB 1AP9A 3SBPA 4AMJA 2HRGA 1S52A 4HYXA 5AX1A 3QJUB 1E65A 2UX6A 3EH5B 2FT8A 2F95A 5PAZA 1PAZA 1RKRA 2M3GA 4EA3A 5KKHA 2PEDA 5B6VA 1AT9A 3NSYA 1OE3A 1JZGA 3AZUA 4DP9X 3FYEB 2PCYA 2I7OA 3DIVA 3HB3B 3NP4A 1L9SA 2IDFA 2DWSA 1CC3A 1LN6A 1CUOA 1PLBA 1M0MA 5G28A 1L0MA 2XX0A 1X9UA 1KGBA 4PAZA 4JHUA 1YLBB 4G72B 1A4CA 5ITEA 3X3CA 3OE9A 1AS8A 1PMYA 1XB3A 3H4FA 2EIMB 2UXVA 2FT6A 1MZYA 5LDUA 1PLCA 1XIOA 4X32A 3ZBMA 3IBOA 4K9JA 1SDDA 4A2FA 1SFDA 1PY0A 3PQRA 4GP4B 2FT7A 2X87A 1M9WA 2HLEB 5F8UA 2FJSA 3EH3B 1JZHA 1F4ZA 1QHJA 2BRDA 4G7SB 4N4WA 1B3IA 4BEYA 1FWXA 1JZJA 3WQJA 2I7SA 3UTXA 1KGYE 3TBCA 3OAXA 4MQSA 1R1CA 1KV7A 3ABWA 1JVOA 5EN0A 2YAHA 3ASNB 3SQRA 1EZLA 1AG0A 1KBWA 2YAEA 1BM1A 4DJHA 4DP2X 1E0PA 3CAPA 1AS7A 3NJFA 4BEZA 3UG9A 1A4BA 3CVBA 3QPKA 2Y03A 2XX1A 3AY2A 4XTLA 5G54A 3OD3A 4TL3A 4N4YB 1KG9A 3FQ1A 4PCYA 2BW4A 2GB2A 1JERA 3NJJA 2JAGA 2EINB 3ZPQA 5B6YA 3G5WA 3OE8A 4UF7C 5I6KA 2F93A 2HX7A 4M4RB 5EHFA 3VVKA 4MD1A 2WO3B 1PXSA 2QPEB 5AKRA 1IXFA 1HAUA 1KCWA 4F2FA 2I85A 2KS9A 1CWQA 3EHBB 3X1FA 4NB7A 3X1NA 1GS8A 4Q89A 3MBWB 5A7EA 2KSBA 2Y00A 1ZV2A 5B7FA 2P80D 5H2KA 4YSOA 2I35A 2H3XC 1PZCA 1F88A 2XVBA 1AZUA 2VSKB 3NJNA 3HAQA 3TU6A 1AR1B 1ASQA 4WTQA 4GBRA 3AG3B 2FNWA 2R7EB 3S3BB 1J9TA 4GXFA 1AOZA 1UCQA 4XTOA 1AS6A 1M0LA 4GP8B 2QDWA 2YARA 3WNIA 4HCGA 4QLWA 5I28A 1PNDA 1PXRA 2YDOA 3TASA 1ZIAA 1FBBA 4AMIA 2AZUA 3RYMA 4BXSV 2XLLA 3BVDB 3TBBA 1JV7A 4UHRA 5H2JA 5I26A 3PWHA 4FA7B 4G7RB 2BP8A 4KOCA 1QKPA 3NYAA 4F7KA 3NSFA 3ZPRA 1OF0A 1IKOP 4LDEA 4E9WA 1WA2X 1OE2A 4YSSA 2J5WA 5H2HA 2NTUA 4YSUA 4KNTA 4KNFA 2VMJA 5B2NA 2BO0A 3PAVA 4ZK8A 5JJNA 1L9RA 4BDVA 2VM4A 3QJRB 5B7EA 2IDUA 3CDZB 3UGEA 1TN0A 1OE1A 1PCSA 1DYZA 2AVFA 3FS9A 1BQ5A 1JXFA 4A67A 2ZIYA 2J4YA 1JZEA 1ET8A 2JFCA 1MG3C 7PCYA 4A4MA 4BVNA 1GY1A 2UXFA 4DAJA 4AKQA 1OCRB 4EIYA 3OMAB 1V55B 1X9RA 1M57B 5B1BB 3JT2A 3OMNB 5FC9A 3UAEA 3ABKB 2FQGA 3S8FB 2IWKA 4UANA 2GSMB 4TXVB 2JKWA 3FU9A 2H5UA 5G53A 1L9OA 2VM3A 4FAAB 1L9PA 3NSCA 3ZEVA 3UADA 2PP8A 5AHYA 2I21A 1I53A 1NPJA 3T6XA 1TN5A 2AT9A 3SN6R 4X4KA 3DDLA 4WW3A 2BHFA 1GUEA 4BWTA 3FSWA 3ASOB 4KLYA 2UXGA 2KSAA 5D4HA 5B1AB 4DPCX 1WA1X 4KNUA 1H2SA 4L6RA 7PAZA 4GY4A 1S8LA 4HYJA 2J57A 5ITCA 1EHKB 2BWIA 2YXVA 2I1XA 3PCYA 5G36A 4HCIA 4AX3A 1DZ0A 3C75A 1E12A 3D12B 1W8EA 4X1HA 3QJVB 3NY8A 2CJ3A 5A44A 2QT6A 4KO7A 1OV8A 4BWUA 4M3HA 1AZBA 1OCZB 2A3TA 5I5IA 4YSEA 4PXKA 1M56B 2CALA 4E9VA 4HZ1A 4ENZA 3NS0A 4KO9A 1R2NA 2FQFA 1NIEA 3NJHA 2R4RA 1JOIA 3QJSB 1ASOA 3QDCA 2YAFA 4BWBA 1AAJA 4N8UA 5ANHA 5AZUA 1PZBA 4A68A 2XWZA 4DPAX 2X72A 5TGZA 2ZXWB 1JGJA 1OOWA 2DWTA 2WSDA 4A2DA 1BEXA 1A3ZA 1IC0A 4JKNA 4KOBA 5BR2A 2YCXA 1N68A 2IH8A 2ZZLA 3NJGA 4FBZA 2PPDA 1KG8A 5LWEA 1BXVA 2UX7A 1CYXA 4DP6X 1UAZA 2Z73A 5PCYA 5I5MA 1KMEA 5AFAA 2DYRB 3EH4B 1J5CA 5AX0A 3QQXA 1V10A 1SJMA 4Y9HA 4LDOA 3TA4D 5I6MA 3C9MA 4GYBA 4GRVA 1WA0X 1XB8A 4AI7A 4IARA 2WJKA 4WAVA 1E67A 3MBVA 3IEAA 1JZFA 2BZ7A 5I6NA 3S3DB 1ET7A 2BP0B 3NJLA 2GC7C 4YSTA 3T45A 1BQRA 1PZAA 1JFPA 1GS7A 4J4QA 1BQKA 1C3WA 2YDVA 5C1MA 2HRHA 4BK5C 1KDIA 1J9RA 3QBIA 1P8UA 2FQDA 3SBRA 3UZAA 1GY2A 2QDVA 1U19A 2Y01A 5B6WA 6PCYA 2IDTA 4WKXA 3A7KA 1XMEB 2EIKB 3KJ6A 2WO2B 1TEFA 3KW7A 3FU7B 4HWLA 4G70B 1L9QA 5ETZA 3WIAA 4EF3A 3CG8A 1ZDSA 1BYOA 1E5ZA 2IWEA 2YXWA 1N70A 5F7AA 3HARA 3CVDA 1AZCA 1BRDA 3V2WA 1C8SA 1KCBA 4NERA 3AYNA 3VGAA 3IN2A 1MG2C 1WS8A 1RCYA 1NIAA 2B3IA 1S54A 5JJEA 1E30A 1NWPA 2PP7A 2TSBA 2W88A
chains in the Genus database with same CATH superfamily
2E76C 3WUWB 1E5CA 5GRJL 2YN3A 3HB3C 1N0XH 4JN2B 2P5WB 2PYEB 1AQMA 3FUHA 4UQBA 2VL4A 1WAAA 2IWFA 2MWCA 3QZOA 4O4YH 2XN9E 2ZWNA 4I8DA 4D0BA 1ZVYA 4YE4L 3A4DA 4BV1A 4XWOD 5JHLA 2XZQL 1CQKA 3L16A 1TETH 4MQTB 1FIGH 1XXDC 5D2LE 3ARSA 1WVZA 3MOQA 1CQYA 4FTVD 1BXUA 4NN5B 3ULSB 2VXVH 5SWZE 3FF7A 4OLXL 2CIIB 1HWGB 1QEWA 3B5HA 5IGXL 5KANG 3NCJH 3ULUL 4FFYA 4UQ3A 4WQOA 1RFDL 4FX5A 5FW8A 5INDB 2F8OA 1M7DB 1OGSA 5H2BA 3HS0B 4RNRA 3O9WB 1J5DA 4UT9L 2HG0A 4RMUA 3NVQA 2ZQKA 5GZND 2G2RB 4FXLA 3HZMA 1AZNA 2DQGH 1OCWH 3NIGE 4DP0X 3CFJA 4J6RH 3GBNH 2H45A 4I9WD 3UL4A 4LPTA 2XKNA 4MDIA 4N25A 2CHNA 3U0TA 3ZR6A 1WFJA 1UM6L 1W0VB 1WICA 4JB9L 3FCBA 5JLZA 5CIPA 5DQ9B 2YKLH 1QKZL 1AZZC 1JBJA 4B9JA 2V5YA 4KUCD 4G8GA 3KE0A 3E8VA 3FULA 4L8DB 4W1TA 3PXOA 5I73C 1FFQA 2C9PA 3AYMA 3PHOB 2KZKA 3VJ6A 1S5HA 4BRJA 1XIWB 2X4RA 5AW6B 3QORD 5TQ0H 5BRZD 4DNLA 1TVDA 4QHKJ 2AJZA 1PNCA 4JFYB 5T8IA 5IB2A 3NEOA 4XP9L 5DVMA 1U8KA 1HX0A 3QJQB 2KLRA 2NUTB 4I1PA 2OK0H 3EDKA 2HWZL 3IMVA 4LVHC 1NJ9B 4OLUL 3HI5H 3RFRA 4Y4KB 1MQ8A 4PR5B 3RWHB 2GIYA 4MAYA 2G0KA 2VDMB 3A6CL 1JV5B 5E99L 2KPWA 3TOPA 3W2DL 2YMTA 2GEEA 2ZXBA 4ZXBA 2AZAA 3DLQR 2DB8A 1C16B 2NW2A 4M7KH 2LV4A 4DZBB 4CNIA 3DGDA 3BW9A 3ZDZF 4W81A 5DRNA 2BNQD 5AL8A 2C3GA 4NAQA 3U1PA 1XCQA 2Q76B 2ICES 3TT1L 2VXQL 2PR4L 3BPOB 3C5ZA 4IK7A 1EO8H 4XC1H 1TNNA 5GJTH 1E5YA 1QR1A 3CFDA 3WAKA 2ZOUA 3QK0A 4WW1A 3MC0A 3TFKC 4MJ5A 1OXYA 2M8XA 3HC3H 3DVNB 5JORA 1AE6L 3AWGA 3ALPA 1X6LA 1T4WA 1UEMA 3FO0L 5DHVH 5F96H 5MEND 4Z18A 4Z0XA 4JMNA 3S37L 3DDFA 3IMTA 3NZHH 1DUZB 4F8TA 1R75A 5KOMC 4LDEB 1DJXA 2YRBA 1NPNA 1K4CA 2WQUA 5DHGA 2BRRH 1WQVT 4UMSA 1E7UA 1HESA 3RA7L 3VTTA 4EDXB 2KQMA 3RZCC 1SBSL 5T3XH 3L9EA 2BS71 4JPSA 5CLZA 4YFEA 3BP7B 5HDOA 2CHDA 3EF7A 5KANI 4CBPA 1FCCA 3K2MC 3VXUA 3BAYA 1MUJB 2PCPA 2Z65C 1BVKB 5FO9B 2GK0A 1W91A 3IDNA 5DJ0A 3IMUA 3EDJA 3ZT6A 3LDBC 4BSJA 3LQZB 2D7TH 3QNXA 5E9AA 4I9WE 5HPOA 1JGEB 4U33A 3OJVC 2EVHA 1EEZA 3P0YH 3U46A 1W8OA 3WNNA 2Z7UA 4AJWA 1VZHA 1IU1A 3WIIH 4PVBA 3AU1A 3ABLB 3NN8A 1SY6A 4PGJA 2ORBH 3WD5L 3S8GB 3G04A 3S5LA 1F4YL 3MRQB 3ZKSD 2Y1AA 1G43A 5IESL 5JIHA 5BVJA 5F88B 1R47A 4UBDD 4HPOH 4G59C 7FABL 2ICWJ 3ARZA 4QRPA 4AIEA 2VAAA 1DDTA 1Y6NR 5DJAA 3ARYA 3V0WH 4NSKA 2A73A 2CGZA 2Z1PA 2KH2B 3O11B 5DCCA 1F56A 1XEDA 5A2KH 2AQTA 2NSMA 2VGLM 2WWOA 5FO7B 1WFTA 2FUTA 2X42A 4YHLL 3CMOH 1JGVH 3L9YA 5BRZE 3AACA 3OKEB 5E9NA 2PPEA 4Y5VA 3BUDA 3RIAK 4PYGA 3WG7B 1AMXA 3W0WB 2F58L 2B1HH 4JPWH 5H37H 5IJVA 1CO1A 5KS9F 4OLVH 3V8CA 4HIHB 4M7JH 1S52A 2NY5H 3D39D 3LXUX 5JO5A 1U8PB 5F9JB 3LPFA 3HVNA 4EA3A 2V5RA 4PRBB 4NRXA 1RY7B 1MRCH 2ZPKH 3FCTA 4DP9X 4IGBC 3T0EB 1IC1A 5HHQA 1AQKH 1JPFB 2B4CL 3T0BA 3VSVA 1QSEA 3K80A 4YDIL 3B9KA 3TO4B 1PY9A 3CPUA 1FGNH 1P53A 1NC4A 1MIMH 4TNEA 3BSHA 1MHPH 4LSQL 5LDUA 2BNQE 4ZO7A 4P3CL 4HK3J 2N1TE 4JM2B 3DK0A 5JDSB 4L1HA 1ZAGA 2K9UA 3KM1A 5GZOD 1BZ7A 2IDCA 3NCEB 3PL6B 4MNGE 5D5ME 1OSPL 3CN2A 3MLTB 3A3YB 2IADB 3SDYL 4PJ7B 5TF0A 3HE7A 4XNDA 1AGBB 3KYOA 2W38A 1FNSL 1R1CA 2ED9A 3ABWA 1BIIB 1EZLA 4MMYA 1U8JB 4FZEL 1R0AH 4CSTA 2IV9A 5AVWB 4AIZB 5F7DA 3S35L 4H44C 1BBJB 1A4BA 1FPTL 1VFMA 5CS7A 5FYJU 1JPTH 1VKXA 3MR9A 4LSTH 4XTLA 5DHDA 1JK8B 1Y18A 5CSGA 2MQGA 2NZ9D 5C97A 5C0IA 1NEZB 2IOOA 4RFOH 4YAQA 2EINB 4CILA 4KXZI 3ZTJH 1AO7A 2H2PD 2W0FB 1X4XA 2HT2D 2DAVA 4ZPTB 2NY7H 3MV9D 1V27A 1I85A 1KT2B 4HOWA 1GIGH 5L7XL 1KNOA 4U1HB 5I1CL 3BVVA 1GS8A 2NUPB 3DGGA 2NYYD 4U1NA 1Q0YH 3HG1D 4FXGC 3ESUF 3HLAA 3DOSA 3N42F 4IU3A 3ULUF 4HMEA 5D7EA 5AAWA 4XCFH 1ZLUK 4EN3A 4KHXL 3HN3A 2Y07H 3AG3B 4AQEB 1I75A 3KPPA 5IW1B 4GXFA 4OZFB 3BH4A 4YX2L 4OIFA 2D8KA 3IWVA 5GHWH 5A2JH 5I1IL 1Q90A 4OQTH 5DTFB 5LWYL 4KZDL 3I2CH 1S7SB 2D9CA 3NCFB 2ADIA 4FQQB 3TN0B 4JFFD 3REVB 3RWFA 5ANME 1EAOA 5FA3B 3FF8A 3NIFB 3GLDA 1J0ZA 1WA2X 2C1OB 1I8KA 4WDIB 3W82A 1A7OH 4DGIH 4F3FB 2PYEA 2NTUA 2W07A 4OGXH 5C0BB 2HVKB 1I3VA 4KQ3L 3X3FH 2B1AH 3RUGB 3GNML 3QJRB 2DM3A 4L5FH 4LARL 5E8DH 1E4WH 1RUQH 2QFPA 1YVLA 5KVDL 1PCSA 3DWTA 4WV1A 1JD7A 3D39E 2P7TB 4QKXB 4Z7NF 4A4MA 3VXSA 1TJMA 3CFIC 4AKQA 3GHBH 3HUJA 1H6TA 2WW8A 1FNHA 3JT2A 3QRGH 3ULSA 1FN4B 2LE9A 1BECA 5ACLA 4PJHA 3GLZA 4JPIB 2WCGA 4JQIA 2DN7A 1T1ZB 4BSWB 4GUPA 4P48A 3TEYA 4JDTH 1ND0A 1IRAY 1HDMB 4YHMH 5C09D 2VMEA 1M7DA 1SXCA 1M6UA 5I1LB 4KXDA 1JF6A 3O9WA 2PMZA 3JBG7 3KLQA 5D1XC 4XN7A 3O4OB 3FSWA 1FJ1A 2AQSA 1DEEA 1X7QB 1Z0NA 4PJ9D 2F53A 5KVEL 1F3DH 2BWIA 3PCYA 4X2UA 1UD6A 4HJ0D 3NIDF 3X13B 2EIZB 3ELQA 4HCRL 3X11B 3U4KA 5CEZD 3FW6A 2NMSA 3UPCA 4R6UA 3TL5A 4XVJL 1OV8A 5LNGA 1U36A 4ZMPA 1W0VA 5JYMA 1HWHB 4MZRA 1FLRH 2YGNA 1R2NA 4GAJL 2DD8H 4RVBA 1GTFA 1ACXA 4XBGA 4DGVH 4R83A 4LXFA 1J0YA 4N0RA 5I75B 4LHJB 2RIKA 3L5IA 4KI5C 3BGFC 1AHWC 5B3JE 4BQ6A 5TGZA 4RISH 3SE9H 1BPVA 4OD1H 3E80A 3VA2C 3AJ7A 1M7XA 1A3RL 2MMXA 2O6CA 1UB6A 4JFDD 4PREA 3MV9E 3PHOA 3IFPA 4ZDHB 5IW6B 2DQJL 3ARBC 2R0ZH 4GB9A 4PJIF 3ZE1B 1XIWA 1PU0A 3EYSH 4L9LA 5K1JA 1RK0B 1XL6A 4HIEA 1OGTB 2QTEA 3PWPD 3S36X 3ISYA 4JFYA 5AFAA 2O61B 1CTMA 4GSDL 1J5CA 1QRKA 1I8UA 4TYUA 1RZFH 1P6FA 2ED6A 2MNJB 5HDBF 4U1IA 1ZANL 3SDAC 4ENEC 2NNRA 2X89A 3MBVA 1NJ9A 5CWSA 4Y4KA 3CJJA 5J13C 3LQAH 3RWHA 3PQYA 2H0PA 5CMAA 1JV5A 2P24A 3F01A 1NGYA 2P5EB 3QDJD 4P0DA 3DUSA 4M6NL 3UAJD 3QXWA 1C16A 5B6WA 3ESMA 4DZBA 1NOLA 4PJCE 1OVZA 2EIEA 4JFFE 1DO5A 3K2IA 4N0FB 2ZSWB 1YEIL 4HSCX 1QMUA 2H6OA 5DLML 1FORH 3QEQB 2ZKYA 3GMLA 3U9PH 3UO1L 3CG8A 4PHZA 2ETWA 4TKWA 4Y5YB 2C7UB 1P7QD 1IGFL 2GBUA 3SDXF 3ZL1A 4AMKL 4ELME 1AXIB 4U0RC 4QNPE 1NCJA 3DVNA 4X98B 5CP7A 4N8VG 2AP2A 4QJ3B 1DFXA 5HHVL 1YNTF 3ZDZB 4PW4A 1NWPA 2O5XL 3TEWA 2W88A 4KK6C 4LCWA 5FF6B 2ZF9A 4NNXB 3LPPA 3PAYA 4A7SA 1DUZA 1W6LA 5HVWA 3KCPB 3PGFH 1JZIA 2RFXB 1ZJBA 3WI9A 3P2TA 1MCFA 3ILQC 2CCLA 3WFEH 4EDXA 5C09E 3EXJA 4E41D 1FFPB 4QIRA 4WO4A 4K71C 4HHAB 3EG9A 3MYJB 3BP7A 4NUPA 5AVTB 4K3DH 5ITFB 1ILUA 2D0HA 2BSTB 4UDTA 1MUJA 1UASA 4JANB 2YA1A 4TM9A 5FO9A 1BVKA 1LILA 3G5ZB 3UIZA 3WO3B 5JPMA 2EICA 2WYTA 5J7AA 5DD6A 2YSSB 5FYJD 3S4SG 3LQZA 4UNIA 1MFUA 4JPKL 1K2DB 4UT7L 1JGEA 1I3GL 1M1XB 4QD2E 2VDKH 1U2YA 4YO0B 3IJ8A 4YHZH 4PN6A 4AYFB 5EWIH 3ZUNC 3BGMB 1OHZA 5FCUH 4WI3A 5FYLL 5E1QA 1GYCA 3QBGA 3F7QA 1KEMH 3D18B 3NJKA 1NCWH 2JK5A 2N1KA 5FFOA 4Y2DB 4YUEH 3SPIA 1AQ8A 4KROB 2ZXCA 3BKMH 4RGOH 1F8TL 4AWJC 3VXTA 4NZRL 4FERA 2CJUH 5FO7A 5IVNA 4GFXA 3DX4A 1HNGA 3ML8A 2HKFL 3OKEA 3OJDA 1YJDH 4HSAC 2VW6A 3MNVB 3PWPE 5AWZA 4MJ4A 2Z92A 4ZFOL 4I48B 1Q94A 1F4WH 2W94A 4GMSH 4HIHA 1GCFA 5DJXB 1MCQA 2YD8A 1U8PA 3P3SA 5CZXC 3N1GC 5AL0A 1AXTH 2GHZA 5F9JA 2DQUH 3MNMA 5H2LA 3QWNA 4WTZG 5KTEH 2CGYA 4FQXC 4TSBL 4HKJB 3QC5X 3OHMB 3KR3L 5B35A 2VDNL 1UCTA 2BCMA 4B9PA 2N0KA 3QDJE 4P4KC 5EO1B 5D70L 1JPFA 4OZGB 4Y8DC 5KS9B 4CGUB 3E8UH 1II4E 2NCMA 4PB9H 4UILL 1PKQB 1TTUA 2H47C 3JVGA 2XQYG 3M1BB 4JM2A 3SPVB 1U3NA 3ARWA 3EMLA 3TYGH 3PL6A 1AGFB 4ZX5A 3VG9A 2EDYA 1KBGL 3DPBB 4YHPB 4GAYB 3VFUB 2VQUA 2IAAC 1AGBA 2FBRA 1K4DB 3PHSA 4GQ9L 4LKCA 3OKLB 2DQTH 1EXUB 3L4CA 3F58L 1BIIA 4BCXA 1WWBX 5D6DC 5AZ2H 1SOQA 2VRKA 2OULB 4DTGL 3BOVA 3M17A 4GYCA 4FMVA 4L0ZA 4Z7QE 3SSGA 3IMBA 1ECZA 2XG5B 4KMQA 4P49A 2Y02A 1JK8A 4W9DC 3QULA 3KEDA 1NEZA 3FB8A 3ZKMD 5KVGL 2AW2A 4BM7A 3V2YA 2BWDA 1UJTA 4E41E 4X6CF 1QNZL 4AEHH 1AY1L 1KT2A 1U8MA 2DTML 4QJ5B 2JIXD 4WJ5B 1BF5A 3I9GH 4GG6F 3N43B 4M1CD 1YUHB 3UABA 3AM6A 4U6HB 5EBGA 3CWGA 4BFEA 5IG7B 1MCOH 5FYJE 2JCCB 3JWDL 2FTAA 4M6AA 3RHWF 4ZUSB 3ZGIA 2Q10A 5DRWB 1CD0A 4MVBC 3L3OB 3NY9A 4XT1A 4AQEA 1YYML 1CDYA 2ICEB 5E1HB 2E8ZA 5K9KB 1EPFA 1HKLH 1TDQA 4J3UA 2VERA 5AYUL 1CLYH 2ENYA 2R29H 3BXNB 4FN0A 5DTFA 2Y7SA 3TV8A 3KNBB 2F19H 3U2IA 1N67A 5AOIA 1QUPA 3LTVA 1MRDL 2PXYD 4FQQA 3REVA 1ACYH 4ZMTA 4QXTA 1XCWA 3IXAA 5FA3A 4GXVH 3VFNA 1NGPH 1RZKL 3VXMA 4NWTH 3ATBA 4WDIA 1CGSH 1I8AA 4F3FA 5DEZA 5F9WC 5C0BA 1WEJH 5ES4B 1HYSC 3VHZA 3KGRA 2ZP9A 3HC2A 1G7HB 5H8DA 3VQLA 1CE6B 3DURB 5D96C 2VKWA 5AB1A 4G3YL 4ISVA 1KBBA 2Z31D 1Z66A 2JTYA 2P42B 5IB1B 3V9EA 2P7TA 1GKEA 1LP9B 2OZ4H 3JZ7A 4JN1H 2CLZB 1U3HB 1SNRA 5IEKB 3J07A 4KKBD 4G42B 1QRNE 2DM7A 2DQFA 4IRZH 4X50A 3MLRH 4EJ4A 3RG1C 1IGCH 1JZ2A 3QUKB 4JRYA 3RVVC 3QEHB 4EIUA 1S2EA 1G4MA 2G3NA 4RDQG 3TVMB 3W9EB 1HDMA 2FIRT 3IRCA 3FH7A 2J8UB 1OCCB 1IILE 4AMJA 5G4OA 1UKQA 4OSUL 3TNNB 1KJVA 1DVFC 2X53A 4W9CC 4NYLB 1UKTA 5EU4A 1NKRA 1QYGH 3ZKXC 2YMXL 1KGUA 5B6VA 3CAFA 5IUCA 2BFVL 3AZUA 2VE6B 1CS6A 3X13A 5EOTB 4NNYB 5C6TL 4GRWF 5C0JA 3FO1A 1DVUA 3LRGA 4JLRA 1O6VA 3EOAB 4G9FB 5G28A 5J6SA 1KGBA 4ETYA 1FNLA 1YLBB 3NPSB 5CEZL 4RWYL 3G5XB 3AUWB 3GSXA 4G7YH 3ECVA 1KJ3H 2FX9H 4S1DC 1XIOA 4X32A 3RWEB 1C8PA 1PY0A 4MD0B 5F93C 3SE6A 2JI2A 4NN7B 1FCGA 1IO4C 1JNLH 3WO4C 4L4VB 4F7CB 3NRQA 5E9DE 2G9HB 2DH3A 4XAWH 2IPTH 4G7SB 3BIKA 3WQJA 2I7SA 2IANE 4YOKA 3I85A 3GHEH 3TBCA 4P23D 3QZLA 3FTWA 4ZDHA 5IW6A 3OJ2C 1QBML 3WENA 4DJHA 2Q1EA 5C2BH 3EJYC 3C8KA 5FM8A 1BBDL 3CVBA 3QPKA 1OGTA 1UHVA 4GQQA 5KSAC 2YD6A 2CWRA 3EGSA 5CN2A 1EO5A 1YEKL 3FHQA 5J11C 4GO9A 4TOYL 1YUKB 1YEHL 1KZYA 5E56A 2OJZL 1NAKH 3PP3K 4H8VA 2CO6B 4ETQB 2WANA 4DUVA 4UV7H 3RJOA 3SQOL 5IFHH 5IZ7A 1B4TA 4LHUG 3UAFA 3GMPB 4L1BA 1QD0A 3PJLA 3X1NA 2AF2A 2P5EA 2YO3A 4OCMC 2HKHH 4KTDL 3MBWB 5DGRA 4YZWA 2Q8AH 1G9NH 4AJVA 5J57B 4GNKB 5AKVA 5H2KA 2UY6B 4FQIL 4S0TD 3FT3B 4IKIA 5EDSA 3HBQA 4RQQA 4U2YA 4UQAA 3RY4A 3V5HB 4KZ0A 1R6VA 2ZSWA 4P2OD 5HDBB 3L4VA 3RKDD 3MLWH 2WLNA 2B14A 2OQJB 3QEQA 5B39B 5IROD 3LEVL 2X3CA 1AS6A 1NDGB 1SZNA 1TPXC 5ECGA 5TTRA 4DWHA 1L0YA 2ESVD 1DQQB 4ZFGL 2XTSA 1P5UA 4HFWA 3UROR 3L3KB 1UJ3A 3QNFA 4QXUH 1A6ZB 4IIQB 4GW1B 2R59A 4EUPG 4EI6B 4W9FC 3O6KH 5E2TH 4R5TA 5CCKH 4FLRA 4ZAKB 4J1UB 5FF6A 4URKA 4FYTA 2B16A 2H7WA 4NNXA 1X5LA 4Y19D 4YC2B 2WBJB 2ADFL 3KCPA 4MJIB 4ODSH 2NXYB 3GTNA 3PP3H 5KVMC 1QI5A 3MV7B 3MRHA 4KVCH 2IGFH 4PWJA 2W0KA 1SVZA 4NZ8A 5ADPH 4BFIB 5KSBF 3SDXB 5DZ9A 4PJXE 2B15A 3PS6A 1WBZB 4HHAA 1JYXA 2JJWA 1TCRB 4M7ZC 2FGWL 1GGUA 1OGPA 3IF1B 3W57A 3SY6A 4PWKA 3H42H 2GTWA 3F12B 2ENJA 4JANA 3SKMB 4B5EA 1BQUA 1A5FL 4NC1C 2AQNA 1JFHA 3TEXA 2FQGA 2IWKA 3ZVVA 1MCCA 3RY6C 1WWAX 1MLBA 3B2VL 5DUJA 1R3JB 4AYFA 3QBTB 3PFQA 5JQHC 1MCEA 2SEBB 2VM3A 2XPGB 3CX2A 4AT6A 5I76A 5MI0B 3MLSL 5CU5A 1DLFL 1FDLH 1I7UA 1NPJA 2IQ9L 2XN9B 3BGMA 4PWEA 1D2PA 5KBKA 3QHFL 1F42A 3O3EB 3PF2A 2MCMA 2DZEA 1IC7H 2KSAA 4CDHA 3IMSA 3MUY1 5HI4D 3ZYZA 4O00A 1BG1A 3VXPB 1TTGA 1DDHA 2Q3XA 2FEDD 4PJ5B 2VJXA 4KO7A 3PDGA 3QCTL 4ZTPL 3ARDB 2JB6B 2BMKA 1M56B 2O93L 2CALA 4E9VA 1XF4B 3BO8B 2XN0A 4KHTL 1RP8A 4NJ9L 5L9DL 2DQDL 4GRLB 3T8MA 2I5YL 1AP2A 1IGJB 4G83A 4LL9A 1GAFH 1YEFH 2VIRA 4I48A 5MERA 4BWBA 3EYQD 4XB3A 4U6VH 5DJXA 4Z3IA 2YC1B 1KB9K 2BVPB 2K7QA 1JGJA 4OGAC 4XOEA 4YWGH 3WKYA 3S34L 5JXAL 3BZEA 1SDAB 4OLZH 4ZO8A 3IDMB 8FABB 4JG1L 1KG8A 2B0SL 5GGTA 4UT6A 1UT1A 5EO1A 3TTYA 4XBEL 4F93B 2WTPA 2Z73A 1SN0A 4GIPD 4OZGA 4E9LA 4J27A 5J6HB 1MW2A 4XNBA 2FLMA 4MXWH 2L4OA 3TA4D 3IGKA 1PKQA 5DHEA 5LLIC 2O5YL 2X1PA 4KY1L 1AQHA 3SPVA 1BOYA 4PYHA 2GITA 1MJ8L 1E67A 4P2QD 1EHLH 1AGFA 4W4OC 3H2WA 4W70A 1EDHA 3DPBA 3T45A 2CUMA 4GAYA 2ESVE 3VFUA 1BQKA 5DFVC 3OKLA 2X09A 3D85A 3UZAA 1ULVA 1JHKL 3KPRB 4MCYB 4TSAL 3CLFH 1YNLH 3FFCD 4NM4L 5JZ7D 1NEPA 4ZUWA 5I30H 2Y06H 1LJMA 2WO2B 2EIKB 3KJ6A 1G9ML 3BZFB 4QY8A 4OAWB 2WJ5A 3KW7A 4NP4H 4QO1B 4FNRA 5FHAL 2H0JA 2NQCA 2OXGA 4Y19E 4HOZA 4YHIA 3GXDA 5EOCJ 5IT2H 4DIXA 5DVOA 2EKSB 2BLFA 2QHLA 2XQBH 4ZW7A 2E47A 1U91B 4NERA 1N19A 3AYNA 3IN2A 1F58L 2E6JA 2WQ8A 4G1MB 2X40A 3ARXA 4TQHA 2JJSC 2EEXA 4G8AC 5CBEB 5DEFB 1E2WA 4WJ5A 3VD7A 5DFWH 2OYKA 4JFOA 5AALA 3AG4B 3A4AA 1HS6A 2CCWA 5D1ZB 5EOQH 3WLWC 1QW8A 1TEGA 2HT3D 2JCCA 2XRAH 4ZUSA 5C08B 4Z7OB 4WNSA 1SFHA 1BLNB 1HHHB 3L3OA 4WFFD 1XBRA 1A1OA 1MDAA 5FK9B 5IQ9B 1ZV5A 2EXWD 3FHAA 3ORJA 2ICEA 4NDMB 4X6CB 4XXJA 1RPQA 4XGZB 3HIZA 1A6UL 1J8HD 5JOEA 5K9KA 4MXQD 3TM6A 1ZT4B 3LPWA 2CUIA 3ESNA 3UDWC 4FTVB 2WIIB 1DJZA 2V17H 4HDIB 2C1PB 3QO0B 3GWJA 4HZLB 4KKNA 4R96A 4GLRI 4JR8A 4Z3JA 3VNZA 2BIQA 1F45A 5CGYC 1J8SA 1AKJD 4DN3L 3IRZA 1JTOA 3BH8B 1TQSA 3QEUB 1HFUA 2R83A 1G7HA 2Z3FA 1ZV9A 2J25A 1IE4A 2YUWA 5K1VA 4ZTOL 1FRGH 2AAAA 3VMNA 1JXKA 3S5LG 3N55A 2V3FA 4E5XB 1LP9A 4E9TA 1WBXA 5F6IC 3MLZH 2CLZA 1ET5A 3LZLA 3UEQA 1HTYA 1B2WL 3DQBA 4G42A 4M8RA 4XCEB 5I71B 2CSPA 5TE6H 3CXFA 2JH2A 2APXA 1EEYA 3JZYA 5J06A 1F3RB 1NUGA 4HS8H 4GSRA 1XR9B 3TVMA 3M7OA 2CHWA 4KUZH 1OWWA 5GGVH 3K2UL 1EMTL 5EBMB 4F7EB 2J8UA 4RX4D 3MCLL 3PWNB 4UAHA 4LHQB 3TNNA 2P43B 1UFUA 2WZ6A 1BFVH 4P2QE 4OCWH 5EZOH 1ETZB 4PLOB 1G87A 3FB5A 4XCYA 1V7MH 2Z6FA 3M45A 5CJ5A 1X5XA 8PAZA 5JQ6H 2VSCA 2AEOA 3AMKA 5ALCH 1NCDH 4K94L 4F57H 1A7PL 3EO9L 3RFMA 4MQ7B 4F7PA 1DQTA 4G6FD 5IUSA 4NQDE 2YOAA 4MRBA 3BCFA 3WJMA 5C9JB 3FFCE 2H0EA 3G5XA 4Y4FD 4ZW6A 4TNVF 2XY1A 3OHXA 3RWEA 5T1DL 5F9OL 1OIOA 3AS0A 3DSNB 1FBKA 2NNAB 4L4VA 2Y1YA 1KPVB 2Q9OA 2G9HA 4NPYB 3RP1A 3CVCA 3ZIYA 5GGUA 5L2KE 1CICD 2RAMA 2ED7A 4X31A 4J3OF 1YEJL 1C08B 1GGCL 4H0LC 4UIMB 1T4KB 3LS5H 2RQEA 3LHPH 4Z3FA 3V5DA 1SOKA 2CO3A 1XGQA 3MJ9H 4P99A 5H4YA 1ERNA 3HVDA 4YVNA 1MF2L 5DEGA 5EORH 2WQAA 2CK0L 2DEYX 3U2JA 4FP8L 4XX5A 4DERA 3BVUA 3FTUA 3CCHB 1U8LB 5CJOH 4NHCL 1CFVL 3L45A 3SKJL 1JAEA 4WFFE 5ETUB 3GSOB 3ARGA 4PY7B 4A2GA 4ES8A 1NIBA 4MCNA 2DYSB 1HHKA 2Y6SC 1R3IH 3L1GA 1N7MH 4IBZA 3BAXA 1T20B 4MJ6B 5AVVB 4HIIB 3VM7A 1CR9H 3GMPA 2B8OT 2RCSH 3F04A 2F08A 3KYNB 3QDMD 4OF8A 1J8HE 1AANA 4PBWD 2XFXB 3MBWA 4N2HA 5TPWL 1CGXA 4JKMA 3WFBL 2WSKA 5MENB 3G6DL 1EGJL 3FT3A 3OZKA 2ZFEA 4V2CB 3WE6B 2CUHA 2YA0A 3CN3A 4I18A 1OTTD 3GMMB 3QG6A 4DOHE 1LVEA 1C5DA 2Y5TB 5C3TA 4BA8A 2BCKB 3K6OA 4G8EA 4K5OA 5I19L 2CM5A 2E7LA 2OQJA 4QCIB 2YSTA 4HWNA 4XVUD 2WD0A 5I8OH 1TLMA 1MPAH 3OAZH 5I15H 2AEQL 1I8MB 3ATDA 4YK4B 2D7PA 2IH3B 4RGNC 2WJLA 4XPGH 1NUNB 4IIQA 5LXGL 4GW1A 2WXHA 2VQTA 1QHOA 1QHPA 2BIOA 2VR8A 1KENH 1UWGH 4EI6A 4JHAH 5E1AB 4O51B 5J7CC 2CUAA 3UACA 3QBLA 4MAYC 1T5XB 3ECBB 4J1UA 4ZAKA 5F3HA 4N3TA 1BEYL 3K0YA 4ZXBC 1MAML 2WBJA 2GSGB 4MJIA 3S36H 4JZNB 4IMKA 1V5JA 1PSKH 2YS4A 1FVDA 1SHWA 3VI4B 4R4BB 4LEOB 3CXDL 1O6SA 1RK7A 2YLKA 5IB5B 3P3TA 3FUJA 3K74B 5HDWA 1WBZA 3DTXB 3C5ZC 1TCRA 3IF1A 5AB0A 3F12A 1BZQK 2FWSA 2ARWA 3KLDA 2YWZA 3QFJD 4QTIL 1J12A 2CBPA 3L1EA 5CEXB 4TTDD 1B90A 2Y7MA 3DX7A 2CGRH 1J0JA 2VQ4A 2B77A 2SEBA 4XNXH 2EVFA 3I6KB 4HF5L 2R69L 1NINA 2GUOB 2XN9A 3E3QC 2FX8L 4K8RH 4MYWB 2HRGA 2EDKA 5LNEA 4MNQE 1A3LL 1WT5A 1Y6MR 1BD2B 5HSFA 1USZA 2W0LA 3O3EA 3QQDB 4Q74A 1RKRA 2YD7A 3GS4A 3N40P 5HVHC 4TPRL 5KKHA 5BUAA 1BFOB 1B0GA 1U4FA 2X2YA 2VDNB 4U6YA 3S8WA 3JWNE 1BW8A 3CFBA 5SWZA 5AW9B 1CT8B 5CUSH 4A6YA 2F5BL 1USQA 3ARDA 2KERA 2JB6A 3QEGH 4PAZA 2XV6B 3BO8A 3QCUL 2NY1C 5CJ8A 3D50A 3CFEA 5KUMA 4BE5A 1GHFH 1TF4A 4LPWA 3HMXL 3TBVA 4PS8A 4ZPVB 1MZYA 2BK8A 2XIDA 1L7TH 1ZA6B 3UBXG 3VD3A 3R0NA 1IGJA 3IBOA 1PEZA 4OFKA 2OX5B 5FOJA 5IREA 4DO5A 4YLQT 3HAEG 1N0XL 1UZ8A 3EH3B 1MNUH 1F4ZA 3ZGHA 2YC1A 3K4DA 5GRVL 1CXLA 4O4YL 5L4JA 1RPKA 2DLFH 1JVOA 1CWVA 3OAWA 1AKPA 3MDJA 8FABA 2R1XB 3HW7A 4LB8A 1TETL 1FIGL 1MVUA 3EKCA 2DYPD 2VDRL 1PPIA 4IOFC 4Q6IB 1CDGA 3H9SB 4M7LH 4ODUB 4Z7WE 5J6HA 3VXRB 1KTRL 4XHJC 3KYMB 4FNQA 4U7MA 2ZKMX 4HFUH 3NCJL 4XP6H 3PIQB 2CM6A 3BIAX 3WY2A 2KC0A 2V2XB 1KXTA 4Y5VC 4A2MA 4R9HA 5FYKU 1YEDB 2CNZA 2ZUVA 3VGAB 5B4MC 4WI5A 5JIKA 3VYOA 2HLAA 4MB1A 3CFTA 1BQHB 1CU4H 4PLKD 4X4XB 1ZV2A 1RZJC 2DQGL 3GC3A 3KPRA 4MCYA 1OCWL 4XNMA 4J6RL 3NCYS 4RZKA 1HL8A 5DWPA 5E6ID 3HG1B 3WHE0 3GBNL 3BZFA 4OAWA 4O9HH 5F7FA 5CILH 4Z76A 3E38A 4NQCD 3DX0A 3VFMB 3QWOB 2FNWA 3ARVA 3B9KC 4P5KA 3EO0B 5AOZA 5AKSA 2EKSA 4FG0A 4MB5A 4GP8B 2QDWA 1P1ZB 2YKLL 1R46A 5DVKA 4JRXD 1NCUA 1U91A 4DGWC 4B3VA 1FFNA 3MN8A 4G1MA 5CBEA 3FQNB 2WWMC 1A7QH 3V52H 4LRNH 4HJJL 1ZXKA 2JKLA 5KUKA 5DZVA 3HE7C 3QFJE 3FO9A 3BJLA 1UH3A 2QVKA 3KL5A 1ZT7B 1HC1A 3H8NA 4L3AA 5ICUA 2WMPB 5TQ0L 4BUHA 4PJDF 1EHNA 4H1LB 5C08A 4PGBB 4PV9B 1X5MA 1HHHA 2BWQA 5FK9A 4GBXD 1TN0A 4WHTA 2A83B 3VSTA 2JKNA 3BUQA 4NDMA 1AGCB 4Q7DA 4XGZA 2J4YA 1EAPB 5SWSE 2OK0L 3EJPA 4RZCB 3CN1A 4N0CD 3CHRA 3HI5L 2FH8A 4ESKA 4EIYA 1F4XL 1SOXA 1ZT4A 2FB4H 4ZMLA 1MOEA 4FTVA 1RI8A 1YYLH 2WIIA 1I85C 4YZFF 1U8CB 1WG3A 1L6XA 3VRLE 3QJXA 5EF0A 3AB0B 4HZLA 3DMMD 2XXMB 3UMNA 4M7KL 1MI5B 4K0OA 3ES6A 3LNDA 3FQUB 4I13B 3QRFM 3NQIA 3SN6R 1DFBH 5C09B 3QEUA 1JP5A 5IQOA 1KYOJ 5AAWC 4POZD 4LOEA 4N2IA 4EN3C 1K3IA 1VEOA 4UWQB 1EO8L 5GZNA 5GJTL 1VFAB 4GW5A 4PJ9B 1LDSA 1UWYA 3UBXI 3ZUCA 1W8EA 2WO4A 1JDDA 3OXSA 1CFBA 4O5LH 2CJ3A 4XX1E 5BO1H 2COVD 4ODXB 4D8PB 4M3HA 4XVTH 3ZE2E 3VXNB 3WMSA 2LU5A 3Q43A 3EOTH 5CN1A 3C09C 1XR9A 3LV3B 4DK5A 1UUSA 3NZHL 2MJWA 3K1KC 1MEXH 4JFZH 2ZXWB 3BVTA 3QUZD 2KBGA 4QAWA 2BRRL 2ZOLB 3MLPA 1DCLA 5DDHA 4ICWA 1UM4H 5T3XL 1XEUA 3PHAA 5E6ZA 3WMPA 4JFDB 1M6OB 3X17A 4WV1C 5HI5D 2IXQB 2ZUUA 1SJXA 2MCPH 3QORA 5BRZA 1CD1A 3SYPA 1T0NB 5C9JA 4NN5C 3JQOB 3NQKA 2D7TL 3MSPA 3C9MA 3FQTA 2JKTM 1ETA1 4WAVA 4LMQI 1E8ZA 4NQCE 5GS0D 3WIIL 2UY7B 4NPYA 2ORBL 3S3SA 2EDMA 3O8XD 2HRHA 1C3WA 3AU0A 4JRXE 1E6JH 3O9WC 1KDIA 1TENA 4IOSD 1PY4A 2V7HB 2IOIA 2MCAA 3EXLA 1GW6A 1R3HB 2EVIA 1NBYB 4KI5E 2AK4B 2BY0A 4Y1AD 3T3ME 3ZMRA 3WL9B 2JVUA 2I24N 4X6EB 2BNQA 3MUJA 4KKLC 4WRLA 3V0WL 1MFEH 2KI6A 5GIRB 5IBTH 2BY3A 4TNWF 3IXTB 1U8LA 3CMOL 3KPLB 1ZTXE 5IV2B 3SHSA 1XTMA 2W91A 5ETUA 1E5ZA 3H3PH 4PY7A 3IFLH 5IFJB 2B1HL 1NEZG 4Q56A 3F7YB 4LDLB 2DKUA 3NG5A 4MJ6A 1T20A 4M7JL 3BP5A 2NY5L 3KYNA 4PWFA 4FFZA 2UZXB 2PP7A 2QFRA 1ZPUA 4MMZB 5MENA 1MRCL 3JV0A 2ZPKL 3L48A 1TU2B 3UBHA 1P8HA 3L3JA 5K59E 1JZ7A 1R3LB 4QIDA 5DHXB 1XIWC 3QP3A 1AQKL 3BVWA 3TZVB 4L9LC 3WTYA 1R5WA 2BCKA 4OT1H 2GIXA 4M56A 1JMZA 2WNXA 4A55A 3US1A 1FGNL 2WXIA 2YD9A 1MIML 4N86A 1MHPL 1LGVA 3WY3A 4WIQA 5GRZA 4H0HB 4JQ6A 4IBSA 4AJ0A 2LTQC 5A2BA 3UYPB 2AEWA 1NBCA 1S8DB 1UD2A 4LFHG 4Y4KC 4F37F 1DZEA 5IEHB 1ID2A 2F5AH 1WD8A 3NGBB 2G75A 4O51A 2GAZB 1SF3A 4JNXA 4HWEH 1VZGA 4NO5B 4CN1A 1R0AL 4XMVA 2GSGA 3N1FC 3V4UL 4APQB 2C9AA 2AJSH 4JZNA 4JFEE 4QEGA 3WBDA 3VI4A 4R4BA 5FYKD 1RZ8B 1JPTL 4LSTL 1U8OA 4WHDA 3SPJA 5A1AA 5IB5A 1GC1L 3RY5A 1CD8A 1JRHI 4P9HC 2ZUQB 3ERXA 1T83A 3BPOC 5JOFB 2DI9A 4OCYL 1X5JA 4PCTA 2O4EA 2E7BA 4QDGA 3S96B 4KGLA 4KJWC 3D4SA 3LXCA 3Q1SH 2NY7L 2IDQA 4KTEH 4KDVA 4JBSA 4WW2F 5ANMA 5EIQA 3N2JA 2Q20A 2XIIA 1ZVHA 5HPMB 4OB5H 4RMSA 3VE0B 1AXSB 1W16A 2JE8A 2VSMB 1Q0YL 3BDYH 3ABGA 2GUOA 4FA6A 4BKTC 4G6AC 2XQ0A 2PPCA 3MXWL 1BD2A 4AIOA 4XCFL 1AR1C 3QQDA 3HNVH 4E42B 1FA4A 1OLZA 2VZTA 5EOCH 3D39A 3MBEB 4KAQL 2Y07L 5EZIL 5B1KA 5H2MA 4ZMAT 4TQ8A 1BX2B 4U6TA 4U4IA 4WO4C 1LYQA 2CPUA 4HJ1A 4G43B 3DSFH 3WHE1 5JIQA 3DO3A 3RTLA 5SX4I 2PPFA 4OQTL 3TA3C 3I2CL 5JPMC 3FQ2A 3B9EA 4Y1AE 1CDCA 2OX5A 4FABH 4GUOA 2DWEA 4DP8X 5DVPA 2HUHA 1A7OL 5TQ2H 4OGXL 2ZT9C 2UXTA 5GZOA 3VMOA 3X3FL 2WVSA 2B1AL 3C6LB 4FYSA 5L4FA 2R2HA 3QA3A 2ISDA 3UJIL 3UEZA 4L5FL 1F1DA 5E8DL 1E4WL 1KCUH 1RUQL 4G5AA 4Z3TA 2EACA 4QRSB 5B34A 1KGIA 3EZ8A 2R1XA 3L5JA 3R7RA 4AW4A 5JXED 2AKRB 43CAA 3VU2A 3CQQA 2J55A 3TX4A 1NUFA 4ODUA 3GHBL 4Q6IA 5T3ZD 3B2DC 1ZVSA 3QRGL 5KAQF 1XF1A 3SQBB 1JZ8A 5F6HI 1HH6A 5J6GB 4MA1B 3PIQA 3ZRFC 3TIEA 3GI9H 3IE9A 4GH7B 3ZZ1A 4CJ1A 4JDTL 3C5JB 4YHML 3QUYD 4OJYA 4R26H 1XH1A 4HBCH 2X70B 1ILSA 1TO4A 3MV9A 1WZAA 4HA1A 5DA0B 1BQHA 4X7EC 3UAAA 4ZX3A 1S5IH 2R0WL 5IJKA 2BVQA 2VDPH 3UJTH 1MCIA 3HG1A 1OGAD 3U4EB 4Z3GA 5I23A 5IB3B 2J1YA 1N2RA 3U25A 1N0LB 1YMMB 2HPYA 4W6WB 5LG1A 5IY5B 4OI8A 1FLRL 2DD8L 5A43C 5BV7L 1TVBB 2J8HA 3L13A 5FYKE 1IM9D 3JVGC 5FOBB 4WWOA 2DM2A 4JM2C 1BYPA 4ODTH 3VTMA 5IB4B 3BWAB 2OMYB 3PL6C 5FFLA 1D6VH 2HX9A 3FQNA 4RISL 3VG9C 3SE9L 1QSFB 3SGJA 2HVBA 2IPKB 3PPEA 3U48A 2AV7A 4PJCA 1ZT7A 2X6MA 4JFFA 2VNCA 2X3BA 4LASH 2VISA 1NGXA 2IPUG 2QADD 4L35A 2Y7NA 3EYSL 5JW4M 3MX0B 4GO8A 1I8LA 4H1LA 4KXZH 5A40E 4LBAA 4FC3E 1E4KA 1YO4A 3MGTB 1UXSA 5ELIA 5A16B 2A83A 3M46A 3WIFB 1RZFL 1ADQL 1EAPA 5F1NB 4ELMA 2EKJA 2Z31B 4RGMB 4BFGA 2ZUWA 4IRSD 1OF2B 2V9QA 5AVQB 3UTSD 3EYOB 5KYUB 4AYID 1H15A 3LQAL 1ZVNA 1T7ZA 2IAMB 4FL4B 1BAGA 1ZLSH 4L3CB 4A37A 3P2DA 1DSFH 3OPUA 1U8CA 3CH8A 2ATKB 3VMPA 1PG7H 1I8IB 2Y7QB 4AH2A 2EUWA 3T6VA 4TQIA 4KKPA 4JQXA 1R5VB 3SBPA 1KY6A 2DKSA 2J3SA 3QI9B 1FG2B 5C09A 4P57B 3GS0A 2FT8A 3V6ZB 5D7IE 1FORL 2CA4A 4J8RB 4XT1C 5ABDE 1E9PA 5E23A 1VFAA 3U9PL 2CLRB 4PJ9A 3WTXA 4LAJH 2DWSA 3K6DA 3QAQA 1CUOA 3K4ZA 4D8PA 4ODXA 4YHOH 4OCRH 3ZIMA 1ZLWH 3E2HB 3H7BB 3VXNA 4JQVA 4ODBD 4L0YA 2H6PB 1N4XH 4YH6A 3BUPA 2EDWA 3SYCA 4MLSA 2EIDA 4NLHA 5T3ZE 1OAQH 3HI1A 4GP4B 2X4OB 1M9WA 3W1ZA 2C7FA 2VERN 3PGFL 3E9UA 4I7ZC 4QHMB 1G7QB 2N3JA 4M61B 3LB6D 2F7RA 1B3IA 1JZJA 1Z5LB 3OAXA 3MRKB 1VEMA 1KV7A 3UP6A 3WFEL 1LE9B 2ZUSA 4ACTA 4U3HA 3UC2A 1BM1A 1M6OA 4JFDA 4MS8D 4R7VA 1E0PA 4K3DL 4YL9A 5E00B 4BEZA 1J48A 1I1YB 1T7XA 4JG9A 4LAQH 3QNZA 4OLEA 3MFGB 4PWHA 4B9GA 1PW3A 3GZKA 3PWPA 4JFWA 2ZZUT 2AMGA 3FN0H 1JERA 1ECYA 2GFBA 4QF1B 2VDKL 4YHZL 2BP5M 2J6EH 5EWIL 2BHUA 3BT2H 3RKPA 4K2UH 4XOBA 1TO5A 3L1FA 2VDLH 3SOBL 5FCUL 4F80A 2E9GA 1E2VA 1I7ZB 2PCFB 3VYPA 5CP3H 3AREB 3O4OC 3O2VH 5K93A 15C8H 1KEML 3QDJA 1CLOH 5T5FL 1NCWL 1R3HA 3UAJA 4XZUB 4YUEL 5E5MB 3O4LD 5F7LB 3LEXB 3BKML 4RGOL 2X0UA 4P04A 1NLBH 2VSKB 3Q8AA 4Z7VF 1ASQA 4OZIE 2XNAB 4X6EA 4JZJA 3RGBA 4GKSB 3PWLB 5GIRA 4TNFA 3RIAF 4GQPH 4HIJA 4WUUB 3IXTA 3ZDXF 1X7SA 3L17A 1YJDL 4PRPB 5IFJA 3HI6H 2ESVB 1F4WL 5I75C 4GMSL 4AMIA 2XY2A 1P7QA 2VZUA 2J1WA 1MFMA 3TJPA 5D2LF 1AXTL 3GT6A 5I26A 4YNYB 2W9LA 4X7SH 1QLFA 2DQUL 3IFNL 4KOCA 3UTSE 4MMZA 3NYAA 2E46A 2YBRB 4JG5A 3CHPA 1Z3RA 2E9BA 4RMWA 4RSVA 2A9DA 2J5WA 3EJCA 1R3LA 5CLTA 4QAMB 2K6ZA 4KKAD 4LNVA 3WNMA 1BM7A 3R06B 4UNTA 4GW4B 5F1KC 5BCAA 3CC5B 2HLFC 3E8UL 2YUXA 5MEPB 4PB9L 3ZYOA 2NY2B 3FS9A 1JXFA 4QHUB 2YPVH 4E41A 2NY0C 4N0UE 3TYGL 2WKLA 2X12A 1CVSC 3DXAB 4DUXA 1BZDA 1S8DA 5JIIA 4AG4H 1SXBA 3BN3B 4KNQA 3VRIB 2J72A 1SYVB 5AYTA 5BW7A 4LQFH 2DQTL 4FAAB 3ZHFA 5E5UB 4RWHA 1S6NA 5AZ2L 2FBJH 3SZ6A 2E59A 1CI3M 3QJZA 1OTSD 4NI6A 5A3IC 5BOZG 4LCYB 5LAXB 1WA1X 3B83A 4Z78A 3RTQB 1A7RH 5G36A 3S96A 1P6WA 3IAPA 3WIHA 4FJZA 1P5UC 4MD4B 1UJ3C 1VGKB 4X7CC 3ZOAA 4AEHL 5E5LA 2VR6A 2WP3O 4FLSA 1F6FB 2I32A 1ZS8B 2IEPA 2XT1B 5HPMA 3I9GL 1EK3A 3VE0A 2DJSA 1P4UA 2EADA 4D9QD 1MCOL 1PZBA 2VN4A 4DVRH 1KB5H 4LO9A 3C5SB 1MY7A 3FT4B 4E42A 4LGRB 4A2DA 3GKWH 3MBEA 1DQJA 2R2EB 4MRCA 1CFQB 3TJHC 2YCXA 1TOXA 5ILTH 1ZGLM 1BX2A 1V3KA 2H32H 3NSXA 4RBPK 2ZZLA 4WW2B 5C07D 3VI3E 2PPDA 5DUPH 4G43A 6FABH 4OU3A 1KYOK 2VDRB 3BFQG 1HKLL 2BP3A 3F00A 3NSJA 1CLYL 2R29L 2H4EA 2PF6A 4PTUB 2F19L 2NX5E 3IDUA 2EVGA 2QHRH 3LN4B 3S3PA 3HHMA 3NEXA 3BH9B 3O4LE 5EUOE 4AVKA 1ACYL 2YPLB 1WA0X 4IBWA 5K9JH 1URLA 4HWBH 4NWTL 1TJXA 3CU1A 1CZ8H 3NCWA 1LO4L 3C6LA 4YBQC 1MJUH 4PRIE 5E1GA 2FQDA 2J2ZA 4QRSA 5IMMB 1LMIA 2YPKB 3HA0A 1FZJB 5F21B 3FTGA 2OZ4L 4W9LC 4JN1L 1HXYA 4QXGH 4B60A 4LCCB 4IRZL 1CFNA 3MLRL 3I84A 1IGCL 3SQBA 3ETBF 3SE8L 5JHAA 1U93B 4XOCA 2I9LB 1KYFA 2JJUA 4XCNB 3ML9A 3KDMA 3NZSA 3RIFK 5J6GA 1T1WB 1A2YB 4BZ1A 1QG3A 3FUNA 4XO3A 3C5JA 4RBPH 2VLRD 2BH0A 2XETA 2KHAA 3P02A 5D6CB 4PI0A 3OAYK 2WO3B 4N2KA 5DJ2B 4AW7A 2JIXA 4IRJB 1AJ7H 1WAEA 3N04A 3FRUB 3VAEA 3U4BL 5EN2B 3BFOA 4PJGF 2XACC 4U1JB 3B1UA 2X4PB 1LD9B 3QDGD 3QZWB 1NC2D 5IB3A 5EF2A 3K5SA 1AH1A 3V4VH 3UXFA 4BDVB 3EGXB 5C6WH 1WJ3A 4UM9B 4R7DB 2UWEF 4G7YL 3GGWB 4J2XA 1KJ3L 3M8OH 2E9IA 4GO6B 2FX9L 4P3DB 2H3NB 3ESPA 5JPNA 5FOBA 2WVUA 1TFPA 4QT5B 5IB4A 3BWAA 1JNLL 2Q3AA 2OMYA 1PD1A 1IJNA 1J8RA 1RIUL 1DQKA 2J4WH 3C2AH 3HJ0A 3IE4A 4CC4A 4XAWL 2IPTL 1EXHA 4W9KC 1FI8C 3GHEL 1PL3A 3FUEA 2PXYA 4TLTA 3TH2T 3HANA 3NDZE 1KDJA 1YN6B 3AS2A 2OYPA 3T4YB 4AGLA 4MXVE 2WXMA 3ZW3A 3ZSTA 4O02A 5C2BL 1XB6A 3LKQB 3MX0A 3PE9A 5E2JA 2ZWZA 2FJFA 3TBSB 4RFNC 1Q9OB 4ALAL 4D9QE 2QGBA 3W3BA 5EPMA 3ZTEA 3OWEA 3L5WA 2V9RA 3QAZB 2FHCA 4PS3A 2GABA 4V1DD 1UH2A 1PLGH 3IJ9A 1UB5A 1NAKL 2Z31A 4G8FA 2CDEA 5F1NA 5GGVY 4UV7L 4E0RB 2XWJB 3EYOA 5KYUA 5IFHL 1M3IA 2YAQA 5D7KE 3SD5A 4J3XA 5C07E 3GJFK 4J28A 4ZW8A 5DHVB 2FO4B 2Q8AL 2ITEA 5FM5O 3MVSA 1OO2A 1UD8A 2ATKA 4MD5B 4GEJA 3Q13A 1G9NL 1H0DB 3B7TA 2ZXQA 4FLQA 1ZEAL 3IJEB 1Z9MA 1UOVA 2IO5A 1FG2A 4P57A 4I0KA 1W6WA 1MELA 4HU8A 5TDOA 4XPHH 4FCHA 5IQLA 3V6ZA 3ZZQA 3MLWL 5D5MF 3L3OC 2MHAA 4J8RA 2CCVA 4Z0BH 2ICEC 2EDRA 4FEMA 3ZTJG 1E9QB 1YPZF 4JPVH 5HYJB 2VLJB 4QXUL 4LOUD 5JQIB 1A4KA 1S7XB 4ZFFA 2X38A 2H6PA 2J12B 2QPUA 5E2TL 2VN3A 5CCKL 1E4XH 1K5NB 4MWFB 4YSRA 1A3QA 4JZOB 3COCA 4NIKB 4M9PA 3PAUA 3MGOB 2X4OA 5DC2A 4GMTH 3MRDB 1LQSR 4ODSL 3W5MA 4M61A 4DP1X 3BSZA 4KVCL 4XNQB 4JVPA 2IGFL 4RDBA 3GINA 4YDKL 4XI5D 1Z5LA 5ADPL 3MRKA 4M3KB 2VXUH 2PR9A 1LE9A 2F0CA 2GIMA 5G2NA 4P23A 5DZAA 3L3GB 1OAYH 2XHNA 4DP7X 1U21A 5F89A 5E00A 3S88L 2NXZD 4P4RB 3H42L 4ICXA 3LN5B 5E6YA 2IVFC 3FPYA 1AYOA 1OAUH 4FD0A 1FC2D 4KMTL 1WAAE 4WTWA 1OCOB 3QDGE 1FV1B 4J2QA 2WLIB 4QF1A 5EC2A 3W37A 3VACA 3FONA 1VDGA 4H20H 2IV8A 3BUTA 3EUDA 1IW6A 5D93B 1I7TB 2WNGA 4HKBB 3J27A 3TVMC 1FDLL 3BZDA 2VZOA 3QIBD 1T3FA 2PCFA 1N59A 4GP5B 2NNXA 3PJSA 2EUXA 3RNKA 1F41A 3S3CB 1B9ZA 1IC7L 3QDMB 2YBGA 1EGJA 2B9AA 2YMOA 2HTKC 4XZUA 1ZXQA 1U8QB 5E5MA 4PPTA 4BXVA 4N6RB 4U1SA 5GISH 2O6EA 3QZBA 1L6PA 2KL6A 2XNAA 3LKPA 1JPSH 3C5XA 1ZT1B 4P2OA 2OMWB 5I6LA 4WUUA 3NPSC 1OHQA 1SJEB 3QIWD 3ULVC 2OZNA 1IAII 1LK2A 5IROA 3OHXC 1YEFL 2ESVA 5CSZB 3ISWA 2EABA 4NN7C 2EIJB 3Q3GA 4V1DE 5DD5H 1FE8H 4YWGL 1NGQH 4YNYA 1SHMA 4OLZL 1A9EA 1ONQB 1HZXA 1BJ8A 5DSCB 4OD2A 4Z7VB 4QJ4B 4KGJA 1H3UA 3D87B 4BZ2H 5L88H 4PW3A 4Y19A 3ZDXB 3G6AB 3ZU8A 2EAEA 1CFMA 2WLLA 2IMMA 3CSTA 3C9LA 3IAQA 4NKDA 3R06A 1FFOA 2N4IA 4GW4A 1AG6A 1UWXK 3IU3B 4MXWL 2YRPA 4QHPA 3SJVD 2ZYHA 1MJ7H 3SGDI 1VRSA 1AYRA 2OXHB 1B9KA 5JJJA 3EFFB 2B08A 1FH2A 1EHLL 3T0WA 1CIUA 3ARGC 2GC4C 4PRNB 3TJEH 3VRIA 2YZ8A 1X5HA 3HC4H 1UXWB 1SYVA 2KQNA 3EH1A 2A6JB 5I8KH 1KJ2L 3WFCH 3DJ9A 2JWYA 4F8LA 3CLFL 1YNLL 2OR7A 1HNYA 3NOIA 5I30L 1AP9A 2CMRH 3PRZA 4ZUUB 3QJUB 4HH8A 4I18C 4ZMNA 4X9IA 4ZRGA 4GRMA 4NP4L 2OAAA 4LCYA 5KYYB 5LAXA 4D0DA 5IT2L 2E7LC 3RJDA 4WWKB 3OR6B 3TNMB 1C1EH 4MZIA 3ATAA 2VDOH 2QVTA 3NP4A 4R2GB 5DD3H 3IVKA 4ZUTA 4MD4A 4WENB 1VGKA 1UD4A 3CX5J 2X5PA 4IIQC 1Q9WB 1NBQA 2EC8A 1XB3A 2LFGA 1GZQB 1HEJC 2FT6A 4ZAKC 1A6VH 4PJEE 5EOQL 3PQRA 4EVNA 5F8UA 3OLIA 4BSVB 2WBJC 2XRAL 3IS1X 4IMKC 4I87A 2C8NA 3WY1A 2H1PH 5IVXE 3VD1A 1GJIA 2DL2A 1D7BA 1FZKB 1QACA 2R2EA 3ASNB 3LCYA 4ZNEA 4XMPH 1LMKA 4HX1B 2XVKA 4TLKA 2VH5L 3F6LA 3E3QE 5B1CA 4PIBA 1SN2A 2OBGA 5A6IA 4M5SA 3SYAA 4WK0B 3P30H 3OD3A 1F97A 1FNFA 4MCZA 2A0LC 5DU7A 1R24B 2ITCB 3WSQL 4AEEA 1Q0XH 4G2AA 3BH9A 4BFNA 2H9GB 2V17L 2OL3B 3LNGA 3Q8EA 4Q9CA 2QPFA 2MFNA 2PCXA 3D33A 3L9RB 4TL4A 1TT6A 4MD1A 4P2QA 4UINH 5F8RC 1PXSA 1Q1JH 1XT5A 3CDCA 1HEZB 5DJZB 4JY4A 5E8OB 5EC1B 3VH8B 3VXUE 4F2FA 2VRQA 4UOJA 3ELAT 4BFJA 4Y1TA 1WT5C 2MPAH 1ZOXA 3RX9A 4QRFA 1FRGL 2E7MA 3FCUB 1K9TA 4PJBB 2A74B 2YPKA 2FEEI 3MLZL 5AW3B 4HUWA 2AGJH 4NBYB 3FFCA 4PG9A 4HV8B 32C2B 5E6IB 3LKOA 1FSKB 4WGVB 4GBRA 1EZSA 1E7VA 3ARDC 5HHPB 5TE6L 3GEFA 1J9TA 1U8HB 1U93A 2DMGA 2I9LA 4NRYA 4NQCB 5BV7B 3UYRH 4HS8L 1T1WA 5JR1H 4ZSOE 4KUZL 3RB7A 5GGVL 3RILA 1R19A 4NQXA 3UTTD 1WD9A 3MLUH 4QRPE 3RYMA 1VACB 3SJVE 1A1NB 3ZTNL 4HEPA 1BFVL 1NAMA 4OCWL 2P5WD 1UA6H 5DJ2A 5EZOL 1A25A 4N5ED 4OF0A 4XP4L 1V7ML 4CC1A 5HYFA 1EO7A 2QV4A 4YSSA 1K8IB 6TAAA 5JQ6L 2BVOB 1LD9A 1NCDL 2X4PA 3QZWA 4KNTA 5ALCL 1CGUA 4NKIH 4F57L 4BDVA 3CDZB 3V6OE 2CO1A 3W39B 5HYIA 1OE1A 4R7DA 1KTJA 3GGWA 3D25B 3GJEB 3G7TA 3DRQB 1A0QH 1PZUB 4BVNA 1HZHL 5CJXA 1WAPA 3P9LB 4QT5A 5LGKA 1J8HA 1V55B 5FECB 2APWA 3OMNB 4PJGB 3DETC 2MTPA 5DMKB 1QSEE 3T08A 1UYWH 1U41A 5C8JA 4IYKA 1IGIH 2JKWA 1K8DB 1QR4A 2VMDA 3LHPL 3LS5L 4KJPC 1YN6A 3K2KA 4F91B 2XVGA 5I1HH 1L9PA 1DQVA 1KB3A 2LQRA 2APFA 3MJ9L 4F1ZA 4DF9A 1EUTA 4FMKA 1LE5B 2UWEB 2WSPA 4NRZB 5TE4L 4WW3A 4BFFA 5KN5A 2AHIA 2BHFA 1CGVA 5I8EB 1AKJA 5EORL 3A67H 1Q9OA 2WLMA 3UJJL 1KBKA 5CJOL 4UU9B 5IKCB 1RUMH 1FYTB 4XBMA 5E8EA 3QJVB 4R3SB 3KBPA 1DTUA 4BWUA 1MLCB 1R3IL 1N7ML 4U7KA 1CR9L 4D0CA 2RCSL 1VHPA 3QS3A 4CUCA 3KGUA 2WZ0A 3NESA 4ES9A 1EEQA 3KWXA 4MD5A 1T66D 1W0WB 4ZUVA 1H0DA 1FO0H 3LH2L 4N9GB 5JHLH 4NQEB 4HS3B 3EIFA 25C8H 1CGWA 3MRGB 5HI3D 4NAMA 4PP2B 4RX4A 3ZT5A 3OKNA 3KXFB 2R9HD 5LBSL 2EIBA 5I8OL 5ERWB 3OKOA 3WS6A 4CJ0A 3KDPB 5CGMA 5JNYB 1MPAL 5I15L 5G5DA 4H0IA 4B50A 4FFYH 3S98A 1E9QA 4XWOC 5KBMA 3OKYA 4LEBA 4XPGL 3HNTH 2H26B 2HG5B 4GLRH 4XP1H 4A38A 1KENL 1UWGL 4JHAL 2NZIA 4LDOA 4P5MA 2VDKB 4JZOA 5J3HD 4Z7QF 1A9BA 3DX9A 4Y4FA 2FNBA 1BWWA 2WJKA 3MGOA 1JZFA 5I6NA 1ZSDA 3S36L 3MRDA 2G4EA 1PVHA 1PSKL 1NLDH 1L5GB 2WC7A 1MFDH 2K8MA 2XYCA 4FG4A 4F9PA 4HJGB 1YPZB 3O8XB 1CICA 1RU9H 1XL4A 3N06B 5ICYB 3L3GA 4B9CA 5GZNC 4NX0A 2P5WE 3DYOA 3LN5A 2PYEE 2OLDA 4IKLA 4X5XA 5I71C 2CGRL 3W5NA 1GSMA 1Q4NX 5FDYA 3RVXD 3WN6A 1FV1A 2WLIA 4UM8B 5H37A 4BQBA 1UOLA 4XNXL 5FM4A 3HARA 1I7TA 3SKNB 3OZ9H 4K8RL 1XAKA 3FUKA 4NENB 5CZVH 1JGLH 4JKPH 1EZUA 4QHNB 5D7JB 4GSXA 1CLZH 3QDMA 4WI8A 2DMCA 3SO3C 2DWDB 5E2VH 3POHA 2F2HA 3QNYA 4KMLB 1JHTB 2GI0A 4HIPA 4N6RA 2D7NA 3PWUB 4NLAA 3WNJA 4PJ8B 4LPUA 5H94B 3EYUH 2AERT 4Y9GA 2F68X 3QEGL 1ZT1A 3QORC 2MEJB 3RPBA 1SJEA 4LLQA 1GHFL 2YD1A 1L7TL 1YCSA 4ZX4A 4TVPD 5I0XA 2MOVA 5CSZA 2KMWA 5FA4A 5CEYA 4AEIH 4JY5H 7TAAA 5LDSA 1MNUL 4M6MH 3B9VA 1X6NA 1GKOA 2YWYA 2JLPA 2DLFL 1AIZA 1PTZA 2NY6D 3FN3A 3QUMA 1E40A 2E8YA 4PUBH 2AQPA 2CO7B 3U9UB 1SUHA 3G6AA 4R7LA 3SDDD 3VD0A 1QBAA 4GRWH 4HLZG 4M7LL 1DL7H 4HGWA 2N7AA 4MLIA 4ONGH 1KBVA 4AGNA 5CD3A 1JNNH 2NY4D 1DQIA 1T21B 2HMID 3IU3A 3CVIH 4OZHF 4H1LG 4HFUL 4XP6L 2EVJA 3CSBA 2D7OA 3IGAB 1KYAA 1DQDH 2ZKXA 4BJLA 2DLTA 5I66B 4PRNA 5JIDA 3QFJA 4H2CA 3W0WD 3W81A 1KTLA 3T71A 1UXWA 2VXTH 3QSKB 3AW5A 1CU4L 4S0SD 2P8MB 2FX7H 1EAQA 1HINH 1CJYA 3MHZA 4IAQA 1RXLA 5A6LA 4ZS6D 5FGCB 3RX8A 2WOYA 4LSSL 1KGCD 4JGMA 2XKSA 3WLBA 2DOCA 4O9HL 1A7NH 5CILL 4ZTEA 2ZG2A 5ESQA 2WUBH 1XGTB 5KYYA 4OV0A 2X4UB 3T0ED 1OWRM 5ICZB 1RUAH 4JS7A 1YQ2A 2Y6TE 3QAPA 3TO4D 4KRLB 3JTTB 4XMLH 2L3BA 3FTYA 2C5DC 1KCRL 3EO1B 1P8IA 4DKFH 4LKXB 4OFIA 4ZYKA 4JFQB 2F74A 4HW6A 4LRNL 4MBSA 1RH8A 1GZQA 3FU8A 1S9WB 2EXYD 3PL6D 5FUOH 5LBVA 5EEZA 4BQ9A 3B3IB 3K6SA 1DE4B 4UUJA 1RJZB 1DJHA 3H1ZA 5ID0B 1BAFH 3V2AR 3BLPX 2F8XC 1B4JL 3FYIB 3TS8A 2ZG1A 4Z23A 4BSVA 5H2NA 1AFVH 5D7IB 4HCFA 5I0VA 3LKNB 3L3HA 2WGXA 3LH9A 1JN6B 3OSKA 4OM1H 1FZKA 5D9SB 4GI8A 2NDGA 1DN0B 2XV3A 4EZLA 3MODL 1T83C 2K6WA 5F7BA 3TEUA 4UBDC 4HUVA 1SEBB 4YPGB 3T65A 2D2OA 3NRFA 2DYPA 4Q52A 4QHKI 1R24A 2VLKB 1YYLL 3C08H 2H9GA 4EI5B 5EU6D 3N0AA 1RZJH 5CZVL 2OL3A 1BLIA 4S10A 1J9SA 1A1MB 3PXLA 5E95B 3L9RA 4OLYH 3BD3A 3D05A 2QR0B 4OLWH 5E8OA 1FG9C 3QUYB 1DFBL 3ZDYF 3DROB 4XE0A 4TVPE 4WEMB 3SPHA 2KLTA 3K4AA 3THMH 1CIDA 2AABL 1MH5B 3B34A 1F4AA 1QSVA 4PJBA 2A74A 4U1LB 4YXLH 3JWOC 1M0KA 1ZLVK 4QRBA 4ZI8A 2X4NB 4IK6A 2YD0A 5ICXB 4O5LL 2OM5A 32C2A 5E6IA 5BO1L 1OGAB 4XVTL 1DBBH 2IWGA 1IBGH 4D7PA 3IN0A 4NQCA 5SX5K 2XTJD 4S2SA 5INCB 4YEEA 2DQEH 4X4MA 3HR5A 4QRTB 5GSRB 3TN0D 4JRXA 4YSCA 4PJXF 1W80A 1MEXL 1NDMB 3PWJB 2QPDB 1V3MA 4JFZL 4R90H 1A1NA 3EFOB 2CQVA 2W65B 4G7QB 5GZOC 4RMBA 4Q9QH 1UWEH 3CIQA 1WZKA 2VR3A 3Q5YA 4GAGL 4KO6A 1OP4A 2QTVA 3QJFB 1VFOA 3X1GA 1LDPH 1UM4L 4L1SA 3WE1A 3RFZB 1WF5A 4BCZA 4QPEA 3CXHK 5DO2D 2J5LB 3W0WE 2BVOA 2W1NA 3S7GA 3D2UB 2QADB 4R0LB 3GMRB 5CBAB 4Q6IC 4JGJA 1ODAA 3MJGX 5AVSB 2FLRT 1MAKA 1F18A 1ADQA 2ATPB 3GSUA 1T6BX 1ESOA 4GBXA 3GJEA 3ZKQD 3EADA 5C0DB 1G84A 3DRQA 1PFCA 2NZ9C 3DTUB 3O6FB 5E70A 2CRIA 2A9MH 2FAUA 2H6UA 3P9LA 2K70A 4EZJA 4ODVH 3T0EE 1HXMB 5FECA 3X3BA 4J12A 2H2PC 4OF3A 1Q5IA 4Y5XB 1GS6X 1O7DE 3HHSB 2HT2C 3UTSB 4A7GF 5ID1B 1E6JL 4CU7A 1RZIA 4GPOA 1NFDF 3O2WH 5SX5H 5IJKC 2OFQA 4M00A 3DMMA 3GBMH 2NYYC 1E65A 4FI7A 2QLYA 4N2GA 4WFED 2J20A 4H8WL 5I8EA 4ZW3A 5I9QB 2YD2A 5TE7H 1S9XB 4PJ7E 2XWBA 2PUQT 4JKWA 3X3GH 1MFEL 5IBTL 3D48R 3GSNB 3LVTA 2I7OA 3OGCA 1ITBB 3L81A 4UU9A 4WZ9A 3H3PL 4ZOCA 3HHRB 3IFLL 1LN6A 4NPJA 4R3SA 2ICWI 2DMBA 5JA8B 1NFKA 2UYLB 1FGVH 3QXVA 3OLEA 5DWUH 1NGZB 3BQUD 4CN6A 3I75A 1RJCA 1ZHKA 2UXVA 3R1GH 3TBYB 3SGJC 1SMOA 1W0WA 4N26A 4X99A 2RTTA 1SFDA 1BVOA 5HYSB 2R1YB 3MNDA 3K46A 3IS0X 4HS3A 4B9KC 5EIIB 3BIBX 1QHJA 3FQ4A 4N5UA 1I8LC 2X0VA 3GQFA 3FDWA 3QUZA 4OT1L 5CLYA 4JJHA 2IQAB 4KH9A 1Z9NA 2Y2WA 5ERWA 3SQRA 1E4KC 3MTXA 2ZUYA 4JQIH 4YE0A 4JO1H 3CZFB 3NJFA 4H8HA 1FL3B 5E4EB 3KLLA 5DMGD 4LSRH 5JW4Q 2H26A 3AY2A 4B9YA 2F5AL 1QFOA 5D55A 5HHNB 3NJJA 1G7LA 4HWEL 3KVDD 4M4PA 3G5WA 3L2NA 3CX5K 2G5BA 2JXMB 5GS3A 5EHFA 5HDLA 1JGDA 2AJSL 2AJXL 1L5GA 3P4OB 4JQXC 1KCWA 5M94B 4NB7A 4ACPA 3O8XA 1AHMA 1MHCB 4FQ2H 4L8SA 4S1RH 4Q89A 3TBWA 4JPQA 2Z8VC 3JV6A 5T5FA 3HAEH 4IOSA 2P80D 2I35A 1G7JB 1JI2A 3MLXH 4H5SA 3NIFE 4XVSH 5EU5B 4AYEC 2H3XC 4W6XB 5TD4A 4MX7B 3WGVB 4PJ9C 3WTWA 4QXVA 4G7VH 1T7VA 3RWIA 3NJNA 5C0BE 3Q1SL 4HJ0C 5D2NB 4KTEL 5C0EB 4Y1AA 3RUGE 5DF0A 4JQVC 4OB5L 1LO0H 2ICCA 1QX1A 1XSKA 3FMGH 3BDYL 2AXJA 4LF3B 3CV5A 5LG6A 4NENA 2FCBA 3HNVL 4QHNA 4AXWA 4AUYA 4LSUH 4NO0D 3JV5A 4YGAB 1BOGB 3EUUA 3NCMA 4Q9RL 4P2RB 3VGBA 3U6RA 2I9TB 3PWUA 3QO1B 3VB9A 1MREH 4DCQA 2BZDA 3LRSB 2VDMH 4A67A 4ODWA 1JZEA 3OKKB 4HH9B 2EDDA 4WFEE 3TIDB 2N56A 4AYSA 4MCMA 3PU7A 1M3JA 4FABL 5IM7A 4WI6A 5TQ2L 1WUZA 3LJ3A 3VD5A 4YHYC 4KV5E 3S8FB 1OSYA 1QZNA 5DRXB 4P9HH 1COBA 1KJ2B 3FU9A 1KCUL 3ROOB 2H5UA 3OPZH 4PRHD 2FHBA 5CJBA 4A04A 5JMOC 2CO7A 1E6OL 2A6KB 3UAJC 2V0AA 4XMTA 1PX4A 4MQXD 2AMUA 1GZPB 4PP1D 2VAJA 4Y2DD 1GH7A 1RLBA 4KROD 4LEXH 4XO4A 1E0OB 3BKYH 4JZJC 5TDNA 1KN2H 1JE6A 1G6RH 1DZ0A 3C60D 3GI9L 3GSWA 1KLFB 5LQBL 3LH8A 2YQ2A 4MDRA 4X1HA 3ZE1E 4R26L 1MXDA 5I66A 5IHBA 4HBCL 3EJRA 1OCZB 1WHOA 1ODUA 3DA0A 4AC2A 4YSEA 4D9LH 4DPRA 3GZQA 2JQMA 3WTSA 3NJHA 3X14A 1Q9KA 1S5IL 3F64A 2AV1B 4LLVB 2VDPL 4MMZC 3UJTL 5AW4B 4OZHB 3HMWH 3S48A 2XWZA 3QJHB 4DPAX 1L0QA 1MFBH 1FL5B 5K39B 1IZKA 2BERA 2NT1A 2FZ3B 1G0DA 5I2IA 3EJZD 3JV4B 2P5EE 2FYVA 5TGBB 5FS5A 2HFTA 1BM3H 1RURH 1GMIA 3AFLA 3D3VD 1PQZB 4JW3A 4XMXA 2G5UA 4ODTL 4IJ3C 5PCYA 5C3LD 5JYLA 1SJVA 1ZMYA 1D6VL 1SQMA 3EO1A 2Y7OA 4LKXA