3QJQB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjqB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjqB02
2NTWA 5AWZA 5H2NA 2IAAC 3WQJA 1JFPA 4JQ6A 3ABLB 3T6ZA 2OV0A 3V9EA 3OMAB 1L9QA 2CUAA 2VW6A 2RH1A 1M56B 2BHFA 2DWSA 1UCQA 2TSAA 1PNCA 2ZIYA 1JV6A 4FPDA 4MD2A 1A4AA 2OJ1A 2LNLA 3UTXA 2G87A 2CCWA 4KO5A 4PCYA 2YCWA 1FWXA 3HARA 1HZXA 4E9QA 1ILUA 3X1BA 2IWKA 1F50A 2QPDB 1V10A 2DYRB 3X1GA 3CVDA 3T45A 2XX1A 2ZXWB 3REYA 3NSFA 1NIEA 1PXRA 4HCFA 1A3ZA 4YSRA 2N0MA 2J55A 1MG2C 3NYKA 2XXFA 2FT6A 4NERA 3S3DB 2ZFEA 2NRDA 4DPAX 1JXFA 4BWTA 2Y00A 1AANA 1RKRA 4BWBA 2FQDA 2IH9A 1JZJA 2HZHA 5JJJA 1ILSA 2IWEA 3BQVA 1ASQA 3ASNB 3CZUB 3VVKA 3U25A 1R2NA 3CG8A 1V55B 1WS7A 2WSDA 4TXVB 2WJLA 1MGYA 2ZONA 2CBPA 2HX9A 2YQBA 3UACA 1LN6A 1EHKB 1QKOA 3PAUA 1A4CA 3OQRA 4WKXA 1KG9A 2GIMA 2H5UA 2HRHA 4MQTA 1AZCA 3AG3B 5TK4A 4BEZA 2WJKA 3V2WA 4GP8B 5BR5A 1EZLA 2I85A 4DP2X 3FPYA 3MX0B 5G2AA 2F93A 3HAOA 1F4ZA 1SF3A 4M4RB 1GS7A 2AANA 3AY2A 1XIOA 1AZUA 3PPSA 3VHZA 1BEXA 1NIBA 1GUEA 4YSPA 4JKNA 2I20A 1SNRA 4DP7X 4AMJA 4G7RB 4MQSA 5B7EA 3UABA 1S52A 3WKPA 4BWWA 3JTBA 3IEAA 3EH3B 3QJQB 2FQGA 2XX0A 2VSMB 1E5ZA 3FT0A 1ZIBA 1TKWA 2Y02A 1H2SA 2BO0A 3FPXA 4GRVA 2I21A 4MBSA 3QQXA 3WI9A 2HPYA 7PCYA 3UAAA 4DP5X 5A44A 1GY2A 2VM4A 1AAJA 1KYAA 1GYCA 3S3CB 2UXTA 1J9RA 1OE2A 4YSCA 3HANA 1M0MA 1S8JA 4PXFA 1KGBA 1X9RA 3ASOB 2E86A 1IXFA 2P80A 4GBRA 1R1CA 3IE9A 4GP4B 1OOWA 4JR8A 4A68A 4UANA 1NIDA 3V2YA 4YSEA 3WG7B 4K9JA 1SFHA 1BYOA 2Y03A 1J9SA 5FC9A 2VT4A 4AKOA 2RACA 4E9XA 1GW0A 1SHXA 3NJIA 1OCOB 3UGEA 1BXUA 5DHHA 5AFAA 1R84A 3QJUB 4YL4A 2QPEB 3VW7A 3AYNA 3QPKA 2VM3A 1J9TA 3EF4A 3UG9A 4BVNA 1ID2A 4BUOA 1L9PA 4YSAA 3ABGA 3S3BB 1ADWA 4AX3A 3N2JA 2KSBA 3AYMA 3AM6A 4A66A 3CDZB 3FYIB 3NJNA 2Q5BA 5I5JA 1NICA 1PY0A 2Y1AA 1J5CA 2JAFA 3DIVA 3D12B 3ABWA 2FT8A 1QNIA 1CURA 1E30A 3UZAA 1QHQA 4X4KA 5D4HA 5H2MA 1KG8A 4OV0A 5B6VA 1M57B 1L9SA 1OV8A 4DAJA 1IW9A 4Y9HA 2YXVA 5B1JC 1BM1A 1AG0A 1BQ5A 1GS8A 3QBIA 2BP8A 2KSYA 2YAHA 1ZDSA 3OD3A 3UZCA 3UTVA 5AX0A 3HB3B 3HASA 3T6XA 2PP8A 1C3WA 3FU7B 2JXMA 2VN3A 2FT7A 3CAPA 3PXLA 1DZ0A 1NPNA 4KNTA 5FJGA 4E9YA 1X0K1 1NWPA 5B2NA 1RZPA 2PPDA 3ERXA 3ZIYA 1GS6X 3ZPRA 1XB8A 2R7EA 3UTYA 3N55A 1NTDA 1NINA 1FBBA 1QHJA 3PBLA 2EIKB 4E9TA 3OE9A 3TASA 4TL3A 4X1HA 4G70B 2Z55A 2VW7A 1M0KA 4AI7A 3ODUA 1J5DA 3AG1B 3KJ6A 1TN0A 1AZRA 5F8UA 1OCZB 4BXSV 2EIMB 1CWQA 1S53A 5EN0A 1OF0A 4BWUA 1T5KA 3NJMA 3FQ1A 3FSVA 1ET8A 2XV0A 2B3IA 1WS8A 3ZBMA 1ETJA 5ITCA 1F88A 1L9RA 2PPCA 4E9RA 4DP6X 5B6WA 4YSDA 2PP9A 4YVUA 4XT3A 1F56A 2OCCB 3SBRA 1M0LA 2BP8B 5D4IA 4WTQA 3IN2A 1QKPA 2CALA 1URIA 1Q5JA 1PLBA 4KO6A 5PAZA 1OE1A 3NJLA 1E0PA 3RFMA 4N4WA 4DP4X 1L9HA 4YSQA 1MG3C 2GHZA 1NZRA 2Y04A 2IDSA 2MRYA 1AACA 3KW7A 1AS7A 4YSTA 3VG9A 2UXGA 4Q8BA 3WNIA 2QDWA 1IC0A 4BDVA 1AIZA 1N68A 3JT2A 3ZDWA 4MFHA 4EF3A 3PWHA 2EILB 2HX8A 1FBKA 3ABKB 1AZNA 4EIYA 1DZEA 2F95A 2R4RA 4PAZA 3QDCA 4ENZA 2X88A 3VI0A 5ETZA 1HAUA 4A67A 3T6WA 5AZDA 2W8CA 1JGJA 3X3BA 4XTOA 2XYBA 2R4SA 5KKHA 3AG4B 1FA4A 5J7AA 3QJRB 1XJIA 3H4FA 3QBLA 1IKOP 5I6MA 1ASPA 4QI1A 1W8EA 5H2HA 4DP8X 5ITEA 1W6LA 2AT9A 1SDDA 1JVLA 2DV6A 5JJEA 4F2EA 4GYBA 2DY2A 4KO7A 5C1MA 5I5IA 3NT0A 1GU8A 1L9TA 3ZPQA 1BYPA 3X3CA 1JZGA 5IY5B 1C8RA 4BEYA 2YAFA 3NJGA 1PMYA 1U19A 2B08A 2UX6A 4UAHA 3S8GB 2CJ3A 1E5YA 4NC3A 5I5MA 4HWLA 5LWEA 1PZAA 3FSZA 1Q5IA 1WAEA 5I28A 1VJMA 3UTWA 1L0MA 2L6XA 4RH4A 3S8FB 1AT9A 2CAKA 4A2GA 1IUZA 3V9CA 3NJJA 5TGZA 5G36A 1CUOA 3WIAA 1QM8A 1QLEB 1PF3A 4LDLA 1PLAA 2HRGA 3X1FA 4GY4A 6PAZA 1A8ZA 2HX7A 5H2KA 5B1JA 5I26A 5B6YA 2QDVA 4AZUA 4DPBX 2KSAA 5G28A 2UXFA 1DYZA 2FQEA 5B7MA 2BW5A 3WKQA 5DYSA 3C9LA 1PLCA 5B6ZA 4A2DA 4KLYA 2YXWA 4P5RA 3T6VA 4G71B 2AZAA 2XUWA 4YSOA 3PAZA 1VGOA 1VLXA 1JZEA 4CSPA 1ZIAA 4K5YA 4HCIA 4DKLA 4QIDA 1E65A 1BRXA 4UG2A 2XXGA 3NY9A 2DWTA 3NJKA 2PP7A 4Q89A 1KCWA 3T71A 4F2FA 1JV7A 2PLTA 3FQ2A 4A2EA 3FS9A 4DP1X 1ET7A 2GSMB 2ZWNA 2JKWA 4DPCX 2IH8A 2PPAA 2GC7C 2VSKB 1ZDQA 5B0WA 1E12A 4AKQA 5AHZA 1ET5A 4GP5B 1YLBB 2PCFA 3OMIB 4DP9X 5F7AA 2EI4A 1AS8A 1TN5A 4G7SB 1A65A 2YAQA 3EHBB 3TBBA 3QAPA 2I1XA 2AZUA 5B34A 5LDUA 2BRDA 4UHRA 2BWDA 1ZV2A 2JFCA 2AVFA 2M3GA 3NSBA 3NSCA 1KDJA 4KOCA 2H3XC 2VMJA 4HIPA 4AKPA 4HALA 2HLEB 2AFNA 4YSSA 3SBPA 3EMLA 5G2CA 5F7BA 1NDTA 2YAPA 3VGAA 2ZOOA 4LDOA 2YAEA 3SBQA 2IDFA 4JHUA 5D4JA 1AQ8A 2FTAA 3KW8A 3OAXA 4IAQA 3SN6R 2BP0A 3HAPA 3PXOA 3FSAA 1JXDA 2I7OA 1PAZA 4DJHA 3DQBA 4WW3A 4MD1A 4G72B 2IDTA 7PAZA 2IWFA 3CVCA 1BRDA 5H2IA 3QJVB 1W6WA 5JJNA 2EINB 4YSUA 3NP3A 4N6HA 2XV3A 4X31A 1KBWA 5H2OA 3PLYA 2GBAA 1HFUA 5AKRA 3PDSA 1JERA 1A4BA 2PCYA 2EIJB 1XMEB 1OE3A 1PNDA 4AMIA 2I7SA 3AZUA 3C75A 3NSYA 5B35A 6PCYA 1PY6A 4W1TA 1CC3A 1AG6A 1AZBA 2FQFA 1BQKA 1NIAA 4A4MA 1WA0X 2BZCA 3GXUB 1SHWA 2X87A 3FQYA 4W9ZA 1GZMA 5TK2A 1J9QA 1SF5A 4QRYA 4GYCA 5B3SB 3AG2B 5I6LA 2Y01A 1JXGA 2UX7A 3WNJA 1BAWA 1B3IA 2J57A 1PZBA 1KDIA 3ZX1A 2XVBA 4HYJA 1JZFA 1KBVA 4A2FA 3RYMA 5AHYA 4E9VA 3A7KA 1IBZA 1KCBA 4HYXA 2YDOA 2R7EB 4HCGA 1JOIA 1XB3A 2GC4C 3D4SA 2YAOA 3UAEA 5G2DA 4J4QA 4EJ4A 4NB7A 4HAKA 5A8EA 4FA7B 2PEDA 2GB2A 3H56A 4WAVA 1TU2A 1AR1B 4KNSA 3SQRA 1XB6A 3UONA 5EHFA 2BP0B 2ZZLA 1KGYE 3FYEB 3C9MA 4IB4A 1BXVA 3NYAA 1O0AA 1P8UA 3DDLA 3L45A 4KO9A 3TU6A 2YDVA 4XTLA 2LLNA 3ABMB 1P8HA 2YCXA 2NTUA 1UAZA 4XT1A 1UATA 2PPEA 1ZPUA 3PCYA 2I35A 1CYXA 1FFTB 4BK5C 3OE6A 2BZ7A 1AP9A 3TBCA 4LDEA 2FNWA 5A7EA 5I6PA 3H4HA 2IDQA 4F7KA 5ANHA 1NWOA 4QLWA 5A45A 1L9OA 1WA1X 3MBWB 2FWLB 3GYRA 1S54A 4FBZA 2X72A 2Y69B 5B1BB 4FAAB 1S51A 4M3HA 4EA3A 3NS0A 1NPJA 3EH5B 4BV0A 4P5SA 4L35A 2GI0A 5H2JA 3OM3B 3DTUB 1NIFA 3NSDA 3NY8A 1IW6A 4GPOA 4ZK8A 2UXVA 3CDZA 3HEIB 5B6XA 4L0PB 1PCSA 4BDVB 3OE8A 3IBOA 2XU9A 1P8IA 3P0GA 4A2HA 3OE0A 3TA4D 4L6RA 3CODA 5DHGA 2QT6A 1ASOA 3UADA 1GY1A 3PAVA 1V54B 3NP4A 3AW5A 1S8LA 2MTAA 1TEGA 1RCYA 1SFDA 2TSBA 3CVBA 3DKHA 2PPFA 4GXFA 4UF7C 3FU9A 2KS9A 5I6KA 4N8UA 4XTNA 3G5WA 1OCRB 1X0I1 4HHWA 1X9UA 3NJFA 3X1NA 2Q9OA 1X0SA 4N4YB 3X1EA 5I6OA 1SDDB 4IARA 2BW4A 2YAMA 5AX1A 3FU7A 3RZEA 2J4YA 1RZQA 2YARA 3EH4B 2JAGA 4XXJA 1HAWA 4G7QB 1JZHA 2IDUA 1AOZA 3X2QB 2FJSA 1TEFA 1JZIA 4CSZA 3QJSB 1CYWA 1E67A 1IBYA 4YVNA 5G54A 2WO3B 9PCYA 3QJTB 8PAZA 1KV7A 2P80D 1WA2X 2J56A 5PCYA 4JKVA 2WO2B 1SJMA 3GDCA 3NJHA 5B1KA 5E9NA 3MBVA 4KNFA 3PQRA 1C8SA 3OMNB 1BXAA 2XWZA 4HHGA 3T9WA 4X32A 5AZUA 4E9SA 2YCZA 1MZYA 2XLLA 1H68A 2XV2A 2DYSB 4PXKA 2W88A 2H47C 3FU8A 2J5WA 4KOBA 4HZ1A 2A3TA 4BXVA 1N70A 1GR7A 2Z73A 5B1AB 2BWIA 1OCCB 2VW4A 1PZCA 5H2LA 2YCYA 1GSKA 3ZEVA 1JVOA 1PXSA 1BRRA 4NAJA 4JHVA 3FSWA 4QKTA 4DP0X 4E9WA 1M9WA 5I6NA 1MZZA 3QBGA 5H2PA 5BR2A 1BQRA 2HXAA 4KNUA 3IN0A 3COCA 1KMEA 1I53A 3HAQA 3QBKA 5G53A 5B7FA 1AS6A 1MDAA 3QAKA 3BVDB
chains in the Genus database with same CATH superfamily
4Y2LA 1EVTC 3V9EA 2W91A 4DW2H 1DLFH 2VW6A 4U49A 4Z7OB 2OLDA 3QJOA 1Q9OA 4NPYB 4W4OC 3ZKMD 5C0DA 2IPTH 5C09E 2VERN 1RU9L 1EZUA 4NAMA 5D7KD 1A6AA 3BX7C 2XETA 3TT1H 5JIMA 4E9QA 2A83B 3X3FL 4GKSB 2N0KA 3ZKMC 2X41A 1FAIL 3EOYG 4OZFH 2GHWB 3BSZA 4L8SC 2AJUL 5K9OA 1WO2A 2DLIA 3K6SB 1D5IL 3NEEA 3V7MA 3NYKA 3FQUA 3VI4A 5E94A 4K7PL 4RQQA 1U3ZA 1KSRA 2HG5A 3IFOA 1AANA 4A37A 4BWBA 5D1XE 2XFXB 2DH3A 4XCNB 2QBWA 5T1LB 5AL0A 4GJTB 5MEOA 5CLTA 3ZOAA 4LAJH 3QAZC 4JQIL 4OFDA 1E3FA 4N90D 4DQOH 1AO7A 4NCDA 1GMEA 1CE6A 3I02A 5CJ8A 4TNWK 3HJ0A 4ZW8A 4P5TD 4U1NB 3GMMA 3UACA 3RKPA 2GT9A 1NMCC 2OXHB 3HMXA 3V4PB 2X2YA 2GIMA 4L3EB 4LEOB 5AZEH 4GBXB 1J0YA 1RUKL 4F9LC 4RGMC 5HP5A 1IAII 4NWTL 3B6SA 3CZFA 1WBXB 3FPYA 3P3YA 4RWYH 3MDJA 2X70B 3TEXA 3BN3B 2NX5E 3GBMH 5IJDC 5DA0B 4ZMNA 2IOOA 5MI0B 5KSUA 2EUZA 3NFPB 3PDGA 3FTYA 2VIRA 4U0QB 3MOBL 2K6WA 4PMFA 2CRMA 4GMTL 3FQTA 4QOKD 5EOCH 3IEAA 1SJEA 1LEIB 3SGDH 1WZ1L 5D1QA 4FF9A 2I32A 3GZOA 2QFPA 2HRPH 4XMPH 4EN3B 1TXKA 4M7KH 5A44A 2FECL 4X9FA 4JRXE 1XV8A 5TGBB 2A9NH 4K3GA 1X9RA 3RILA 3ASWA 3IE9A 4UQ3B 4GP4B 3GF8A 5EUOA 4JR8A 3CMOH 4YZFE 4AL8C 3WG7B 5H8DA 3LY6A 5CN1A 4WJG3 1EAPA 2GUOB 2H26A 4R7DB 3RPKA 4DKFL 4S11A 4AEHH 4NN5C 2OCJA 2XQYK 3VW7A 3IFLL 2EDYA 4BVNA 5JIHA 1D5XB 3V6BR 1UENA 2NNXA 4QCIB 5AW4B 5H2BA 3RP1A 4YDIL 4PH8A 1F11A 2EDMA 4TOYL 4U2ZA 3AM6A 3RIFF 1XGRA 4XP5L 4YBHA 2BVOB 1YEJL 1IAKB 2ORBH 1Z2KA 3VXTB 4TUOB 5CR8A 2VL5A 3HE6C 3SE8L 4JY5H 4YEEA 1PW3A 2XN2A 4WI9A 1ZGLA 1CFNA 3L1GA 4UTCA 3GO1H 2IG2H 3QIUB 4DP0X 1IW9A 4LVHB 3MRNB 2O61A 1XXDC 1V7NL 3KPLB 5KW9L 4OLYH 4IHOB 1C9SA 5CLXA 1JDDA 4UU9B 3WIHL 4PS4L 2PTUA 3IAQA 4X0KB 4KHTL 3BKYL 3O2WL 3U1SH 5I1CL 4NLAA 1QLFA 4JG1L 3FB7A 4LLMA 1YEKL 4YHNA 2OJEA 5HBBA 2FUQA 4ONOA 2R1YA 3IMUA 2FYYA 1IGTB 1ZEAL 4MQ7A 1E6JL 3LD8C 3O3UN 4M02A 1NPUA 3PHOA 4AENA 4ZYKA 3D6GA 4QYOB 3T4AB 4G6KH 4N8VA 4JFQA 4LLAA 3IXTB 4H25B 1NM9A 1F8TH 5J4MA 4KXZH 3APMA 3B2MA 3OVUB 4YGVB 3TZVD 2GTZB 2PYFA 1KTLB 4I9XA 2B4CH 1RJYB 4PJFF 4G8GE 4IIQA 5DEFA 5EN0A 1OF0A 3AS2A 2L3BA 3CSTA 4JVPA 5E8OB 3ZQWA 1YRKA 1PG7H 2GJRA 1HL8A 4HXAH 1QW8A 2B59B 3L4VA 1A7PH 1BJ1H 4HSCX 1F88A 5B6WA 2ZKYA 2JCCE 2OMYB 2CGZA 4X8CA 2YD6A 4RDQG 2Y0SA 1ZXQA 4LCCC 4MRBA 4B50A 5EEVA 2WXQA 4I89A 4LP5A 1UXLA 4HIEB 2CKBL 4HH9A 3N85H 3OR7A 3PRZA 4Y9CA 1MJ7L 2Y04A 3UJTL 3FTVA 1RL1A 3X3GH 1YEEH 1G9NH 1TZGL 1MVYA 2V2XA 3FMGH 1KJVA 5I0ZA 3JT2A 1JWSA 5T3XL 4TTGA 1AZNA 4I18B 5DC4B 4PAZA 1A8JH 1AGEA 4UMGA 2P44B 1U91B 3IB4A 4L4VD 3F8UB 3V0IA 2QGDA 3I85A 5DR5L 5FXCH 1R3HA 5TDOA 1JGJA 5IQNA 4OZIE 2OMBA 3LKNA 3DUSA 4XTOA 4MVBC 1XJIA 2QHRH 3FQ4A 4Y9GA 2OX5A 3FKUS 3LN5B 3H55A 1ZLEA 1U3JA 1ZT1B 2W95A 5BZWA 4OZHF 2ATPB 2OW6A 5HGHB 5FFLA 1XMWA 2C8NA 4R2GD 3KGUA 1OAUL 3MLYL 5MERB 2ED7A 3RVWC 1FGNH 4XWOC 1RZIA 3WEBA 5SWZE 1Q5IA 3AABA 1OAQH 4P23B 1E8XA 3GMNA 5T1KD 1Q9WB 2R0KH 3VI4E 3H9SA 4NUMA 3GEFA 4KK8D 1FPTH 5JHDD 3R7QA 2F2HA 3SZ6A 1YMMB 2R4SL 3QI9D 4Q9BA 2OQJA 3SKJL 4RAHA 1SLUA 1RUQH 1AO7E 3KPOA 3LS4L 3FTUA 4R7NB 1ZGLP 4NJ9H 4H88H 1ROWA 3WUZA 1UADC 1CFQA 1PFCA 1DN0A 1Q90A 3FTWA 2J1WA 1QX1A 2JJSC 3O3BA 3OBAA 4G71B 1H15B 2AZAA 1IQDB 3PQYD 2IPUG 2XA3A 4JREC 4N2FA 4CC0A 1JPGA 2VQTA 4XPTH 2VMFA 4JM2D 4UG2A 3VFUA 1ZV9A 4ODTL 2IJ0C 1T04B 3KZ8A 5HHMB 1IE5A 2CM5A 4RNRB 1D6VH 3CHQA 4QEGA 1ET7A 5GJSH 1YNKL 3RPIB 4JM2C 3CIAA 1ZDQA 1H6UA 3E9TA 4OZGF 1QWHA 3VFNA 5AHZA 2HFGL 3H2PA 3HPJA 4HJ1A 1TZHA 4G5AA 4H4NA 4KDTA 5DURB 1I7ZB 1P4BH 4FKHA 4XVUD 4H8UA 4U1SA 3MRBA 4CJ0A 2AV7B 1QSFB 3TV3H 4YS4A 2WINA 2Z31C 4FJYA 5D1QE 3ARGB 2RALA 1CK0H 1KG0A 3KWUA 3RY6C 4ZD3H 3DPBA 4M5SA 4CVZA 5B38B 2FEDC 1GSMA 4F7MB 2YEZB 4W6YB 3SDXE 4LPTA 4WK0B 3JSSA 2CUMA 4HJJH 4Q14A 1N6VA 2X05A 2ZOOA 3BWUC 4G43B 3DVIA 1INQB 4EO5A 2WKOA 3GI9H 2IDFA 3ECQA 5EUOE 3NSXA 2FB4L 1D5ZA 3OAXA 1PKQA 2A38A 4CU6A 4PPTA 1LO4H 3THML 3ML9A 4B7LA 5D93B 1MLCB 2ZOLB 3IF1A 1KYFA 1F6AB 2KS0A 5H2IA 3TH2T 2YJQA 1RZKH 2PYEA 3MHZA 1NGYB 2OULB 4A2LA 5B3JE 2UY7A 2XYCA 4FTVD 4YDJA 4DEPB 5FA4A 4N2IA 4I3SL 4JDVA 4NZTL 1LP9F 1WP6A 3HUJB 1YQ2A 3BH8B 3R4RA 3IDJA 4J1UA 1R5VA 4BKTC 4TQ8A 4DN3L 3RIAK 2HVJB 1OF2B 1X5GA 1WUZA 5IW6B 2PR4H 4DAGL 1T7WA 4QRYA 2R56H 4PRNA 3V7AE 4TM9A 4EZMA 3ILQC 4Q6IB 3ZK0A 2P5WB 4JO2H 5J12C 4LBAA 5CEXA 3VI3E 4AH2B 1R4XA 1KBVA 1UA6L 1N8OE 3VD1A 2XTLA 1NFDB 4ZI8A 1UZ6F 2YQ3A 4KPHH 5F0PB 2HRLA 4RDBA 2GC4C 3BEWA 3QNYA 5EZPA 1IC4L 2Q2EB 4EJ4A 1TR7A 4NB7A 1B2WH 4S0TD 4Y89A 5C0GA 2GEEA 1XB6A 3LH2H 4NPJA 1DSFL 5JR1L 2Y7MA 3MJ7A 3NYAA 1O7DC 3L45A 4MXQD 1QBML 2V9RA 4HX1A 3CSFA 2F61A 2CG9X 2DQIH 2EE2A 5CP3A 4U6YB 1HDMA 1ZKAA 4HCRA 3WY3A 2XNAB 3KPQA 2X09A 2CWRA 5HHVH 3FQRA 5FUCC 3OE6A 2NDFA 2CGRL 5A7EA 2LU7A 3CZLA 4MXQC 4QLWA 1NWOA 2FLRT 3G6JB 4JZNA 3N9GH 1KBGH 2MPAL 2QSVA 4PGBB 5HGBA 1NPJA 1H5BC 1JV5A 2GI0A 2ZUSA 3OZ9H 1CL7L 3N5AA 3DRQB 4K3JH 3ESPA 5IV2B 1EJFA 1DQLH 5B6XA 3TT3H 3QWOA 1YEWA 3BDYL 3MSPA 1JGEA 3P0GA 4XR8C 3NRQA 1IBBA 3US9A 2CDFA 3AQXA 5FUOH 4BEIA 5I75B 1ZT4A 2GSIA 5F7EL 1M4KA 4F57L 1J8HB 3FU9A 3HC3L 4G42B 4NNYA 2QADB 2D7MA 1CFTB 5DSCA 4CVWA 3UPRB 3LNHA 2UZIH 4X7SH 1VADA 4YX2H 3RB7A 3VRLF 5IVZB 4NO0D 4JNXA 1OW0C 2ZXQA 4LDEB 3HN8A 3NACL 4MX7B 4HC1L 1A02N 2RA1A 5A3ID 5JOFA 5GZNA 2CU9A 5JW4N 5DJ8A 4ZTOH 4XNUH 1XCTA 1YO4A 2HTLD 2VAAB 3BAEL 4JRYA 3I9AA 2Q6WB 2QGBA 1D7DA 1OM3H 5GGTL 1XGTB 3VSTA 5A3IC 1SJMA 3P9LA 4IRSB 4AQ1C 3H7BA 3AXHA 4JPIB 4N0CC 1RK0A 1WD9A 4UT9L 1M7DA 3WNNA 5C0JB 1YZZA 3VXMB 1DQKA 4ESKA 1B2YA 2BC4A 5I8EB 2XV2A 4RSVA 5CHNA 3QZWA 4L4TA 2HVKB 1U8OB 4IOSD 4JO4H 2IQ9H 2NXZC 2Q87A 2CUIA 1JGVL 2VXQA 3M1BB 1G9HA 4JHVA 1N5YL 4BIKA 2DI8A 1URLA 2PR9A 3HRZA 4HKJA 3AROA 5DHVA 1MCSA 2XPGB 3D4YA 3R06B 1IGJB 5KSAD 1M7IB 1VCAA 3FK3A 4O00A 3V10A 4ZMZA 4U1LA 2R0LH 4JDEB 4YFLF 3RKDD 4RGND 1J05B 3HZMB 4ZDHA 1WBYA 1G94A 4BK4A 1F6FB 3MRJA 5TQ2H 5AAMA 3MOAH 2X42A 4GW1B 3MV7B 2YUWA 4JFXB 4LMQE 1UD6A 5MP6L 4OCRL 2B77A 3CVHB 3FFOA 1UFUA 5AENA 2Y06H 4OI7A 4L1DA 4OLVL 4O02B 4MD5A 3PGCA 4HGWB 4E68A 3NZHH 1JTOA 3ZE2B 1NAMH 4JFHD 5CIPH 4LPWA 3BVTA 3S5ZA 3NSFA 5A2CA 3ZYOA 3ZTJG 1A3ZA 4BV1A 3QBTB 5BRPA 1MHHB 4IRZL 4WIQA 2ZUTA 4JO8A 2ZCHH 4EKXA 4ZO9A 5LDSA 1NDGA 4GT0A 3APCA 2IAMD 5ETUA 4PV1C 3JWDC 2DQFA 3D85A 5FHAH 2J6EL 2YPLE 1K72A 3LSOB 4PJXE 1ASQA 3SQOL 4AYGA 4WW1A 4EI6A 3HHSA 3OB8A 3U25A 1MH5A 2R27A 3AU0A 5KBLA 3UP1A 5H37G 4W9EC 1WS7A 1ANUA 3HHMA 5BCAA 5E08H 4GS7B 2YD4A 3F2LA 1HE8A 4XPAH 2YQBA 5FYJL 4L9DA 4M1CC 1KG9A 4KQ4L 4N26A 4R4NC 1XBRA 1U95B 1PKQE 5DMJB 1AZCA 1XEDA 2ZWSA 2NNAA 1Y18B 5FAAA 1S8DB 5BR5A 2FWOA 5D2LF 5T1JA 1EBAA 5HI3D 1NGXA 2R0WL 3WFDL 1NBYA 3L1OL 4OGYL 4G7RB 4MQSA 1HNFA 3T2NH 5E4EB 3I9PA 3ECVA 3UZEA 5JORB 4Y9FA 4CADB 1KENL 3BPNC 4YAQA 5HI3C 1XGYL 4NZJA 3UTZA 4MMZB 2VO5A 4NC0B 1QNZL 5KVFE 5F1IA 3PWPA 3G7TA 5T3ZL 2XG4B 3IDNA 1SMDA 3WFHB 4YHIB 4WHTA 4B5EA 1N59B 4UUJA 3CDFA 1U3YA 2F19H 2PO6B 2W9LA 1YYCA 4MA1B 1QA9B 3B37A 3SGEH 1L0XA 3VRIA 1PIFA 1T4KB 3U1SL 4PP1D 4F24A 2FGZA 4H1LB 4YHMH 1YECH 1ZANL 1BXUA 1CFVH 2X4NA 1NQBA 4P9HL 2NYYC 4CVUA 1N5AB 4M7LH 5KVEE 4M6AA 2ROYA 3ZDZB 4A6YB 4K23H 2ICWB 1YSOA 4MCYA 1MFEH 1BP3B 5FYKH 3SE3A 2GTQA 1P84J 3DSFL 4P46C 2AMUA 4Z7UE 5D7SH 5D7LD 3MXVL 3OAWA 2XWBA 1A7BA 1BF2A 1NDMB 4H26B 4PB0H 4QRUA 4W4OA 4ZPVA 3KG5A 1FORH 3DTDA 4S1QH 4NC1C 2EDTA 2QL1A 3OXSA 4M29A 3TNNA 4DAJA 5EZIL 4IOIA 1FF5A 1I7RB 4JY4B 3TVMB 3O6MH 2QQKH 4I0PB 1OAYH 4V2CB 2V9TA 3GIVA 1OO2A 2YGNA 3KPPB 4KJWD 1QEWA 4FG6D 4IBYA 2FIRT 2IBBA 4ISVB 5F70A 5I0WA 2QQLH 2V33A 3K80A 1AGFA 2B14A 3ISWA 5FOBB 2YS4A 3QZOA 5ENWA 1RP9A 3GJFA 3MRHB 4KJWC 3WMSA 5JIPA 5FM5O 4FG6C 2J8UE 5TPWL 4F37F 1EZVX 5TE7H 3RB5A 3WS3B 4JG0H 4R4FL 5J6GB 2OP4L 4WEEA 1SOQA 4HOMA 1IM3B 2FNBA 1MW0A 3KWWB 4WUUB 5EN2A 25C8L 5IF0A 1MRFH 3MGOB 1ADQA 4YQXL 3OE9A 4HPYL 1ND0B 1OGTB 1TN0A 3UBXG 5BS0B 1DJYA 3O6FB 2P46B 4F9LA 1T6VN 2QHRL 2XV0A 3OXRB 1K3IA 2H6PB 1WS8A 4HIJB 4P5TA 3T04D 2NQDA 1FGVH 1N9PA 1WAAA 2YGOA 3TL5A 4XT3A 1MCIA 2NUTB 3S88L 2YD0A 5GRVK 2X28A 3APDA 3X13B 1ES0A 1PLBA 3NJLA 3LJ3A 1JZ2A 3D25A 4L4TE 5LNEA 4DP4X 1FCGA 3NZUA 4P4RB 5DZPA 1OAQL 2EYTA 4ZQKB 3U9PL 2VDKH 1NCJA 1KCUH 2R0KL 5EU7E 1IC0A 4GT7A 5JYLA 4U1MA 5DJDA 3QG7H 3ZDWA 2KZWA 1I1FB 4LLWA 1R24B 2Z3FA 4QOKA 4ENED 1C12A 5C86A 4JFEB 1DVUA 5CEZH 5IZ7A 5ETZA 2VDQL 3D0AA 4D2NA 3TCTA 2HFEB 3GIZH 2ZQKA 3VXRB 1MUJA 5DHXB 5C6TH 3U4EA 3S36L 5IB3A 1CGYA 4R5XA 2VLKD 3V5DA 3D9AH 3NVQA 3OLIA 4FHBD 4GMSH 4RBPH 4N5ED 1XH3A 3EUDA 4GYBA 1WFNA 1KIRA 3K46A 1T4WA 4OTXL 3U48A 4OVVA 5KSBE 4C83A 1A6ZA 4I7ZC 2MCPL 2CXGA 1JF5A 2GYSA 5ICUA 1RHHB 3NEXA 4JHAL 4UAHA 4NFBA 5IJVA 4I85A 4GXVL 4WCYL 4F91B 2Z7UA 4GUPA 4OT1H 3ZY7A 4DCQA 1FRGH 4GO8A 5AYQA 3IMTA 3S8FB 4FMKA 1WICA 4KH2A 4OI9A 1CIDA 2DIJA 1VACB 4X98B 3NPZB 3V0EA 3BUYB 3WIAA 1SGKA 4UDTB 2X0UA 2L04A 4FG4A 4WWKC 4MD0A 4OIBA 1PLAA 2AQ1A 3LIZH 5F6IC 5IHLB 3NQKA 5D7HA 5I71B 4A7GA 4R0LC 5DUPH 1NFDF 3UC0H 4KZEL 43CAB 4QXTB 4PWGA 2VE6B 1CG9B 1GC1H 3B9VA 1QABA 4Y4HC 5B7MA 5IROD 1W80A 3VQ2C 3U7YH 1ZGLM 1F4YL 1MCEA 1HEHC 3GI9L 3WO3B 3MCKA 5LAPA 4K5YA 4FYTA 4TQEL 3IJ7A 4YNYA 2BHUA 3NGBC 3KLLA 5IROC 2Z8RA 3HFMH 4JVUA 3DARA 5AUMA 4LIQL 2DWTA 3FW6A 3TTSA 1S2EA 2VDLB 3EYSH 3ZE0E 1JV7A 5FK9B 2X0VA 4X5XB 1M9SA 3V5KB 4IQHA 4BH8A 1GH7A 1MCKA 4PLKC 2EDQA 3QEUA 2BSSB 1YNLL 2YKKA 1WFJA 3OPUA 3IXAB 4FEIA 4OAWA 2BIMA 2EI4A 1HC1A 2ALWA 4KVCL 3B2UD 3AS1A 2F8XC 5KS9B 1YEDA 1JPFB 3O9WC 1M05B 3PWPE 4JZOB 5D5MB 2BWDA 1WT5A 3Q05A 2AJZA 4XRCB 3O4OB 4PS8A 2R56L 1KDJA 5DCCA 2O6FA 4PJ6A 4MS8D 2QELA 3P2TA 2X3CA 1RY7B 4F3FA 4LCCA 3VDCA 4G80B 5BVJB 3VGAA 5TE4H 1LTXA 3LPFA 3C8DA 4MS8C 5HPMA 4IAQA 4XBPA 3RZCB 4ORZC 3WENA 1WFUA 2E27H 5IR1B 1HHJB 3MODL 4LKCB 5T5NF 1PAZA 2QGCA 4G72B 3CCHB 4NWUH 3B7UX 5BPPA 4NN6B 3KVQA 2VABB 4FERA 1OSYA 2XV3A 3MKGA 1VKXB 3L3KA 4R4BB 3BMVA 3PLYA 2HWZH 1TIUA 3PDSA 2Y7QA 3NCBB 1J7VR 3Q0HA 4X83A 5KSVB 1S7WB 2YD9A 5LCVH 1WEJH 4KKQA 1KJ2B 1CC3A 4PWKA 3M7OA 4OW6A 4DNLA 2VJ8A 5A40E 4U3SA 2P8PA 1W8NA 2MFNA 4M00A 3ZL2A 1HIML 1EEYA 4L4VA 3N9GL 2JKXA 4Q52A 4NEHB 4HYTB 1G7MB 3A0OA 3IKKA 5EBWB 3O45B 3APFA 4OH2A 3VQMA 4UQ2A 1AHWA 2DLFH 2RMNA 3MV9B 1IBZA 3CLWA 4OIIL 3NTCH 2QPFA 5I8CB 3CBJB 3QXAB 3C8KA 3BPLC 1YN7B 5D7KE 1ZS8A 1EFQA 3S35L 2VXSL 2N7BA 1DJWA 4HS8L 1K8IA 1XTMA 2AEOA 4FEMA 1F4WL 3LMJL 1PQZB 4GG6F 5F6HJ 5LN4A 2ZZLA 2WZPD 3BVNA 4TSCL 1UQSB 2NY1C 3ABMB 4JFPA 3GTVA 4LSTH 3O3EA 1T3FB 5T1KA 5LXGH 1U42A 4JANA 4R26H 3RWDB 3L3GB 4N2GA 4PSPA 5HDOA 3OKMA 4JCWA 2VDMH 4JUTA 5I6PA 3WUWA 4KITB 1BFSA 2IDQA 4Z77A 2JJSA 3QI9A 1JYVA 5FW8A 4JGUA 1HHIA 1E4WH 1IBHA 1NOLA 3ZGIA 1NCNA 1N8ZB 3D0VB 3EJZC 3PWUA 4IKJA 3EFDH 1DJXA 1WPCA 3INUH 3IJYA 4PGDB 3NSDA 2Q86B 1WCBB 3DYOA 4YHZH 3FT2B 2QKIB 1NEZA 1RJLA 1QO3B 3C09C 3SQBB 2I07A 2EE6A 2EYRB 4X80H 2UZYB 1R3JB 4MXWH 3OAZH 5J3HD 4JM2A 4M7LT 4C56B 3PJSA 4P4KB 2MQCA 1AJ7H 2OYLA 2ALAA 3M88A 4PJ8D 4ZZKA 3MRMB 4EKJA 2AABH 4KTDH 5CD5D 4ABWA 1PLGH 4N9GB 5E1IA 4WI6A 5HVHB 2KERA 5F72S 1UM4L 5LNDA 3V79C 3G5WA 5C07B 4G6MH 2ZYSA 3F7PC 4PG2C 5BZXA 4AYFB 2PTTA 5C08D 2OMWA 5DJXB 2BOLA 3P4OB 4EJ1C 2IQAA 5CD5C 1E9OA 4PR5B 2GABA 1KTKE 3NFNA 2JAGA 2XQYA 1KFGA 1FL5A 3DURB 5D7IA 4ZXBC 4Z95L 1TEYA 4HKZB 3EGXB 32C2B 4AGLA 4N2KA 2IALB 3DDFA 1DDHA 1E9PB 4XC3H 1BD2B 4UV7L 2H1PL 3DK0A 5EU6B 5C71A 4LBEA 3QUKA 5ACZB 3QXDA 1WAPA 4FLRA 3K6OA 1U3NA 4XN7A 2D31B 3T9WA 3ZYJA 2DLHA 2OSLB 2X4SB 5CJOH 2G5BA 2A74B 3P4NA 4GAJL 3N0AA 4Y5YA 5IMKA 1RIVH 3B2XA 1C8PA 4Z7NE 4ZW6A 3T8XB 1GR7A 4FXLA 4FTVA 5DK2A 2ZCHL 3TCLB 4KFMA 3ZEVA 4NQCD 1Q0YL 5AALA 5AAWC 1P1ZA 3FUDA 5GIRB 3G6AB 4ERSL 3T0VA 4CW1A 5CU5A 1T20A 1I1CA 4MDIB 2NMSA 5I6NA 5ITBH 2YO3A 4FZEL 4HHAA 1GA2A 5I19H 4FXTA 3D0LB 2QV4A 4NZRL 5J13C 4LQFH 1C1EH 2H3KA 3DO4A 5DRNB 4NRXA 2X4PA 3L5HA 2NTWA 5IJCC 1QI4A 1TSRA 1BSIA 4PM1A 4BZ2H 5L0QC 4NUPA 4D9RD 4ZAKB 5KYXB 5BQ7A 3T2OA 2BFVH 4Y9EA 1ZVSA 2ESVB 3OKKA 3O6LH 1FYTB 1NOAA 2G87A 1SM3L 2PW2A 1YQVH 4PCYA 2MPVA 1T2JA 5HDBE 1Z9MA 3HARA 4Z3HA 1GJIA 4PJCB 2DYRB 4RFOH 4YH6A 3RIKA 2W80C 1XCQB 2CJUH 4HXBL 4NIYE 1ZLDA 3T2NL 4DZBA 3WL9B 1H0DB 2ZFEA 5IQLA 3VTAA 5EZOH 3HRPA 1RKRA 3TYFA 1SHSA 1GIGL 2A9CA 4KROB 2XT1B 5GS2D 3ASNB 4AQ8C 2FEJA 5B39A 4JFUA 2VLRD 1HL5A 3CFEA 3IU3A 4BZ1A 4LCWB 4UQ9A 3DX4A 3P73B 3KM2A 3R0NA 1JWUB 2A6IB 1OAZL 2WXMA 4RAVB 1NOFA 5GRJH 5JLZA 1S7SB 1CR9L 4TUKH 1XCXA 4QHMB 5HVFB 1FDLH 2Z93A 2AJXH 3FQWA 2EECA 4X42A 3V55A 2WY3B 3CTTA 4KI1A 3U7WH 4K71C 3IMRA 5INDA 3RL1B 1BEXA 5DJZA 1NC2D 3UZQA 4WWPA 3VWKD 4JKNA 5F7MC 1S9XB 1TUPA 4X4XB 1JHLL 2IGFH 3LHPH 1WV7T 3C9NA 1P1VA 3GTTA 1AGDA 1SOXA 3O8XB 4HA1A 4POUB 4XCEA 5ISZD 2Z6FA 9CGTA 1LD9A 3TBYA 4NO0A 1ZIBA 4P99A 4W4NA 4H5SB 4PJBB 5D2NA 3FUHA 1F3DJ 4W9FC 3SKOA 4YIQA 4R90L 1HZLA 2F53B 1KIUB 1FORL 4AQ1A 5L88L 1P4LA 2QPUA 1QMUA 1RIHH 4N1CA 5DZ9A 2Y5QA 4H8WH 5AD0B 3RVXD 3ZE1E 2UXTA 1OE2A 5FF6A 1KPRB 1S8JA 2FBJL 3GKWH 3L3HB 2QQKL 5HGDB 1OAYL 1OVZA 1S7VB 4PTUA 3UC2A 4M7ZB 4GBRA 3TF7C 3KYKL 4MJ4A 3E7JA 3Q44A 4J3OH 1NIDA 1U8CB 2WWMD 4BK8A 4F8QA 2NY5C 3RVXC 1SFHA 2BRQA 2CRZA 1YYLL 5DK3A 1OCOB 4P3WA 4LLVB 2M83A 1HCVA 1MCDA 4RVBA 2XKSA 3APNA 4BCYA 2WTRB 1ACXA 2WLZA 2Q3XA 4IOSA 1QKZH 3NPSC 2ADYA 1L9PA 5JNYB 1XF2A 5ADOH 4R7LA 1KJMB 3MA7B 1R6VA 2GG1A 3I6GA 1KCVH 1NICA 1NLDL 2XICA 1DSWA 3FQXA 3DIVA 2ZKHL 1KLFB 3X17A 2EKSB 3OWEA 4YUEL 1IZKA 5KSAA 1HJCA 2UZXA 4LSRH 1CLZL 3N41F 3HMXH 2H0EA 3FFDB 1F2QA 3HI1B 1WBZA 3LNFA 3DX6B 4U1JB 1I1AB 2YXVA 2FR4A 3QDJB 4LU5L 2WXJA 4DVBA 1AQKH 2IFFH 1CGSL 1XIWB 3BAIA 1A7NH 1MCQA 1TQCB 3JZ7A 4OZFB 5F7YC 2XN0A 1NUGA 5HYSG 1ZJAA 4WVRA 3S5LA 3TP4A 2P8MA 1BQHB 1I1YA 4IS6B 5E8NB 1SLWA 4UILL 1S7QA 2CKNA 2FT7A 3H54A 1NPNA 5HDQL 1OKEA 4MZ2A 3NUKA 1A2YA 2LOEA 3EJYD 5AZ2H 4KK5D 5D1ZC 5BV7H 3QG7L 1O7VA 4JW3A 3Q3GB 3JV4B 5CD3A 2IAMA 2BSED 4E9TA 3DV6A 1A5FL 1JRHI 4QGTA 2Z55A 3EJYC 4AI7A 4KK5C 2EDXA 3BUDA 2PW1B 1G9MC 2HT2D 2P24B 4NFCA 1DJIA 2HJLA 1CBVH 1H9VA 3FSVA 4JQVC 3ZBMA 4GMSL 2HT2C 3B56A 4OGAD 1Z7JA 4YSDA 3TN0C 1F90L 2QMKA 3L3OC 3T2PA 3FCGA 4QI3A 1CI5A 3ME0A 4L9LC 3IN2A 4TRPL 2V5MA 2ICWI 3RX9A 4JFYB 4MCZA 3VB9A 4YXHH 3IPBA 1KXTB 3BPOB 5D5MF 2G9HA 5TF0A 1N4XH 3EKCA 4FTVE 5C8JA 1UASA 4QO1B 2WLJA 4YWGL 4WI0B 2ZUQC 3QFDA 4Q2ZB 3MRQA 5JXED 4EIYA 4NNPH 3QDCA 4QR7A 4RMTA 1TETH 2W8CA 2X6MA 4ODVH 4I48A 4O2CA 5L9DL 2FWUA 2E76C 5FDWA 3ZQ9A 2VDRH 2YGVA 4ETQA 4WI2A 1HEJC 5IB5B 1MWOA 4MA3A 2B2XH 2C4XA 4X2UA 3T3ME 4L18A 1O7DE 1JCKA 3C2AL 1R19A 3A6OA 1T1XB 2AJSH 4K3EL 5EO9A 3SGJC 4QDGA 1PMYA 3S0PA 4S1RH 2X9YA 5FUCE 1BZ7B 3SPVB 3PUCA 4I2XB 4K3DL 5ANMA 1MJJB 3EIFA 1XH2A 3WXVL 4OIAA 2DQHH 2JI3A 2RQEA 2R4RL 4Y4FD 4ACPA 3SPCA 3N1FC 4FQHA 3KYNB 3E2HC 2OYMA 5A6MA 3WKYA 2Y1YA 3GBNL 2XZZA 1GVIA 2BNRD 3MC0A 5D7LA 4QRTA 5HHPB 2GSGA 3EGSA 2P8LA 2TRYA 3L16A 3GSUA 5J11C 3BPCB 5AOZA 2UXFA 4N2BA 2V2WA 4ONGH 2E3VA 3B9KB 3PV6B 5KAQG 4KLYA 3VFPA 2YXWA 1MLBB 4TULH 1DEEB 3RTQD 2YMXH 1PX8A 2DQGH 2EDOA 2J2ZB 4UNTA 1KPUB 4Z0XB 5JPNB 2GJPA 3ULVF 3LN4B 5EU4B 2JJWA 4ZMWA 4OZIF 5ESVA 4LRNH 2WLYA 4A2EA 1J88A 1TO4A 3U0TA 5L2JB 3FQNA 2KZKA 3B3IB 4Z7IA 1E12A 1LGVA 5H4YA 2DJ4A 1KC5H 2X4TA 3HB3D 1RXLA 3G5YA 2EYSA 1SXSA 5DT1L 3EHBB 4JLRB 2F54B 1C08A 1EJOL 2I1XA 3N04A 1ZAGA 2AZUA 2FJHA 3NRFA 2DN7A 4PJHA 3MJ8B 3E8UH 3MLTA 4JFZL 4LRIA 5E6YA 1S7RA 1LILA 1T22A 2ED6A 2KDYA 4NOFA 3VGFA 2YAPA 1I8IA 4Y16D 3U36A 3KPMB 4DEUA 5JDSA 3BGAA 1IIKA 3MI6A 2QTVA 3UTQB 3GSVA 3PXOA 3T1FA 1UH3A 1URZA 1Y0LA 4Y16C 3CVCA 5FGCE 4OBRA 4R8WH 3CN2A 2FSEB 2YEQA 1TJHL 5J6HA 2ZICA 1ZHKA 5SWSE 2WW8A 5CSBA 5EC1A 3MBXH 5LXGL 2D3JA 4XE5B 2EDJA 5CWSB 3P30H 4D9QE 1Q72H 2XWJB 2P49B 1CD1B 3OKEA 3S3JA 2ISDA 3KCPB 1ECZA 5AW7B 5IVNA 5AB0A 2BVQB 5AB2A 1OSZA 4KRPD 2P47B 2WYTA 4J28A 5TK2A 3GMRA 2IADB 2XZQH 5EO0A 3CVIL 3EFDL 3IFNH 3OG4B 4H0IA 4KKNA 3K4DA 4FFZA 3SKMB 1KDIA 2YD1A 4AVJA 1N10A 2CIIB 2NY3B 2VLKA 2R8SH 2ITEA 4NI3A 4G8IB 2ZXAA 1XGUB 1NMBH 2ZCLL 2YBRA 1JGLH 1MFDH 2PCPA 3K6FA 3J8F7 3LB6D 3GNML 4K8RH 2YPVH 4AZ8B 3PP4L 1KXQA 3N50A 4PJGE 3SDXF 3UO8B 4AYSA 1KTCA 5T3XD 4ABUA 1BG9A 4MD4A 3WNLA 3ILPB 3OGCA 2ILLA 4KO9A 1JHTB 4PTTB 2ARJB 4FXKC 1E4XL 2A77H 1FFNA 4R0LA 1XSOA 2VXUL 3J2PA 2B1OA 4PY7B 3CSYB 2E6JA 2F5BH 1MCRA 3W9EA 1W91A 4LASL 4FBZA 3SDAD 5DRXB 4U1IA 2YKLH 3VCLB 3DGGB 3MCLL 3RNKB 4P9MH 4TQPA 4O51B 5DHYA 1U8QA 5E5RB 5ALCH 3WE6A 3MFGB 5JA9A 5IROA 5GGVY 3QEGH 1MI5D 4AG4L 3SDAC 3ATEA 1WUNT 3FFCD 3L3DB 3BIBX 2UY6A 2DQMA 2X10A 3WEXA 4U05A 1HQ4B 4L29A 3MRLB 4Y1AB 2VO8A 2QT6A 5ITFB 4N2OA 3VI3F 1JPSL 1T0NA 2ZG3A 4ODHH 1BVNT 4IKKA 1IX2A 4RAUA 3BHBB 2OS7A 3GSXA 4AM0A 4QXWA 4UT6A 1CI3M 5IHZB 2W59A 3KEDA 4Y2OB 5IQ7L 4PW9A 2BW4A 5AX1A 3C6LB 3OJ2C 1U8HB 4PV8A 2GJ6D 2LQRA 1ZLVK 1UWGH 3FTGB 4YE0A 4QPEA 1ZT7A 2NY6B 1FNEA 3L9RB 4XVTH 1TCRA 2WWKT 3P40A 3V4LA 5C0CE 1BIIA 4K9EL 2IDCA 5BO1L 4G8FB 4OD3L 4YHKL 2VLJB 3H3KA 1RIUH 3FCTB 4NQSB 4YO0B 3SO5A 4HJ0D 1I9IH 2X1QA 3B1UA 3QJFB 5KVEH 1TLKA 2BMKA 1HNYA 2XLLA 4K5LA 1W9XA 4PRBB 3DMMB 3WBDA 3RDJA 3ULUH 3PL6B 4UYPA 1JZ6A 4PJBF 3VRJA 1KT2B 2A4CA 2WUCH 1XH0A 1JVOA 4PG9A 2EVFA 4NC1E 4CDGC 2EJ1A 3QQ4A 4UZUA 3QUYD 5I30H 3IDGA 1NCGA 2B0SH 2Y25A 3DBSA 3GD1C 4LHUD 3QBKA 1LNUB 3MMEB 4KVNH 1BX2A 2F6AA 4N6QA 2V7HB 4HJSA 4L0ZA 1AYRA 3OMAB 1ONQA 4UYQA 2TSAA 4TUKL 4ICWA 4RESB 1G1CA 4LCUB 1FDLL 2PCFB 1DQQB 1F1AA 1ZJBA 3QWRD 2O6CA 4MSWB 3TFBA 3B9EA 1X5JA 2J1ZA 1DBBH 4EVNA 4MMXB 1ILUA 5C0AD 2KUTA 4P5KA 3ULAB 2EACA 4AGOA 5TDPA 1XFPA 3PWJB 2VKXA 2X7LB 1CF8H 1MPAH 1BGXH 3MLXL 2WZPA 4AVKA 2L0DA 4Z7VA 3V4VL 5JLZB 4K5NA 3G9VA 1UXSB 4OKVA 4B9ZA 2HTKC 1G7HA 2VXVH 4NHCH 4MTMA 5DUBA 5ABAA 3RNQA 4ZMTA 4LFHG 1JHKL 3WJLA 4NQXA 3VACA 4ANXA 4LL4A 4JZJB 3CC5B 1FC1A 1PZ2A 1MQKH 2J71A 3Q5TA 1S46A 4PJHE 3WEOA 2PKDA 3NCJL 3T0WA 2X4QB 2F5AH 4PJDA 3C08L 3WFEL 3D05A 4PWEA 3F7LA 2G0KA 2NR6D 1U8NA 4UDUA 1LN6A 1EHKB 3ZHLA 2LLLA 1A4CA 1KCRH 1TO5A 3QPXH 2DH2A 1QOKA 3BSZL 5T1MA 1LWHA 2ZXEB 4QT5A 2I85A 4F5CA 4J8RB 2NR6C 2VDNL 1I7TB 4PG2A 2MWCA 4F7EA 2ZAIA 2VXQH 3PPSA 3STLB 3T65A 4JL2A 5JW5B 5KVGE 4QMEA 4AMJA 5DJ2A 1O6SB 3UTTE 3ZT5A 5DHVH 2XHNA 5C9JB 4DO6A 1T1ZA 2APVA 3ZQXA 5ICZB 3QISA 3WD5L 4JCMA 2UUDK 1RFDL 3JTBA 1KCVL 1JE6A 4Y4KB 3TH4T 1FZJB 2VSMB 5F21B 3P4LA 3NFSL 1PCXA 1X5IA 3HI5L 3P9MA 3TO2A 3UMTA 2QQQA 5IQ9A 1OAXH 2G60L 3KE0A 4LCIL 3NIGB 3LQMA 2OTUB 4WU5B 1GYCA 5AOIA 2VLKE 3N3EA 1EZVY 5E5MB 1D9KB 3ASOB 1FNLA 2MIZA 1R1CA 4PJXF 1IGCL 1OOWA 2BXYA 4A68A 1NCBH 4NC2B 4PWIA 1ZHLB 4U0RC 5AAPA 4OLXH 1KXQE 2GKIA 1Z0NA 2H0PA 3Q6GL 3Q8CA 4UIMA 2BNQB 1DJGA 3LZQA 2VR8A 3FB5A 5AAWA 2BSCA 4WO4B 8FABB 3MROA 2Y36L 2IH1A 2ADGB 4CJ1A 5B21A 2HH0L 4FQJH 4KHXH 1IVLA 1G1YA 4YHPA 4I9WD 1UKTA 2OSYA 3BGMA 4LSQH 4FYSA 1S3KH 3VFOA 1JNLH 1KY6A 1BZ8A 1HHKB 4U3XA 1E4HA 4KKPA 2FT8A 2BSRB 3L95A 4M43L 3OSKA 4G2AA 2VITA 1S5HA 3AFLA 1S7XB 4F7TB 1L4IA 1ZLWH 3MCYA 2GBVA 3RWCB 3ES6B 3MYZA 1NAMB 2PUQT 5CIPB 2X38A 1EO7A 2WP3T 4MB1A 1KN2L 4D8PB 2IBZX 1Q0XL 3EJCA 5D6CB 5FYLL 4IMKC 1NJ9A 4PJIB 3LZRA 2EQDA 4GAYA 3WJJC 3WY1A 4XX1G 1DVQA 1E9QB 2K4WA 3SDDB 1RZPA 1N4XL 3ZPRA 1ETA1 3E9UA 2I5YL 1A4JA 4Z3EA 1RJCA 1QHJA 3BP5A 1BMGA 1I85C 2DMHA 2ARWA 2EEBA 3DVGB 1LEGA 3GINA 4ZFFA 2EH7L 5F71A 1MCLA 2VLRA 1AD9B 3WLBB 2WQWA 1S53A 4X9BA 1CLYL 4GRLB 1CICD 1F3DH 4NGHH 1C7TA 2RFXA 1DUYB 2J4WH 2D0GA 2HJFA 4Z7UF 1PEWA 4XP9H 2GITB 1CJYA 1XL6A 3LKPB 2PP9A 3RA7L 1IAIH 1P0SE 1S9WB 3W0WD 1CICC 5D4IA 1ZK9A 4FULA 2VZOA 4HWBL 1MFCL 4Y2DB 2WXHA 5IB4A 5MENB 2E8YA 2XPYA 4PGJA 1S7UA 1XGQB 2Q76B 2FX8H 1AACA 4TV3A 5M94B 1NC2A 3ZSSA 5DS8A 3VXSD 2FIKB 3BE1L 1HOEA 2YMOA 3VDAA 3VU2A 4FMFA 3IMBA 4PJ7E 2Z64C 1W72L 1VEOA 5ISZA 4OY9A 3TBTA 3CD4A 1ORSA 3B5GA 4K15A 1MHEA 3DYPA 3FU0A 3FOMA 4GI9A 1X5YA 3JWNG 2J8UF 3JTSA 3OWRA 3UX9B 4XOEA 3MV8B 1I8AA 1F13A 3WKMH 2VQ1B 3LTVA 1FLTX 3GB7B 4XP1H 3QNZA 5E8PB 4ZODA 1ASPA 2BY0A 2WUBL 3JZYA 4HF5L 1FZOB 1ZK5A 2Z35B 2VSCA 3AAZA 3P02A 4FLOA 4R7XA 2A1WH 1CDUA 2VDOL 3GJFH 1DBJL 4PREB 3X3CA 4JFVA 3K4AA 1BHGA 2VISA 3B9DA 2UX6A 3HBQA 1WK0A 1M3IA 1NANI 1OALA 4Z7VE 2WYIA 2RIKA 4JN2A 1ADQH 1A1MA 1WIUA 1JFHA 1QASA 3FZUC 2CK0H 5T3ZD 1K2DB 5DQJB 4FQQA 4PVNA 1PZ5B 2CLVB 2GIXA 1HXMB 1NM4A 5A2AA 2XN9B 3ELQA 5ICYA 3X1FA 1MVUB 3C5ZB 4AZUA 3IDXH 4XAKD 3TBVA 1OTSC 1BEYL 1D5MA 4FQLH 1CTNA 4HIIA 5DYSA 4DZ8B 1DJZA 1IE4A 4P5RA 3T6VA 5BW7A 4TPRH 3UROR 2K7PA 5TFSL 2FSDA 1E42A 3L54A 1UWYA 3K6DA 3NJXA 4JO3L 5JMOC 1E4KA 4F5CE 3D3VD 1MRDL 2R23A 4FQXB 5SWQA 1P7KA 2MEJB 3ARBB 4HUUA 5D1ZA 4EI5B 1EXUA 3DV4A 3WFBH 3SGDI 3I3BA 1N19A 2ZOKB 1TKWB 2B5IC 1M71A 2WXIA 3DXAD 5GGVL 4HWZB 1QR1B 3ARZA 5B0WA 1GKEA 4XHJD 3TIEA 4AKQA 2GEQA 2PN5A 1E50A 1DQDL 3X11B 5DEZA 2B20A 4OGXH 5J9PA 5KSBF 4ORGB 4QRPA 1TN5A 4G7SB 2DL2A 2D73A 3DECA 2BSEA 4MJ5A 4CNIB 3UYPB 2R69H 3FOLB 3Q9QA 3ML8A 4I3RH 3ROOB 5E56A 5GSRA 2G30A 3L3OA 2ZPKH 4XO3A 1LMIA 1MFNA 2DQUL 5AW1B 3F7RA 4WKZA 1IB5A 1IC1A 4LSUL 1IT9H 3QCTL 4RMVA 4U6TA 4X7CC 3SDCB 2UYLB 3UG5A 1AFVL 1AP2B 4X6EA 1N18A 2WYHA 4U2YA 4K5OA 2WXFA 5GS0C 2VDKB 5T8IA 3RUGB 1Q94B 4DJHA 2Z1PA 2ZNXA 4MMYA 3T6QC 3S97C 4YSUA 4BFRA 2WNXA 3NCMA 2GBAA 1FIGH 1TQBB 4L8BA 2Q8AH 1XTLA 5BVPH 2Q8BL 2BOBB 1IBGH 5KYUA 2IPKA 5T1LD 1FFOB 4JRFA 4W1TA 4HWEH 1BQKA 3TJEL 4A4MA 4BGLA 3GXUB 4YDKH 5DZJA 2NZ1A 3MLRH 3WMPA 1GZMA 3SDYL 1JS4A 4X6FB 5JHLL 1JF6A 2W60B 2WLLB 3BW9B 3Q1SH 4M8QA 4XXCC 2HLFD 3ZZQA 1PZBA 2LLGA 4WI3A 1P6WA 4HYJA 3BKML 3SGJA 4H8HA 4D9RE 1IJ9A 3WTUA 1OHZA 1ITCA 1CT8A 5IT2L 2E4TA 3HR5B 1LK3L 1DQMH 3KPSE 4ACTA 2HLFC 1NMAL 2MH4A 1JOIA 2YRBA 1A0QH 2WTOA 5LWYH 2ZT9C 4W9KC 4J4QA 4AQAA 3FB6B 4GBXC 4ZNCD 1BZEA 4KY1L 1LDPH 4KXZI 1WIPA 2LABA 2BY1A 1J48A 2F18A 4L3FA 4B9PA 2Y7LA 5D70H 1CN4A 1UB6B 1DVFB 4IDJL 5E9DD 3TU6A 4Y4FA 2LLNA 2NNFA 1MXDA 1NKGA 3DNKA 4JN1H 2VM9A 3VMPA 2UWEA 5KVFL 3GMQB 4MA8H 2FJGB 4PGZA 4CKVX 4KGJA 4P2AA 2OR7A 1SDYA 2BNRA 5C0ND 5KJRL 1QW9A 4Z7WE 4EN3D 1I9RH 2X6AA 3RWIA 4KUCF 2VLRE 3O2VL 4XVTL 4EA3A 4NKDA 1MCOL 5B38G 1WC7A 5C0NC 2C4FU 3PHSA 1BFOA 1L3WA 2PXYB 5E2WH 5E6IB 5FKAA 4EN3C 5IQOA 1RIUL 2W94A 1BAFL 4GO9A 4XB8A 3T5WA 1ZHBB 3X14A 4F92B 5IMLA 1EV2E 3L5JA 3EJUA 3TA3B 1RHFA 3VYOA 3H3BC 2NY0B 4FFYL 2OMZA 2J3SA 4BE5A 1BOGA 5KVEL 4UAOB 3CODA 2BVEA 2GTWA 1D7CA 3AWEA 5IM7B 4HCRL 3MLVH 4APXA 3NK4A 5EO1B 1TEGA 3ET9F 3QK0A 3ILEA 2DD8L 2WQXA 3LRHA 2APWA 2GCYA 3C12A 3F6IA 5I8KL 5ISZE 4WW2F 3LS5H 3WKNA 3QCUH 4P2QD 4YDVA 4P2OD 1LE9A 1BZOA 4RX4D 4ANKA 3F58H 5KANI 1TDQA 3WIHA 4WTZA 3W82A 3X2QB 3QDMD 1TFPA 3U9UA 3UJIL 35C8H 1KCLA 1R9FA 1IM9B 4FFTA 3K3QA 2P80D 2YD3A 4MNQB 1XD1A 1BWWA 1U8JB 3QIUC 4Y16A 4PD4K 1EIBA 4GRMB 3ZKNC 2BERA 3PHQA 1G84A 1DBAH 3C5SB 1YEIH 1BLNB 2WC7A 3KYAA 4XMZA 3IJSB 1R47A 1E3XA 3QZNA 3RLSA 5GGRY 5E00A 3OZLA 1R5IB 1UH4A 2W88A 2BZDA 2GI7A 3IAPA 4TTDD 1MIML 5FFGA 3TO4D 2QR0B 2VZVA 1UOLA 5JW3H 2EUXA 1FAKT 1TYRA 1RJZA 4B60A 1NGPL 1QPPA 4PRIE 4ZSOE 1MRCL 1PDKA 2QSCL 2YPKB 5IUSA 3T4AC 4URKA 5A16A 5JHAA 1FLRH 3CSBA 3MBEB 1ZWIB 2D2OA 3MJGX 3U0PB 5D7JD 4FFVD 4JKPH 4YFLI 5ILTL 4W81A 1M56B 4F1ZA 3WV0A 2DWSA 2FX9L 4IU2A 2CKBA 4HGKC 1KFAL 2IANB 1UZ8A 4D7PA 5I1HL 3IGLA 1JZDC 1Z9SB 1AZVA 2CCWA 3GHBL 1TQTA 3K2UH 4FXKA 1ZLUH 1FWXA 4A55A 5F9WB 4NJAL 3RQ3A 2X4UA 4G5ZH 1F3JB 2K8MA 2L7UA 4AYDC 5DRWB 2Z91B 4UM9B 2VDMB 1NIEA 4HCFA 3HAEG 2HKAA 2J7LA 2NCEA 3CFDB 4QRPE 4ADIA 2ETWA 2AXHA 5IBLC 5DYOA 1HVXA 4NYLB 3VYPA 3LV3A 2OYPA 3DBXA 5TTRA 1LWJA 4I18C 3JTTB 3SDAA 1BIHA 1MCWW 1A1NB 1LVEA 3DX9B 3VO0A 2NY2B 3E6HB 2FX7L 4M6ML 4XNXL 1E90A 4EQ3A 5E2UL 4Z3IA 4QRQA 1A6VH 1HILA 2B1HH 3A67H 4F33A 4HS3A 3FFCA 2HRHA 3WHXA 3ZL4L 2WZ5A 2JIXB 3CLFL 5K9JL 5G5DA 2P7TB 2F93A 4P23D 3REVB 4JO5A 3U0WH 3TM6A 4P3CL 5C9KA 1R75A 4IGBD 3QQ3A 2XG5A 4J12A 2YXFA 5FO9B 4F58H 2PWGA 1FH5H 4P23C 1OL0A 3FT3A 2WQUA 3GJEA 3WTVA 1DFBH 4BWWA 4JR9L 4YHYB 4DJMA 5F9JA 3VFGL 2GJ6A 4HK0A 4LPYA 4PJ5B 4YHLL 3VFTB 5EIIG 4OCSL 1AMXA 3FPXA 1R3KB 1J9CT 2HPYA 1TU2B 3UAAA 1UCBL 3ARFB 1RUAH 2RR3A 3NCEB 2G4EA 3T4YA 1GCYA 3SYCA 5I0VA 4ONHB 1Z3RA 1I3RA 3KBHE 2AI0L 3Q8EA 3ZZSA 4HUNB 5H35B 4LPVA 4B9IA 4UQDA 3MNWB 1NCHA 3GPEA 1TNMA 2Y24A 2ZX6A 3WDHA 4S2SA 4X8XA 4M1GH 4YL4A 3QPKA 3TIDA 4IBWA 3A6CL 3CC1A 5DFAA 3LKRB 1BFVL 3BDBA 4BZ1H 1ID5I 1DLHB 4RMBA 3VXNB 2CRIA 3ABWA 1SYVB 3QUYA 4EQ2A 3GTNA 4JKMA 4ZJ9A 3M1OA 3BIKB 5ID1B 4LHUA 4JJHA 2VH5H 3ARGC 3L13A 4M3KB 1HEZA 4WGKA 2OK0L 3OHXB 1TJIH 4U6HB 3OAYH 1L9SA 5EWIL 4PGEB 5GS1C 4HEPG 3SCMD 1BM1A 2D7OA 3QWQB 1J1XH 3EW3B 4RISL 1N3NB 4NO2A 5DUJA 3QWRA 1AD0B 2DWEA 1CYGA 3GUTA 1B3JA 3FU7B 3GUFA 3L3JB 5C0AA 1QBLH 3REWB 3F85A 5IVXF 1IL1B 2FX8L 3OJDB 1U3HB 3EGDB 4MJ6A 5D93C 5F88B 4L8CA 4NHUB 4XN2A 1TSHA 3PXJA 4G8GB 1AC6A 1S6NA 3VXPB 3HE7B 5FO7A 2VLLA 3RWJB 2IV8A 1A9EA 4DEPC 1YDPA 4HP5A 2XACC 4TNWF 4CVXB 5D8JH 2JCCB 2BFGA 1OCWH 4LEXL 3NN8A 1KWGA 2J8OA 2J88H 1A21A 3SYPA 4EI0A 5JHMA 2JTYA 1BQLL 3FQ1A 1G5AA 2XTSA 1PFOA 5M7QA 1FL6B 2NR6A 3O0RH 3W11D 3H42H 2CCVA 2R0ZL 3KH4A 3DI2B 3EYVB 3T0DA 1C16A 3WNPA 1ODUA 4NN7C 3Q6FB 1URIA 1N12A 3W11C 1KACB 4FZ8H 3QNXA 1BV8A 2FD6H 4HS6B 4YE4H 4OM1H 2FLMA 4UQAA 3VXUE 4D0CA 4OUOA 1OGAE 3TWCL 4X9HA 5BNXD 5CO1A 3WNIA 1XL4A 5JIDA 2C3VA 1YPZF 2JTDA 5IJKA 1R3IL 5IHUH 4JM4H 3KYMA 5ICXA 3RDTB 4AQEA 5CSGA 4PY8I 1Q9OB 4XMWA 2W0LA 2NTFA 3NIDE 5C0DB 3V6ZA 5CJXC 3V0HA 4BM7A 3F04A 1IC5H 4Y5VB 5D9SA 5AZDA 4HULB 3BDXA 3BZFB 3D4ZA 3QUXD 1A6AB 5HYFA 4QXGH 2OKMA 4NAQA 1RK7A 3UG3A 4DFHA 4WU7A 2G75A 5H94A 3ARPA 2ITCA 2ZZUT 4DP8X 4PJFA 5K9OB 2PWFA 1SDDA 3QUXC 1MJ8H 1JVLA 1LO0L 1VIWA 3BOVA 3T0EB 3FO9A 4NZUL 4AGPA 5E94B 1JNHA 1L9TA 3GZQA 3JWDH 4G9FE 4RQQB 4KXDA 2HG5B 1HSBA 1J8HD 1A7OH 1ZVHA 2FRGP 4KJPD 3ABZA 4E42B 4L37A 5D72L 5L2KD 5MEOB 1S9KC 1LWRA 3HNTH 4U7MA 2N7AA 1SUHA 2DQEH 1AO7B 5I75C 2C9RA 4GINA 4HC1A 1CE6B 1OSPL 3UPCA 4EXPX 3CDYA 4XMTA 3DTXB 2H32A 4X4ZA 2QADC 3NJJA 4KJPC 3V9CA 1A1OA 2IO5A 3GMMB 1NFIA 5LB1A 4AL8L 5CR1A 4Z8FH 4K2UH 5GSVA 12E8H 1E3ZA 5GGTA 2XPZA 3CZFB 4MJIB 1AY1L 4APQD 3QGVA 3S4SG 1MXGA 3LQAH 3WKQA 4AK2A 2OXGA 2L7QA 1IO4C 1IVTA 2WQRA 4IMKA 1JZEA 4QJ5B 5KSUB 1WFTA 5FLVA 5E1HB 4APQC 3PF2A 5AVSB 3WJJA 4FDWA 1UWEH 3FQTB 4KK6D 1NSNL 3N42B 3NJKA 3VH8G 5BV7B 4OZHA 2MOQA 1SJEB 2E56A 3T2QA 1QLEH 3IETA 5D1QB 4DPCX 1I85A 3COOA 1FNHA 4BJLA 5H4ZA 1O75A 1ROCA 4IU3B 3WAKA 1I9JH 1VZGA 1JZ3A 4PRHD 5SX4H 3V0WH 3U6RB 2GY7B 3LXBA 2W0FA 2V3DA 2J44A 4QJ4B 1IRAY 5CZXC 3TBBA 3QAPA 3DJTA 2GJ6E 4OV6F 4V1DE 2VN5A 5EU3A 5EUOB 3SGEI 3UYRL 5J06A 1T5XA 3E38A 1VESA 1MFAL 1EAPB 1WH0A 1RZGA 1CICA 4XNYH 3ETSA 4Y19D 1A7QH 1RUPH 1G7LB 1SQ2N 3PWLA 5EFIA 4AK1A 1XQ4A 1QQDB 1SXBA 5H2BB 3VSUA 3RGBA 4FI6A 3W0WA 4GW4A 4PI0A 1F11B 5I1GL 1IEBB 3HAPA 4IRZA 1XGRB 4RDQF 2VR4A 5DMKA 2VL5B 2FYVA 1W16A 2J6EA 3VXSA 1G7JA 1ZGLB 1CFNB 1GTFA 1KGUA 2V5RA 3NAAH 3NSYA 4I13B 3ZTEA 4AMWA 3Q2NA 1J8KA 2Y2TA 2QKSA 1TZIA 1NAKL 4OZGA 2O61B 2A0LD 5ALBH 2EDNA 2YA2A 4M7JL 5HJDA 2VDRB 5G4NA 3HI6H 3FB7B 3CFTA 3PABB 1PIGA 4LLMB 4XNMB 4XVJH 3U46A 4YHNB 1KIPA 4XOCA 5E2WL 1OP5H 5C2BH 1AXSA 4GSDH 2R1YB 2FYYB 3KJ6L 4GS7C 4HUWA 3HCVA 2ZWZA 4MQ7B 3TH3T 3CXDL 4ZYKB 4HCGA 1U8KA 1VEPA 4FCAA 3EO0A 3HG2A 4HAKA 4N8VB 5A8EA 4JFQB 2ZIDA 2W9DH 1LO3L 5C0AE 4CKQA 3KLAA 2EKJA 4QAMB 1T21A 4ZOCA 5EU5B 4ZPTA 4XB7A 2PYFB 2R83A 4LOEA 5CCKH 4YPJA 2KLRA 4HBCH 1D7FA 4IIQB 4XPFL 5DEFB 2YDVA 1M42A 1F45A 4TSBL 3OKOA 1OAKL 1BM3L 3CFCH 3E1ZA 3PNWA 5I1DA 1EERB 2E7CA 5F7DA 1AP9A 3VJ6B 3NA9H 3JWOL 5BUGA 3L81A 3VW3L 2NLJA 3OLGA 1KCKA 2Y23A 3DHPA 3GLEA 1S51A 1LP9A 4BFEA 4HJUA 3IPEA 1GW6A 3EH5B 1TMQA 4G6JL 5HVWA 5IMOA 4HH9B 3OR7B 1YMHB 5F96L 4OCWH 2XWTA 3ELAT 4NM8H 3U4AA 4L1HA 2V2XB 2J25A 2OPCA 2PO6C 4M03A 5FS5A 1KJVB 1NBZA 4D94A 1JWSB 4A2HA 3OE0A 5CFAA 2YRPA 3D3VA 3MNVA 3QRGL 4RA3A 5KVGH 2DQDL 3ENEA 1FP5A 3UBXB 4MJ2A 2J1XA 5INCA 3ARXA 2I27N 1OARL 1RVFL 1Q9KA 1S8LA 1MWAA 3I6KA 4GXFA 5JOPD 3DKHA 1R3HB 2PPFA 3DXAA 4M5ZL 4M62L 1A25A 2ZKXA 5I6KA 4I8DA 1K85A 1CDHA 2ICEC 3DUSB 1X0I1 1VFBA 1EHLL 4HDIB 2OX5B 3OJVC 4S1SH 4PJGF 4YLBA 2JI1A 1XZ0A 3K0WA 5BZWB 5FW7A 4XCCH 2J4YA 1WD8A 3IM1A 3M46A 2IDUA 1HHGA 2Z0UA 4RSYA 3TVMD 2FJSA 4I0PD 1A6WL 1KWKA 2DLTA 1AXTL 3UEQA 2WB7A 3KNBB 2YD2A 1NL0H 4PJFE 3LEXA 4QNPF 3K5RA 3Q7JA 1DQTA 3GMNB 3V6FA 3TVMC 5IREA 4I0PC 1U21A 3H9SB 5L7XH 3PQRA 4XN4A 5CGBA 4CSTA 5JQ6L 4HHGA 2O5XL 3U83A 4ZTEA 2XZAH 4QHKI 2OQJB 3B2VH 2L4OA 3K6SA 5GXBB 1WRFA 4HUCA 3IU4L 5KYWA 3KPOB 4Y9BA 1MJUH 2E5EA 1QHOA 2NDGA 2J12B 2V17L 3RIAF 1OCCB 4Q9QH 1CFQB 1XF5A 5H2LA 2YCYA 1DN0B 3O3BB 4GXUN 2BIHA 4I9WE 4XCNA 5T1LA 3VFWB 4XXCA 4G7YH 5C09D 4TLKA 1JPGB 1R3LA 4C57C 1V7ML 2CMRH 2Z7YA 3VFMA 1MSPA 3SE6A 3VFUB 2XJLA 4MAUH 5DC9B 1MDAA 3LQZA 5FO2A 4DF9A 1CE1L 1SY6H 5DLML 5IG7A 1TJGL 3V4PA 1QSVA 3R7RA 2Y5TA 1R46A 3O6FC 4LEOA 1LK2B 2YUXA 1Q0EA 3GSRA 15C8H 4F9PC 2VLME 3NZ8B 3VFNB 3GKZA 1CXFA 1WBXA 1TZHB 1P7BA 5D1XD 3NG5A 4OZHE 3QPQD 3GFUA 3MRBB 2IWKA 2X40A 4UT6H 4LSPL 2QPDB 2AAAA 2O30A 3NFPA 1KG0B 3V6OC 3HNSL 4XP4H 2WQ8A 2ZTBA 1PXRA 1KBPA 5E9DA 3SYQA 3QPQC 5HHOB 2ZJSH 5BOPA 2VXTH 2ZX9A 2H7WA 1CLOL 4XPBL 2ADFL 2NRDA 4LAQH 2Y00A 4K5MA 1I8LC 1S5IL 4EN3A 2AV1A 3VVKA 5EEWA 1PKQB 3QZPA 1V55B 4EEEA 5TGBA 3DGDA 3IF1B 1A6TA 1T7ZA 4Z18A 4UQ3A 1RUAL 3CV5A 1T5WA 4WUKL 5HHNA 2PYEB 5ECGA 2HX9A 3LRGA 1QKOA 2UY7B 3C5XA 3QQDA 1KB5L 1F4XL 5FA4B 2R29L 3W0WE 5JA8B 2O5YH 4JDVB 4L5FH 2D3NA 1OT4A 3Q5OA 3B2DC 4DP2X 3IDJB 1R5VB 2VDPL 5DO8A 1PS3A 3HAOA 1SF3A 3VD4A 3D4GA 4XMLL 5SX5K 1D5XA 2JVUA 1M7XA 2OR9H 4KC3B 1KB9J 2N59A 4PRNB 5CBEA 3FU6A 4OIFA 2DKMA 4G9DA 3VXSE 2AXWA 4JRXD 2E47A 3KBFA 1WG3A 3KGRA 4OSUH 2O4EA 5CEXB 5B7EA 1BLIA 3LVEA 3UABA 4OJYA 5KN5A 3VXTA 4ZTPL 4OZGE 3BQUD 1WTLA 4TUOA 5FV2A 1IILE 5K33A 1E5ZA 4MCMA 4P2OA 4Z7QB 2IBZY 2F68X 4RX4A 1OQOA 3QNYB 2XIDA 2BO0A 2JLLA 1H6FA 3NESA 3RAJH 4HIXL 4MHHI 3V0FA 3DJZA 5C0GB 3BXNA 4ZFGL 3QDMA 2GK0A 3ARUA 3UTSD 2C9SA 2YD5A 3QUML 3MJ7B 4X0KA 2P80A 4FI8A 1HS6A 5DD0L 3QULB 4YGAB 4KV5E 4YSEA 3A5VA 3FQRB 4EDWH 3QUZD 2VT4A 2FHFA 4LKXA 3B1TA 4ES9A 4GAGH 4LQ1A 5DQDL 2ZCKL 3VM7A 1IGTA 3VVVA 3LIUA 1THCA 1UUNA 3PGFL 4C55A 5AOMA 5I1KH 1FI8C 2W9EH 1FBIH 1X6NA 4JZNB 5HGBB 4PRPB 1FVCA 1G7IA 3AQZA 2ZAGA 3GHEH 4E36A 2M1KA 2WB1A 1T2QL 1JV5B 3QUZC 4OCXL 3QW9A 4JGJA 5D2LA 5T3ZE 3ATAA 2ADJA 4XNBA 2QQNL 1WZAA 3B8SA 3N40F 3NJNA 4ZMQA 2GTZA 3I9GL 3QWOB 3D12B 3P0GB 1LP9E 5HJ3A 3FBQA 2SODB 3CQQA 5H2MA 2ICES 2CDFB 2TAAA 1G87A 5DD3L 1KG8A 3VD7A 4C4BA 3O4OC 5C7XL 2B39A 3SY6A 1ZMYA 2RBLA 1ZT4B 2GSIB 3D51A 1MFMA 5DGQA 5A1AA 1YY9C 1AG0A 3TONA 1BQ5A 3LZOA 1GZHC 3H42L 3MLUL 3R1GH 5AVTB 7FABL 4E2OA 2V7NA 5DSCB 3UZCA 1NCUA 3ECBB 3QORD 4AEIL 3HASA 1VADB 3D3VE 2JQAA 1ZOXA 4NQEE 1UZ6E 2H1LM 1FSKB 2VN3A 4OM1L 1FL3A 4OM0H 3MUJA 3UJJL 3DXAE 3FCUB 2F1AA 2D9CA 5JOFB 4S0HA 5E2JA 4NN6C 5DJ8B 4M1DH 3FAXA 1XCTB 3I50L 2K6ZA 2BRRL 4Z76A 4JRYB 1TTRA 1FBBA 2DQCL 2E6QA 2L8AA 1U91A 3QA3A 2E9GA 2MNWA 4MCNA 4HIQA 3P9LB 4K94H 5C0IB 5I8OL 3AG1B 2H2PD 3VD5A 2VN7A 1AZRA 2DMBA 1OCZB 3LEYH 3J07A 2BC4B 4JPKH 3NJMA 3N42F 3RFZA 5CHNB 1EEZB 2ATPA 4L4TB 5HGHA 1XR8A 1FE8H 3SO3B 2H2PC 4E9RA 5DGRA 4XNZC 4HJTA 5DMIL 5F0LB 3H9ZA 5MERA 3UAFA 1SBSL 3FUFA 3KMDA 2BK8A 3QXUA 1QKPA 2ZYRA 3L3IA 4HKJB 1WVZA 4P59L 5DF0A 5DHVB 2X3AA 1YEHH 1UACL 3FT4B 4P23A 3QR1A 1KV3A 3ZW3A 4YSQA 3C2SA 1FYHB 4NQDD 3ARDD 4N20A 1AS7A 3ZTNH 4EOWL 1USQA 3WHE1 1T1YA 1QD0A 1EGJA 4ODSH 4U1LB 2OSXA 2QDWA 4KMTL 4ELMB 1CPUA 1DQJA 4EUPA 1C5BH 1MCJA 1NBVL 1WBYB 2EILB 2WXNA 3ULVC 3MRJB 1KGCD 5DS1A 3RTLA 2EXTA 2OMTB 2X53A 5C7ZA 3LZFH 4OJFL 12E8L 4BHUA 3GSNL 1JV2B 3QC5X 4GKZA 2BCMA 1JZ5A 4MD5B 4PIRF 1LO5A 3IRPX 5SWZD 1FA4A 3IDYC 4L3EE 4DK5A 3AITA 1OAJA 2WHVA 1U2HA 1MCPL 2BVPA 3QO1B 1W6LA 3CDGB 1H8NA 2QKIC 4XXWC 2W38A 3BWSA 2DY2A 2C3WA 4OZFG 2KI6A 2EC8A 1GGCL 1I1RA 3BT2H 1C8RA 1J1PL 5ETUB 2H4EA 1JI1A 3RPIA 3D85B 1QLEL 4EI6B 1I3UA 1BQHG 2OFQA 3EOAA 4M6OH 4WW1B 5C07D 3SOBL 1QAWA 3HHSB 4AVHA 1MH5B 3GK8H 1IV8A 2E59A 4FHKA 3QFGA 3QHZH 2PF6A 4Z6AT 5HVHC 5GS2H 3BMWA 2R1WA 2AV7A 2X2IA 4Q4IA 4NZDA 3VFGH 2WZ6A 4LDLA 5GS1A 2IXQB 1INEH 2KQMA 4DPBX 2FWOB 4JK0D 1X3DA 4MZIA 4XNYL 4PJ7F 4F1SA 3MJWA 4WTWA 3BCDA 3SCMA 1NGXB 4JO1L 4OFKA 4ZMYA 4WZ9A 3CK0H 4MQSB 2DMKA 2XTJB 4OV5A 4GRWF 1R5WB 3BEVA 4OB5H 4YAQB 5L8LB 3UTZB 3IS0X 4L4JA 4WJ5A 5TE6H 4GUOA 5F1IB 3TEWA 3IDNB 4KZCA 1CZ8H 2A74C 4ONFL 4WHTB 3GXFA 1ET5A 4U6XA 5E24E 4DTGH 2DICA 4XVSH 2CDEA 1NCDH 4TLSA 3UBHA 1A65A 4AV4A 1PG7W 1JRHH 3KLQA 5IW6A 2O5ZH 2XVLA 3TNMB 5AG8A 1WIOA 5LDUA 3FO0H 2NY5H 2CJSA 3VRIB 3TJPA 2AVFA 3NSBA 1YAZA 4L2YA 1INDL 2W65A 3IJ9A 1HCYA 1XR9A 4EZKA 5I18L 5FYLD 1NFDA 4M5YH 2ESVD 5DO2D 5A2KH 4FP8H 4HSQA 2FTAA 4MCYB 5EZJA 3VMOA 5L8KB 1EA9C 3AREB 3DJSA 3K8KA 3SN6R 5CZRA 1WFMA 4ZMVA 2XXCB 2FGWL 1AXIB 5DO2C 1P4UA 3ZDYB 2XWBB 1QRND 1W6WA 3H53A 5D4QA 4HBCL 1F1DA 1KBWA 1VFMA 4QRUB 4GKNB 5D2LE 2XBDA 1ML0A 3GS4A 4XO4A 4AIEA 3NOIA 3OXSB 2RCSL 3JVFC 3AGVA 4WTXA 3UBGA 4AJYV 3QS2A 3GIVB 2DMCA 4HMCA 1AIFA 1QEWB 2AJYL 4NPKA 2LT9A 3V0GA 2Y7SA 4KROC 4GYCA 2WNGA 3QUXA 3EUUA 1E4JA 1AGFB 3FTXA 1QTPA 2V2TA 5ENWB 1VPOL 3GJFB 4FXGC 5D6DC 4Z0BH 4N22A 5AVZB 3ZX1A 5LGHH 2D03H 3U7AA 5JQIB 2X9WA 4BYHA 3ZHNA 2QV2A 5EN2B 2KH2B 2BP3A 2W0PA 5FCSH 4QRRD 4U1GB 4LLDB 1DL7H 5KVGL 2X5PA 3DROA 1KELH 4KNSA 1J8HA 4B96A 1NBCA 2R2EA 4RMSA 2B9BA 2D7TL 4Y1SA 1T7VA 1GGBL 4RRPG 5B3NA 4HT1L 4RGMB 3RPBA 2JSFA 3ZL1A 2NW3B 4MYWB 4UI2A 4P5TB 4Q97A 4LDEA 1QFWM 4MRCA 2F74A 5A7BA 1RU9H 4FFZL 2BH0A 3X12A 3UGXA 3N91A 2Y3AA 1FAIH 2VC2L 1ES0B 4P5SA 4APQA 4N25A 3UAJD 2NUPA 2F1BA 3D25B 2AJUH 4I1RA 2DJSA 1PD6A 2EYTB 4L3CB 4YDLC 3CDZA 5DC2A 1D5IH 3NCFB 1L3NA 4UINL 4ZMPA 2XVKA 4U1MB 1FQ9C 4K7PH 3GMOA 4MLSA 3S7GA 3UAJC 4XAWL 4LLWB 3MR9B 2HVKA 4QOKB 5IK3A 1C12B 1ASOA 4E41D 3AU1A 5GRYA 4F80A 1UWFA 2EO9A 4QIRA 1W0YT 3F64A 1T80A 1DANT 1RMFL 3U4EB 4D7BA 4N87A 4XWGL 1YMME 5E2VL 3V5DB 2XPGA 4GG6A 4PRHA 3CNKA 2KZBA 1BZ9A 4F27A 1XH3B 1RUKH 4NN5B 1KIRB 5IKCB 4NWTH 5KOVC 4XXJA 4C83B 4XTRD 4UOQA 4QTFA 5CGMA 4CC4A 3HG4A 3QJSB 1E67A 3MLZL 5IJVB 3EH2A 4JFXA 4FLQA 4NQVA 4Y19A 4GUPB 1KV7A 4PLOB 3CVHA 4XTRC 4Z7NB 1Y6NR 4JKVA 5KANG