3QJQB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjqB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjqB02
1ILUA 3FSWA 1AOZA 1MGYA 5PCYA 3HAPA 3QJRB 4JR8A 3X1FA 1E30A 2PLTA 5I5MA 1W6WA 5H2JA 1HFUA 3VG9A 3UTYA 1JXGA 2EIKB 5ANHA 1IBZA 2JXMA 3CODA 3WNIA 1BYOA 1A65A 1KGYE 4WTQA 5LDUA 4GRVA 4HHGA 4TXVB 3MX0B 1PNCA 1JVLA 1S54A 3T45A 1X9UA 2IDTA 4A2HA 1X0I1 1IUZA 4DP6X 2HX9A 2CJ3A 1YLBB 4JKNA 2X72A 4NERA 1WAEA 5D4HA 4GYBA 3AZUA 2BP8B 4DPBX 1KBWA 3FQ1A 4E9VA 1VGOA 3UGEA 4MFHA 4YSAA 2XXFA 3V2WA 1CYXA 1JZJA 2JAGA 3NY8A 2YAEA 4KO6A 3PQRA 1M0MA 1A8ZA 4G7SB 3PXLA 1U19A 4BEYA 1BRRA 2DWSA 4TL3A 1NTDA 3UZAA 1C8RA 3QQXA 1S8JA 4GP5B 3S3BB 1PLBA 3VHZA 4OV0A 5A7EA 3X3CA 1R84A 4NC3A 2FJSA 2WJKA 2IDUA 5B1JA 2AZAA 2R4RA 4LDLA 2QT6A 1M57B 1F56A 2EIMB 2I7OA 3OMAB 2VSMB 4KNUA 4AMJA 3NSFA 3ZDWA 1AIZA 2HLEB 1QLEB 1MDAA 2MTAA 4L6RA 4PXFA 2OJ1A 1PMYA 2AFNA 3SBRA 5B34A 2AT9A 1C3WA 1NINA 1JZIA 1OCZB 4DP1X 1ASQA 1NPNA 2XV0A 3ZEVA 3PWHA 3CZUB 1GS6X 1OCRB 3CVBA 3OAXA 1R2NA 1TN0A 1IBYA 4A68A 4MD1A 1KDIA 2BHFA 2LLNA 4X1HA 2PP9A 2FQEA 1PXRA 2YCWA 3S3CB 4P5SA 1ZDQA 2KSBA 1AR1B 4XXJA 3ABGA 5G28A 3FYEB 4XT3A 3SQRA 2R4SA 4QLWA 4F2FA 4G7RB 3NJNA 6PAZA 1QKPA 2FT6A 1PZCA 3KW7A 4YL4A 2VM3A 2J56A 4K9JA 1C8SA 5H2NA 1CWQA 3RYMA 4AKQA 4DJHA 3UG9A 1NDTA 3GDCA 1BQRA 1TEFA 3CAPA 2WSDA 3FSZA 4DP7X 5I28A 1KG8A 1GUEA 2Y02A 1NPJA 4L35A 1JOIA 2VW4A 1CURA 3HAOA 5AX1A 3NJKA 3HANA 2ZONA 1GYCA 1OV8A 4YSQA 2AVFA 1AZCA 1P8IA 4IB4A 3X1EA 4CSZA 5BR5A 1SHWA 4AKPA 1JV7A 5B6YA 2BZCA 2TSBA 4YVUA 4HALA 5B6XA 2QPEB 5PAZA 5AHZA 2BZ7A 3V9CA 3WKPA 3NSBA 3ABWA 2GC4C 2ZZLA 2NTUA 2PEDA 1BYPA 3ABKB 1KCWA 1XJIA 2UX7A 1AS8A 3H4HA 3NSDA 1BRDA 2YAMA 1PLAA 2YDOA 1QKOA 5JJJA 4GP8B 4YVNA 3KJ6A 2BW4A 2IWEA 2IWFA 3FS9A 2VMJA 1NZRA 4WKXA 3QAPA 1FFTB 1RZPA 4JQ6A 4XTNA 3VGAA 3REYA 1CC3A 1PNDA 3L45A 4DPAX 4KNSA 4BWUA 4KO7A 2HPYA 5ITEA 2YAQA 4P5RA 3HASA 3T6XA 3G5WA 2YQBA 2G87A 1L9OA 4Q89A 5B7MA 1JZHA 3NYKA 2VN3A 1FA4A 4N4YB 2H47C 4HWLA 3UTVA 4DP0X 1JV6A 3S8FB 3AM6A 1GZMA 3FPXA 4KO5A 1SDDB 3D4SA 4AKOA 1TU2A 3FT0A 3N2JA 4ENZA 1P8HA 3S8GB 5B6ZA 1UATA 2YXVA 1QHJA 4NAJA 5DHGA 1JVOA 3OE0A 4BWWA 2I35A 4HHWA 2B3IA 2FNWA 3S3DB 1EHKB 1GS7A 1PCSA 3BQVA 5BR2A 2Y04A 1AT9A 2CCWA 2BO0A 5G54A 3EHBB 2FWLB 4WAVA 2NTWA 3ZIYA 1S51A 3X3BA 1SF5A 4YSDA 2R7EB 3UAEA 5DYSA 1MZYA 1PZBA 3ERXA 1AAJA 2UXFA 1AZUA 2HRHA 2LNLA 2XX1A 3NJFA 3ZPRA 5B7EA 1BXVA 1XB3A 2JFCA 4E9RA 1DZEA 2M3GA 2Y01A 3DDLA 3QDCA 1ASPA 1M56B 1URIA 3NSCA 4EIYA 3UAAA 2F95A 4UG2A 1JZFA 3FU9A 2WO3B 1JXFA 4QKTA 1GY2A 5I6MA 4X32A 3WG7B 1ETJA 2FQGA 2IH8A 1V55B 4QIDA 4IARA 2Q9OA 3OE9A 1S8LA 2I85A 2RH1A 1SFDA 1T5KA 5F7BA 7PCYA 1BQ5A 2GB2A 2XV3A 3C75A 4HCFA 1QHQA 3X1GA 5A8EA 4X4KA 8PAZA 3NP3A 3FSAA 4XTOA 1B3IA 1F4ZA 3V9EA 3CDZB 4FBZA 3AW5A 3IBOA 2EIJB 4E9XA 5D4IA 1X9RA 3TBBA 1JZGA 2YXWA 3AG2B 3UABA 1MZZA 4E9YA 2QDVA 1XMEB 4IAQA 4L0PB 5JJEA 2GBAA 4EJ4A 3NJJA 2IH9A 3A7KA 1L9HA 5I5JA 2PPFA 2EILB 1VJMA 3QBLA 2Q5BA 5B1BB 3NY9A 2L6XA 2PPAA 5G2DA 3FU7B 5AKRA 1AG6A 2AZUA 3JTBA 4E9QA 5B6VA 1AACA 2B08A 3OMIB 4A4MA 2JKWA 1GU8A 2PCFA 3ABLB 5DHHA 3DKHA 4UAHA 1QM8A 1KMEA 1H68A 3FQYA 4BEZA 3NSYA 3VW7A 4KNFA 3NP4A 3FSVA 3P0GA 5H2PA 1KG9A 4A66A 1CUOA 2MRYA 2FT7A 4YSSA 1N68A 4A2DA 2HX8A 2EI4A 1S52A 5B1JC 1E12A 1WA0X 3OE8A 2P80A 2Z73A 1BXAA 1KV7A 2DV6A 2J55A 2YCZA 2PPEA 2UXGA 2Y1AA 1A4CA 3QJTB 3QJSB 1PLCA 3QBKA 5B35A 2H3XC 2ZXWB 4DP8X 1AS7A 1GR7A 1GS8A 1NICA 1PY0A 2AANA 3CVCA 3MBWB 1SFHA 5G2AA 4Y9HA 1OF0A 4HZ1A 4PCYA 1I53A 4UANA 1LN6A 2ZIYA 1IKOP 1JZEA 1NIEA 1OE2A 1SDDA 4NB7A 4YSPA 4DP2X 4YSEA 3QAKA 5B3SB 5A45A 1L9PA 1JGJA 2XLLA 3EMLA 3RZEA 4JKVA 1NIFA 1VLXA 3ODUA 1JFPA 1WA1X 1XB8A 3MBVA 5ETZA 1QNIA 4XTLA 4LDOA 5C1MA 1M9WA 1W8EA 2ZFEA 2E86A 4J4QA 4N8UA 4ZK8A 2DY2A 2ZOOA 2Y00A 1NWOA 3ZBMA 1XIOA 4A2FA 2N0MA 3KW8A 3OMNB 3FPYA 1M0LA 4KOBA 4YSRA 1TN5A 4UF7C 1OE3A 1W6LA 1P8UA 5H2KA 3PBLA 5H2OA 3V2YA 1PXSA 1M0KA 5AHYA 2VSKB 5KKHA 4F7KA 3COCA 1AQ8A 1GY1A 1ZIAA 2BWIA 2FQFA 3TBCA 5FJGA 1AZRA 3N55A 1J5DA 3PCYA 1FWXA 1X0SA 5JJNA 1IW9A 4WW3A 3H4FA 1J5CA 5B0WA 2CALA 1L9QA 1NWPA 5A44A 2YAOA 3AG3B 2R7EA 3DQBA 3VVKA 3D12B 4GXFA 4E9TA 3FYIB 4A2GA 2YCXA 4AMIA 3NJMA 3QBIA 2FT8A 5B7FA 5FC9A 3UTWA 5B1AB 2QPDB 5TGZA 2HZHA 1SHXA 2GHZA 2H5UA 3BVDB 6PCYA 1SJMA 5G36A 1SNRA 1N70A 3AYMA 2GSMB 4HIPA 3OM3B 2HX7A 3EF4A 3QPKA 3T9WA 4G7QB 4BWTA 4YSUA 4GBRA 4BK5C 4EF3A 2DYRB 2XUWA 3TA4D 1V54B 1ASOA 2YDVA 1FBBA 2I21A 3FQ2A 3PPSA 1BQKA 4BDVB 1UCQA 3ASOB 3CDZA 1IW6A 5H2IA 1ZPUA 2IAAC 4GY4A 2NRDA 2HRGA 1ADWA 2UX6A 4MQSA 4FA7B 1OCOB 1ZV2A 2BW5A 2XYBA 5AZUA 1E5ZA 4BDVA 5I26A 5B6WA 1PY6A 3WIAA 1E67A 3TASA 2YARA 4X31A 2YCYA 4HYJA 5G2CA 2KS9A 5I6NA 1MG2C 1XB6A 4F2EA 2IDFA 3AG1B 2DWTA 3HB3B 5H2MA 3UTXA 1L9SA 1PF3A 2FTAA 1A4BA 1NIDA 2QDWA 2EINB 2I1XA 1ZDSA 1AZNA 1ET8A 1BXUA 1GW0A 4BVNA 2WJLA 1HAWA 4QI1A 4BWBA 2J57A 4A2EA 4BXSV 3ABMB 2CUAA 3NS0A 4Q8BA 3WKQA 5I6OA 1BM1A 3UONA 1R1CA 4YSOA 3QJUB 2JAFA 5F7AA 3HEIB 4GP4B 1AANA 5AFAA 1AP9A 4PXKA 1J9TA 2ZWNA 1Q5JA 4BV0A 2XV2A 4PAZA 1AZBA 4KO9A 3T6WA 5IY5B 4MQTA 1ILSA 3NT0A 1RKRA 3PLYA 2KSYA 4BXVA 2X88A 3OQRA 1OCCB 5I6LA 1S53A 4W9ZA 3UACA 4YSTA 5AX0A 1GSKA 5D4JA 4GPOA 3X1BA 1FBKA 2I20A 1H2SA 2XVBA 3PDSA 4N6HA 2BP8A 2VM4A 2BP0B 1OOWA 2W88A 3AG4B 2IDQA 1HZXA 5LWEA 4JHVA 4HCGA 2BWDA 1E0PA 2BP0A 4BUOA 3NYAA 3QJQB 5AZDA 1MG3C 3OD3A 4RH4A 4UHRA 1BRXA 1RCYA 2PP8A 2PP7A 3IN2A 3NJHA 1UAZA 5I6KA 1KBVA 3NJGA 1JXDA 2GIMA 3EH3B 3ZX1A 1A4AA 2A3TA 3DIVA 4HCIA 4MD2A 3EH4B 1AG0A 1F50A 3PAUA 1IC0A 5AWZA 2XWZA 5TK2A 4DP9X 1HAUA 3IN0A 3C9LA 4M3HA 1KYAA 3EH5B 1ZIBA 4YSCA 1AS6A 1NIBA 1Q5IA 1DZ0A 2PPDA 3GXUB 3T6VA 5B2NA 2P80D 4XT1A 4QRYA 4GYCA 2F93A 1CYWA 4A67A 5J7AA 5E9NA 3ZPQA 2GC7C 1X0K1 3SBPA 2Z55A 2BRDA 2X87A 1L9TA 1L9RA 3WQJA 1NIAA 2J4YA 1WA2X 1E65A 3NJIA 4DPCX 3T6ZA 4DP5X 3HAQA 4AZUA 4FAAB 1RZQA 1L0MA 1J9SA 5F8UA 2VW6A 2Y69B 3DTUB 3IEAA 3T71A 1J9RA 3FU7A 2VT4A 5EN0A 3AYNA 2XX0A 1ID2A 4JHUA 3CVDA 2UXVA 5TK4A 4LDEA 2J5WA 1BEXA 3FU8A 1KCBA 3RFMA 2PCYA 3NJLA 1BAWA 4HYXA 4E9SA 2CAKA 2Y03A 3SBQA 2YAFA 3QBGA 3PXOA 3QJVB 4G72B 1ET5A 1WS8A 2W8CA 3AY2A 4DP4X 3GYRA 4EA3A 5B1KA 1TKWA 2IDSA 2GI0A 2HXAA 2XU9A 3IE9A 2TSAA 3X2QB 2CBPA 2FQDA 3JT2A 3UADA 4E9WA 1F88A 4M4RB 1E5YA 5I6PA 4DAJA 1JERA 2DYSB 7PAZA 3C9MA 1O0AA 1EZLA 2YAHA 4CSPA 3PAZA 4G70B 5EHFA 3WI9A 2PPCA 3ASNB 4HAKA 3TU6A 1A3ZA 3CG8A 2OV0A 9PCYA 1SF3A 2OCCB 3WNJA 3PAVA 1DYZA 3U25A 1ET7A 4DKLA 5H2HA 1V10A 4KNTA 4FPDA 5I5IA 4G71B 2XXGA 2KSAA 5ITCA 1IXFA 4W1TA 3OE6A 3UZCA 2WO2B 1TEGA 2VW7A 2YAPA 4KLYA 5G53A 1KDJA 3SN6R 1PZAA 3HARA 4K5YA 3VI0A 1PAZA 2RACA 4AI7A 3H56A 4KOCA 3X1NA 1KGBA 1WS7A 2UXTA 5H2LA 4N4WA 4AX3A 1OE1A 2IWKA 1J9QA 4MBSA 2I7SA
chains in the Genus database with same CATH superfamily
5ADPL 4JJHA 2WQRA 1MGYA 5I5MA 2DQHL 4GG6B 1E30A 5JORB 5TQ0H 1UM4H 1QYGH 2KMWA 1CLOL 2VCOA 1CMOA 1HE7A 4O4YL 2Z0UA 3NZ8B 4HHGA 1WCBA 4KVCL 4PI2A 3T2NL 1N64L 3B2UD 5IV2B 2G60H 4DGVH 5EEXA 3G6JE 2QQLL 3PWPD 2VABA 4FG0A 3OR7B 1KGCE 4GIAA 2CKBA 2P8MB 1H8SA 3BAIA 4YHKL 5FYJD 3U0WL 1BLIA 1O7SA 5JMOC 3QHFH 4HETA 4IDJL 3LS4L 2JKTM 3KLQA 3U7YL 3QQXA 4XR8C 43C9A 4OV0A 3X3CA 4ZFZB 1DSWA 3Q43A 4HPOL 3EGDA 3TIEB 3KBEA 5M94B 4M62H 5IGXL 3MRBB 2YKKA 2EDMA 3HNSL 4IKNA 5JA9A 4ZUUB 1INQA 5DSCB 3B5GA 3R4DA 2C3WA 4WAFA 1NPNA 2R1WA 4YAQB 4P4KC 2JQZA 3HE7D 1AVAA 2F7RA 2HSIA 4OAWA 3BVVA 4NKQB 1XSOA 4J3OD 4CSSA 4GSUA 4RMUA 1NGQL 4UDUA 2BSED 3BFOA 1WFIA 1KB9J 4G9FE 1S7TA 2KDGA 1A6WH 2NW2B 4NI6A 1SJVA 2WB7A 1BVKB 1JPFB 4YL4A 5D1QA 1GGBL 2VMDA 1LP9A 2WWKT 1HILB 2ZP9A 3QNXA 4PJXE 3WMQA 2DICA 3OMZA 5CF3A 4FQHB 4X7TA 5CILH 1YPZA 4A7GA 3VXUB 1MLCA 2AJYH 3H2PA 2CMRH 2E6PA 3BUPA 2H3NB 1NPJA 2B59B 2YGQA 1N3NA 1SLWA 4OF0A 1XL6A 1OTUD 5CEZL 5GISH 1SUHA 4GW4B 2EICA 1HHGB 4NX0A 2Q0ZX 5AVXB 3ZYOA 2Q10A 2YWZA 2GITB 2VSDA 1MH5A 1BMZA 2AITA 5LO7A 2IIJA 4FQPA 4JPIB 3C08L 3VSVA 1F6FB 2YAMA 4KK5D 5L6YH 1K8IB 4B9JA 1W15A 1JN6A 3L9BA 1OPGH 4MAYC 4N2LA 3SQBB 1NEUA 3MV11 4H13C 1J8HE 4GIOA 3MODL 4H40A 3ZO9A 1DJXA 4WVRA 4D0CA 4LHUA 4KNSA 4HFUL 3MQIA 3QDJE 3WJLA 5I71B 2A38A 1FFOA 2NY5L 4RMRA 4TLTA 1I8KB 5F8RC 3T6XA 3G5WA 3W2DL 2R1XB 2DQHH 5LB1A 4KUZH 1B3JA 2NDFA 1NOFA 3S97C 1QYGL 1Q9KA 1KYDA 2ERJB 4HLZG 4AH2B 1OP3H 1V05A 4APQD 5F2FA 5IG7A 1G94A 5T8IA 3O2DH 1GGUA 3SE4A 2IH3A 3N44B 1U8JB 2RBLA 3C2AL 4L1SA 2QQLH 4MYWB 1A6UH 1FFPB 3ARGA 3O3EB 1FIGL 5DZOA 2XXCB 5G54A 2EJ1A 4QRRA 3W38A 1W0WB 3RFZC 2Z31A 5D7IA 3H9HB 4J4PD 2DQDL 4L37B 4TV3A 4XN7A 4KKLD 3NG5A 4NQSB 4Y4FB 5IT2L 2V5RA 5E03A 3GXMA 1ZLWH 4MJ5B 4YGAB 2C9XA 3IT8D 2JFCA 5FDYA 3O2WL 2D9CA 4HPOH 2QMKA 1T80A 5LN8A 3GK8H 3AREB 1KTBA 4X32A 1YMMB 1JNNH 2YS4A 3BH8B 5AOMA 3U9UA 4F3FB 2P8PA 1A21A 3DJZA 1CD9B 2J1XA 2V17L 4PJ9B 4X4KA 2R8SL 3GFUA 2ATPA 4Z7OE 1MRDH 4FXLA 5KBNC 4FBZA 5AOZA 1KCSL 5EU6D 1Q9LB 4Y0GA 5I15H 2ZAHA 5AYTA 1XSJA 3EOBB 3MCLH 3JTSB 4OCSL 5DK3A 4PJFB 1TDQA 1YRKA 1QTSA 5B39A 1ZHKB 4NSKA 3BQUB 1SDYA 1JS4A 1BAFL 4ISVB 1XAKA 5HDBB 1HXYB 1N59A 1PVHA 3OAZK 1IB5A 3BSZA 2C3VB 5DJ0B 1YO4A 2R1YA 4LSSL 3DKHA 3HRPA 3O4OB 2W5PA 5FUCE 3UZQB 5D7SH 1EEUA 3FQYA 3NP4A 4K23L 1KG9A 2X09A 3X12A 2C9PA 2W0KA 3TX4A 2I60L 4IU3B 3PL6A 4K3GA 4NJ9L 4L5FL 4QJ3B 5GRUH 3HUJF 4HSAC 2ORBL 1A7PL 3EO1B 1NDMB 5SWSE 1PQZA 4TVUA 2YA1A 2BVOA 3DI3B 1ZSDB 4AQ8C 1Q9WA 2X2JA 4XODA 4ZTOL 5D5ME 4FCHA 1Y6KR 5T3ZL 5D8JH 3GRWH 3EJSA 1SFHA 4YH6A 4K3EH 4KGLA 5AUMB 3MUGB 4AGNA 2QVFB 1YEKH 2J88H 1NIEA 3ULAB 5I5RA 4IKKA 2NY3C 2A7BA 2F53D 2V37A 1IQDB 3D5OF 1CFTA 4LOEA 2ZWZA 4UT6A 4X6FA 5A6MA 3ETTA 3O0RL 2XFXA 2H26A 1VLXA 3U2SA 4QAWA 5CFAA 5JQ6L 1A9EA 4CVUA 4UT7L 1DQKA 3MRRB 3K72B 5KS9E 3UTTE 2BSRB 1TQUA 2ZOOA 1E2ZA 2DJ4A 5FAAA 4JFDB 5JZ7D 4K71B 2AXJA 4HSQA 1M53A 2RALA 4LL9A 2OX5A 1N8ZB 1O9VA 2VSKB 1OSYA 3LQZA 3HI1A 2XZCH 2GTZA 1MLBA 3FCTA 5D7JC 2AXHA 4F92B 3MNWA 1QABA 3LNGA 1F5WA 3PCYA 4PG2A 4QO1B 5DJZB 1HEJC 4G1MB 3INOA 1B0WA 4HKJB 3RNKA 1IGMH 3MRHA 1XZ0B 2P24B 3ZDYB 2PWFA 3ZKSD 5EEZA 4HEPG 3GSUA 3LKQB 2C5DC 1S3RA 1S9VA 1T0OA 2ITEA 1NCOA 3EOYG 1TFHA 3JT0A 1KXTB 1SHXA 4TNWK 3WTTA 3CD4A 2F8OA 1CD1A 4G7QB 4BFJA 2FX8L 2Q7YA 3VSTA 4NIYE 3GINA 5CLZA 2PN5A 4JHWL 4J8RB 4NAQA 5J3HD 4B7IA 1C12A 3OLIA 2R83A 4Y2DD 1FBBA 3GB7B 5KVDE 3K0YA 1L9MA 1NCTA 4IOIA 4AEIL 4F7CA 1AGBA 1TZHA 1AD0B 4NHUA 1G84A 4Z8FL 3BWSA 3KYOA 3B3IA 1MCWM 5ANME 3KPMA 1AIFB 2AJVL 2FEDD 3HFFA 4WFFE 3KG5A 5CLXA 1MXGA 4AQ1B 5T33L 4OCXH 1T2JA 5T1KD 3D8MA 1E67A 4YHPB 3MR9A 3J8F7 3QNYB 1H9VA 3BCFA 3QI9A 4LVOB 5AW2B 3W1ZA 1B2YA 2YRPA 4U6VH 2Z7WA 2FWOB 3AG1B 3ZKXC 4YDNA 4EOWL 3PQYE 4OZIF 2AABL 3FAXA 1JPTH 2WTPA 4RWHA 5AVTB 3VI4B 5JIHA 4XNXH 3N6YA 4HJUA 1HAWA 5CEXB 1RHFA 2X42A 2FX9L 2ZYRA 5C6TL 4BH8B 5DDHA 3QVAA 3S5LA 1T4WA 3IJYA 3CPLA 2R2HB 4AQEB 1QBMH 1CQKA 3QZLA 1USZA 3FSOA 3EIFA 2EDHA 3GZOA 3JTTA 1JGIA 1H5BC 4QF1B 1M2VA 1MIEL 1GRWA 5ETUA 3HI1B 1HS6A 2NYKA 4P2RD 5EBGA 3ARBD 5CS7A 2DMBA 2WLJA 5IB3B 1SEQL 5KS9B 4QRUA 2EDBA 1B2WL 5I1GL 3S37X 5LKNA 3GUTA 3HAEA 2NY5C 3SPIA 1X6LA 5T3ZH 4GQZA 1FNEB 1U3YA 3QXAB 4LEXH 4KWUA 4DUXA 3IFNH 5JW3L 1J1XH 1OF2A 3QCTH 4FI6A 4XAWL 1F4XH 3Q8CA 2OMWB 2YUVA 2ZCHL 1BQHG 4XPGH 3EHBD 1KT2A 1JGDA 1CN4A 4U2ZA 5I6KA 2A9NH 4TRPL 3VXTA 1PEZA 1P7QB 5SWSB 3I6GB 5BOJA 2C1OA 3LAFA 5JPMA 1PZ3A 2GSGB 3D1MC 2BS8A 1TG8A 2K7PA 3RWGA 3O9WA 3FTVA 3T0VA 4WW2F 4QHLB 1LQSR 4MZ3A 3ZHLA 3B4NA 2HFEB 4P49A 1HHJB 2XJLA 2DIJA 2Y36H 4AK1A 2G2RA 3O6KH 4MMZC 3SSGA 4KROD 1U41A 3UYRH 1KZQA 4YHNB 3QUZA 5HHOB 4XNUL 4Y1AD 4NM8H 1A1NA 1PS3A 2C3VA 3FFCA 1SYVB 4WI6A 2HVJB 4MAZA 4YFEA 1W72H 5D96C 2NY0C 4IRSD 3HZ3A 4N2FA 4PR5B 4LCUB 4PS7A 5KOVC 3RX8A 3QG6B 1XTLA 5D7KD 3RJDA 3TL5A 3KZ8A 1TCRA 3E2HB 4E41E 1EEYB 4PGDA 2MCG1 2DQJL 3DV6A 1OD9A 1PKQA 2EDDA 2OMYB 4E9SA 3DX2A 1AHWA 2WVVB 4P3CH 3PXOA 2WM0A 2YA0A 4GI8A 4LSPH 1G7LB 2C4FT 2X4QB 4NC1E 1NC2A 3RHWK 3CDGB 4U1LB 3D34A 3VG9B 1PAMA 2VLKB 5C0EA 4XBEL 4MXWH 5FUZL 2DLFH 1WAPA 5B21A 1UJ3B 2Q3AA 3MRNB 5IMLB 3RBGA 3U4BL 1CTOA 4P5TB 3Q2VA 1GZPA 1YEGH 2VDKL 2HJFA 2VC2H 4IGBC 3CDCA 1ML0A 1L6ZA 1INDL 2V3FA 2G0KA 1OAQH 3H9YA 5DEGA 1TZOA 4HKZA 4LCIL 1J12A 1IC5L 2APSA 3NPSB 3VNYA 4YXHH 4KQ4H 3PWLA 1BPLB 1WBXA 2ZUQC 3I2CL 4H8UA 2RB8A 5CU9A 1YPZF 3SKOB 4DK3A 1JYXA 4N8CH 3SDAA 2RACA 4U31A 1S7RB 3GMMB 1M1SA 3VG9C 3ROLB 4N4WA 1BM3L 3KDPB 2CHZA 4Y5XB 5BRZD 1OSZB 5CLTA 5DHXB 1RH8A 4WIQA 4KMTL 4D94A 4R2GB 4UZSA 3X1FA 4QHKI 4XC3L 5H2JA 1HCZA 1CFQA 3DGGB 2XRAH 1XH0A 3LOWA 2VC2B 3VD3A 5CSZB 3DO7A 4JRYD 5DUPL 2EKSA 2MQ3A 3OC8A 5E4EB 3IJSB 1RZGB 2LE9A 4HWZB 4PBDA 4G43B 2H1XA 1RPUA 3WFEL 2X72A 3M17B 1WAEA 5IUSA 2P47B 4PR5A 4KZDH 1M6OB 2WNGA 2BP8B 2J72A 2LV4A 5CEZE 1BFSA 2LABA 3SQBA 2BERA 3HN3A 3NCJH 4FP8H 3KLAA 5IHZB 4XPGL 5MEQA 5I1KL 4XMPL 1SYVA 3PXLA 5ESAB 1T21A 4KVCH 3T2NH 4ZW3A 3Q8FA 1XGRA 3RTQB 4K7FA 4A7UA 1WCQA 4DGIH 4ONGH 3VHZA 4KI5D 5K9QG 4LK4A 1CR9L 1QFOA 2CIKB 1NEZG 3TA3C 5GGRY 3I02A 4LDLA 1QUPA 2ENQA 2CH8A 3DVFA 5CEYB 3SDDC 3SGDI 4G82A 3R06A 3TWCL 4AMJA 2OL3H 3GIZL 3HZMB 3UTTA 1TVHA 2ITFA 2EDKA 2Y36L 2XVLA 5FOBA 1UWEL 4FEMA 4WEEA 4JM2F 4X42A 5CZVH 3IETA 4LSVH 1OCZB 3FTGB 1MRCL 1KIRB 5L9DL 5T3ZD 3ULUF 4G8GE 4JO1L 1AGFA 3CVBA 4K5LA 3VFWA 3JQOB 1M3IA 4L4VD 4Z7UB 1CLZH 2OMWA 3LTVA 2JB5L 4MD1A 4IIQB 1HN1A 2DB8A 5KUMA 2R2EA 5JPMC 1YNKL 2X0VA 5A2FA 5DHVH 1RULL 2DQJH 3L3DA 4W6WB 4L1TA 1ZEAH 2CR3A 1IM3D 2VZ1A 2QV2A 4F57H 4MD4B 3GUTB 1BBJB 1U95B 1U8QB 2YO3A 3DJSA 4KJPD 3ZE0F 2WUBL 2JI2A 1WZKA 2YD0A 3ILPA 5IFAL 4NNYB 2EVJA 4YK4C 3LS4H 4XPHH 4PRPE 3P11H 2C7UB 3PDOA 2L8AA 1PZ2A 4ECNA 2I25N 4P2OB 1NGQH 4G80A 5DYOA 1CURA 3HAOA 3AT8A 3EUUA 5DDHB 1NLBH 4PGEB 3VDAA 1EMTH 3X1EA 4N24A 1CXHA 1GGBH 5B6YA 1A14H 5I1AB 1ITCA 4CW1B 1KXVC 1U8JA 3H7BA 4BSWA 3NFNA 2P5EB 4PV9B 3UEQA 1FFNB 3OTTA 4KV5E 3TP4A 2QKIB 3F12A 1Z1WA 3CLFL 1BRDA 2JK5A 3GUFA 3U7WH 5JJJA 4NN5C 5KSVA 3JWDC 4APXA 2WGXA 2Y2YA 4YXKH 3Q06A 1AHWC 1EAPB 2ZXQA 3QAPA 2R1XA 4XTNA 2XOTA 4DPAX 4LZKA 1U93A 5K33A 4MHHI 4QRQA 1ZLDA 1ED3B 4MASA 3NUKA 5J9PB 2JVUA 2BVYA 5T3XH 4DKTA 3O4LE 3POCA 1BD2A 1JZHA 3CFDA 3I3EA 3NYKA 4H44C 4JG0L 4XXWA 5GRVL 3GIVB 3BPNC 3S8FB 3T8MA 4PJDB 1DJZA 1IAII 1SVBA 4NFDA 5FDWA 2UWEE 5DEZA 1T1ZB 3F8UB 2YXVA 1R33A 5DHGA 5LG1A 5HDLA 1YN7B 1ZK9A 5HYEA 4DCQB 2RAMA 4J2XA 3LIZH 3C5ZA 5EUKA 1NEZA 5IFJA 4IDJH 1UXLA 1MFAH 3UAJC 2XIDA 1C8QA 1Q94B 3VFOA 1FLRH 2HT2C 2R7EB 3MREB 1J11A 1NFDB 1T7VA 1JWSB 4HK0B 3TTYA 2VLMD 2FWSA 2P5PA 5BRPA 2I69A 3KPQA 3KM1A 4Y9EA 3ABZA 2VXUL 2QV4A 4PRHD 5DU7A 3B34A 4ZUVA 3K8MA 3BN3B 5K1VA 3OF6D 4LP5A 5KVEE 1C5CH 2A77H 1YY8B 2BLFA 1EEZA 2Y22A 3B2PA 5IB1A 1VJSA 3KLAB 3PHOB 5HYIA 5HDBE 3OE9A 5T3ZE 1R5VA 1WIPA 3DX3A 4HFUH 1K72A 3BSGA 3C75A 3QZWG 1J0IA 5FOJA 4X98B 4JO8A 3UJTH 8PAZA 4DKFH 1M1XB 4PJBA 1BJ1J 4AJYV 2OXHB 4ZPTB 3RVXC 4BV1A 5A6LA 1FDLL 3M1BA 3CXFA 2R23B 3IJHB 3J07A 4FMFA 1WO2A 1X9RA 2XFXB 4JO1H 2OK0L 4ZMYA 3ZTJG 3RWEA 4ATWA 3QUMA 1CLZL 3KR3L 4M7ZB 2P44B 4IMLB 3QO1A 2CJUH 3V4VA 4K5PA 4U1SA 1A6WL 5SX5K 1N6QL 3ZMNA 4GKSA 2Q5BA 4ZMAT 1Q9WB 3VE0B 5MENA 2HJLB 3O6ML 3H3BC 4YEFA 4W9FC 5CKGA 4FNRA 4WEUD 4M1CD 1QWHA 3PUUA 4FNSA 4MCMA 3T2OA 4DEPC 4UQ9A 3O0LA 2E0PA 4XPHL 5IT2H 3L2NA 4HH9B 1RUPL 2C3HA 4I9XA 4PTUB 1KWKA 5G55A 4EBQH 2H6PA 2NY2B 1OKEA 2W92A 3OXSB 4UTBH 3B7YA 2ZXWB 1PY0A 4XVUC 2AANA 2MCPH 4YDLB 2WWOA 1I53A 2DWEA 3JWNC 1Q4NX 1UXSA 2EH7H 1TQTA 2YJQA 1YEJL 2YGVA 4PJ8B 1NFAA 3ZUCA 4NQDB 2Q2LA 3R4RA 5L2KD 3RY4A 3RZEA 4JKVA 2DYPD 3CFEB 5E08H 1BXXA 3BYYA 3P54A 2EVFA 3MBVA 3V6OE 4XTLA 3MCLL 2KH2B 3DVNA 3G5ZB 4Q4EA 4C56A 1OAKL 1XD0A 1M4KA 2VUYA 3VD1A 2EVHA 4JQVC 3D6GA 3LN4B 1I7UA 4LDCA 5FYKL 2CLRA 5AW1B 3PV6B 2RHEA 4X6DF 2CKNA 2GBVA 4AIOA 4NDMA 4F7KA 12E8H 3DXAB 4TSAL 1YNLH 4OFKA 3UDWC 3GJEB 4KJWC 1LL1A 2J4WH 1IAIL 1L9QA 1IGYB 2I60H 5K9OA 3AQXA 4JGUA 3U9PH 3LS5H 4PGZA 3RHWF 4EXPX 3CVHH 1UA3A 4WO4A 3HE7B 4WFHE 1VKXA 1S6NA 2DQ6A 3MUZ1 4FQXD 5TGZA 2DW5A 5D8JL 5CZRA 1QTPA 3QUKA 4N5UA 3O9WB 2H45A 3KLDA 3QYCA 1IGTA 2X7LB 1RV6X 5KVDL 3GSXA 5BXFA 4GBRA 3VU1A 4XXDB 3RUGE 2FWOA 5D7JD 4PJAE 1MFNA 3UTZA 5IJDC 1TJMA 3ELAT 4Y89A 3ZOAA 4JG1L 2F74B 2YDVA 1OTUC 2JQAA 2AEWA 1EPFA 5C0NC 1XGQA 4AQ1A 3ARGC 1YDPA 3CDZA 1IM9A 4ELMF 1KIQA 5GSRA 2Q1EA 1F4YL 1KXHA 4E5XB 1FSKB 5SWQB 4JPQA 2XA8L 3BIKA 2WO4A 1WFJA 1LDPL 4QOKB 1YEIL 4XPFH 1R3IH 2YCYA 5EEYA 1PZ5A 1RK1A 3UZEC 1ADQH 4YZFE 4MAYD 3V6FA 2A6JB 3IF1A 4DGUA 2XKNB 2UYLA 5CZXD 2NY3D 4AGMA 3EDDA 3L5XH 2FTAA 3GRWA 3QIWB 4AITA 3GSQA 3P4NB 1AKJB 3LB6D 3WJLC 3ECVA 1JGVL 1IE4A 1NGWB 2A6KB 2DIEA 3EGSA 3VMPA 3ZDYF 2F08A 2W81C 2BNRB 2H6OA 3EYOB 4MCZB 3PWNB 3ZL4L 4Z7WE 3HC4H 2XG5B 1MFBL 2HFEA 2LU5A 2WCPA 3MRCA 2ZSWA 4I1RA 3T6WA 4JFWA 1KLFB 2ICEB 2KZKA 4XO4A 1M7DA 3QYMA 4Z95H 1SJEB 3V52L 3F00A 1UOVA 4XOEA 3B7RL 4AY0A 4OFPA 3V6FB 5AVSB 2ARWA 4K94L 1CE6A 2UYLB 5IEHB 2Y5TB 3EJZD 4GPOA 4OBSA 1N4XL 1WPCA 3QQDB 4N6HA 4PWKA 2K45A 3IJ7A 4NGHL 1NOAA 1OOWA 4N0RA 2CNYA 4XN8A 3IVKA 2OP4L 4BFGA 1U8KA 4X8XA 1YMHB 3FT2A 2DOCA 4TPRH 5DTFB 4UQDA 3FO1B 3T0WA 5H35A 2G3NA 4YHLL 5JOFA 2ZE0A 2Z4TA 1SEQH 3JWOH 2GY5A 4HS8H 1JGUL 35C8H 1U3HC 2IANB 1A4AA 4HCIA 2FBJL 2ED8A 2G5UA 3MHZA 1LEIA 3DOIA 1QO3B 1KY6A 1ZAGA 3IJ9A 1CXIA 1Y6NR 2VRQA 2MOVA 4XCCL 3WL9B 3WEOA 2J5LC 3IYLW 4C55A 3ILQD 2QGBA 4TSBL 3IAPA 1DVZA 3NCCB 3QCTL 4N2CA 4GUQA 3MVSA 1DQLL 3OKMB 4BD4A 4NPKA 3PL6B 1BMWA 3EFFB 5BS0E 4QXUH 3QQ9D 1AC6A 3UC0L 3FT3A 2FIKA 1M7UA 4OT1H 5DJ6A 1VA9A 1DVFB 4KHXL 2J4YA 1GIGL 2JB6A 4JCMA 4ZMOA 4N86A 2G5BA 4X4ME 3VD4A 2AEQH 3MBXH 3WUWG 1R0AH 5F6IC 1TQSA 3KPRB 1TQCC 3P9MB 4WEBH 5LCVL 5A3ID 4PYHA 3PV6A 5GSVB 1CGUA 3QRGL 1WRFA 5DO8A 3SBWA 4LDEA 5BQDA 1QFUL 2X4SA 1F4WH 1CIDA 5IB5A 5T5NG 1KFGA 4GRWF 2DYPB 4XPBL 1UZ6E 3UCQA 4OI9A 3K72A 5KBLA 7TAAA 2W8CA 4LARH 4Z8FH 3R8QA 3NA4A 3B9KC 2IDSA 4IBLT 1QBBA 2O5NA 2XHNA 4KI1A 3ARXA 4WTWA 1J8RA 3A24A 3Q8EA 1MY5A 3RJQB 3RZCA 1ZE3H 3L3OC 1KELH 2H6PB 3SDXB 7PAZA 3HHMA 4OQ1A 3ZYZA 4JMXA 3TU6A 1DJIA 4LQFL 2X3AA 3TV3H 1MQKL 3HNTH 4HBCL 4MJ5A 4YX2H 3WNMA 2H8PA 2EACA 3GSRA 4KKPA 5I9QB 1ET7A 5HI4D 3RTQA 2X89A 4KY2A 5FYLH 5J56B 3ISYA 4RA3A 4F9PA 2YFOA 5F7MC 2X2IA 1YMME 1EFQA 1JNLH 5HHPA 2AGJH 1G7QB 1HXKA 1SXCA 2VXVL 5DRXA 2V9UA 2EIZB 3HC4L 4Q6IB 5IVXF 4ZFOB 1ZGLM 2UXTA 1J88A 3FU0A 4BK4A 5IW3A 3RY5A 1OE1A 1AO7A 4MMYB 1CIUA 2FR4B 3I74A 1NCHA 4M43H 4ONHB 2ZP8A 1ILUA 4F15C 4K94C 1HCYA 2BSRA 3QQ4A 1GJIA 3BSZL 2ZWSA 4Z0BL 1KYOJ 2B2XL 3MV9D 3RWCA 4JKLA 3VWJC 3IBEA 3MJ7B 4KK6C 1K8DB 3RWDA 1XIWD 2IXQB 5FFOA 5J3HC 3TCTA 3PNWA 4X6FB 5KTEH 5GS1B 3VTMA 1P53A 4NO3B 2WMPA 3D39A 1TUPA 4J2QA 1GHFL 5BVJA 3QZMA 1QX1A 4X4XB 3TNNA 3BPOB 2P48B 1AHMA 3NEEA 1KBWA 3MTXA 4GAFB 1BWWA 2VDKH 5C0GA 1E0OB 4OCWH 5IMOB 2Z4QB 4HV8B 3DMMB 3S37H 1BRRA 1L7TH 3L3KA 3LV3B 4L3EE 4NM4L 4LCIH 3UZAA 3MRMB 4V1DD 1OLLA 1XH2A 1WK0A 2JJWA 4JFYA 4XMKH 3HB3D 2OQJA 3DHUA 4NYLA 3VTAA 3GXDA 3OJDB 3FQWB 1UEYA 2E7LA 5JTWA 1HHHB 3C8HA 3QJHA 3HI5H 3P77B 2LQRA 4KNUA 1R3KA 2ZCKH 1MDAA 4GW1A 1UADC 2ZX6A 2BIPA 3CQFA 4P57A 2A6JA 1HILA 4TVPE 3PWHA 2NXZC 1NAML 1O5DT 2AEQL 3MBXL 3SKMB 1QI5A 1SDAB 2W60A 4K3HA 2NQ3A 1SJXA 1Q0EA 2NXYD 1YNTF 3L6FA 4OUUB 1UWYA 5DA4A 5IB2A 2I9TA 4N2HA 1KJ2L 4TNFA 1AFVH 3JV0A 4GSQA 2PP9A 3CHQA 5I0VA 3GJFK 5DVPA 2VR3A 1TVDA 3W56A 1UB5B 1GGIL 4J28A 5KS9A 3O6FD 4AM0A 5D71L 2BY3A 2FT6A 3BW9A 3C9NA 4GMTH 4KZCA 4DZBA 4F8NA 3HBPA 3D50A 5TTRA 3B3BA 5HGBB 3F12B 3NCMA 4ZXBD 3MJ6A 4F33A 2YQGA 1BQRA 5AB0A 2JB5H 5INDB 3KPRE 5CN2A 2VN6A 3D18A 3D7PA 4NT6B 4DP7X 1YNKH 2CHDA 5ABZA 2Y02A 4L0ZA 5FPIA 2WVUA 3ARBB 4E41B 1ACYH 2AVFA 1D5XA 4KTDH 5JHBA 1TZ8A 4LCWD 3RILA 1SVZA 3AITA 1ZKAA 2WK2A 3V10A 5AHZA 2W9LA 1UWGH 2YC1A 1EV2E 2YPLD 3MNWB 4GT0A 2ZZLA 4HMDA 4RZCB 1FZJB 3VXUA 1KJ2B 5J57B 3LMJH 4XAKD 5J13C 3OHXC 3NSDA 1ESOA 4OLWL 2V33A 1E50A 4MB1A 4FZ8L 4FQIH 4HJIA 5IEKB 4U1JB 4J7RA 1NGYA 2AQPA 1JGEA 3N50A 4KI5C 2RTTA 3Q05A 1SMAA 2QBWA 2V2WA 2FO4A 3KYOB 1A14L 3BH9A 5GJSH 1FNEA 3QXAA 1LGVA 4P5RA 2GJRA 2VL4A 4A6YH 4XOAA 4WFGE 4ZO6A 1IT9L 3GWJA 4OGZA 4N4YB 3WXVL 4W9HC 4JO4H 4R4FL 3U7WL 4RQQB 3W5NA 1E9QA 2V2XB 4AKOA 2J8UF 3W0WA 4Z7VA 3QEQD 3C87A 2AJSL 1UATA 1H5BB 3B5HA 4JPIA 4QTIH 1R3KB 4M1DH 4UIKH 1JZ7A 1QLFB 4P2RE 2C4XA 1S3KH 5FYJH 3TZVD 3SE8L 4F58H 1KGUA 5DC4B 1RJLB 5C9JB 1WSST 2NY6C 2Z8SA 2BIIA 4FZEL 3X3BA 1SM3H 3I75A 2B59A 3MACL 1OCWL 3O2DL 5C0JA 1K4DA 2GQHA 2O6DA 2IPTL 2KUTA 2A6KA 2WBJC 2JJSA 4KK8D 3QE5A 3GDBA 3K4ZA 4POZD 4E9RA 3N9GH 3CLFH 3T09A 3QUYD 4H5SB 5D6DC 2OX5B 4XH2B 2CLVB 3PYCA 2WO3B 3BQUD 3CGTA 3QI9B 1KOAA 3H42H 1M7IA 2A2QT 4JQXA 1LMKA 3BLPX 3CQPA 1WFMA 3S6CA 4XZUA 4K7PX 5AVVB 1MJ8H 5GGRB 4G43A 2CSPA 1HSAB 1KG0B 4DN3H 1G0YR 4MA1B 2XY2A 2GAZA 4YSAA 3P9WB 4X5WB 4Y9CA 3AG2B 1PBYA 4DVRL 1KN4L 2ITCB 4Y5XA 4JO3H 1O7DE 1EUTA 2Z3FA 3UERA 5EU4B 4XAKE 5MERA 1W16A 2FX7H 3WYRA 1HZKA 1JDCA 3JTBA 1KB5A 3VGEA 3RPIA 4TTGA 5ESVA 3QR2A 4PJCB 3L4XA 4ODSL 4RAVA 4NFCA 4ZG1A 1QM8A 4CMHB 3CX2A 3NSYA 3DARA 1NGPH 3EJJX 4UOQA 2AQSA 3FQRA 3H2WA 3KYKH 4RMQA 3P0GA 3CXHJ 4EAEA 4ELDA 2ZJSL 3Q2LA 1NBVH 4AEEA 2A73A 1N59B 2P80A 2OJEA 3D2UB 3LZQA 4FFYH 3M45A 4MXQC 1MWAL 4FQ2H 4R4BB 2GK0A 4P3WA 1G4RA 5FO2A 1UURA 4Q52A 3DYMA 1LEKB 4GNKB 4LKCB 3G04B 3UJJL 3JVFC 4HJ0D 1LN6A 1JZEA 4AUJA 1TTRA 1NCGA 5GZOA 4K71C 4PV1C 4MA8L 2EE6A 2NXZD 5SX5H 3SPVB 3SE9H 2XLLA 3D0LA 4PJIF 4PRBB 4PJBF 2GUOA 4ZS6C 1XB8A 4RFOL 1HIML 4X6EA 3DV4B 5FX3A 1WHOA 3TOPA 3ZIMA 5C1MA 2K78A 3WFBL 3VDBA 1IZKA 1T6WA 5G4MA 1ND0A 1W8EA 3QIWD 3ZBMA 1E3XA 3MUGA 5KYNA 1SYSB 1A3RH 5H37A 5LJYH 2I9LB 3WN5C 4ZS6D 3VM7A 2WKOA 5J1AA 1NMCC 1D9KA 3VWKB 5CXPA 4X7DC 5AHYA 2EXYD 2XNAA 4NWTH 3BKCH 2OULB 2QKSA 4H5SA 1E6JL 2VOTA 4QR7A 1FL6B 2AJSH 2CALA 1CGYA 1HCFX 2G2PA 4N6QA 4M1DL 4LHJB 4Z3TA 3VVKA 2TRYA 3QEUA 4Y7MA 4ZXBB 3FYIB 1WQVT 1Z66A 5D2NC 4WWKD 3IXTA 4UTBL 2UY7A 4MJID 5IVXB 5IP4A 4HIIB 2JLPA 2Q7NA 4QMEA 4NUGL 2HX7A 3EF4A 3WFHB 4BWTA 1TU2B 2GJ6D 3O6LH 2VYRE 4NZTH 2QJDA 4EF3A 1ZV5A 4TQPA 4M6OH 1G6RH 2AV1A 1MVFA 1JV5B 1OAYL 1NMAH 3UTPE 3UPRA 2NNFA 2YSSB 4TVPL 3WENA 4LSUH 3T1WA 5B3JE 5DZJA 2ENJA 4PD4J 2ADIB 2D31A 5HHVH 2VDNL 4OM0H 2DM4A 1MSPA 1GMEA 1UOKA 4H0IA 3IVKB 1KTRL 3HG5A 4JFHE 4MQSA 3RJOA 4FA7B 3O8XA 2NLJA 3IDUA 5BV7B 3MRGA 4NCC2 1X5HA 4GLRI 4Y5VA 5DJXB 3TASA 4ESKA 1NGYB 4AVHA 1RLBA 1EO8L 2VDML 2DWYA 2CJUL 2F15A 4LVHC 4ODTH 3V4LA 1KN4H 4A04A 1SBSL 4HD5A 1K5NB 4BKLB 1QSFE 1U8PB 1CE1L 2W9DL 1MI5B 3JUZA 4G8IA 4G6AD 2ZXCA 4GRWE 3VGBA 3N0AA 3TNMA 4YEEA 4KHTH 3LRSB 3WKQA 3OAYK 5L2JA 1RVFL 3EFDH 3QXTA 3VGGA 3WKNA 1NA8A 4PXKA 2VDOH 5DO2C 1IGFH 1VZHA 1XWVA 2GFBA 1E3FA 1BX2A 4MGXA 4WV1B 3CZSA 4MNQA 5E00A 1T21B 1BF2A 1DVFD 4HJSA 4U6TA 3SGKC 4BXVA 4W9JC 2BRRL 5ISZB 3HPLB 4YHML 1FVDA 1QHPA 4JDVA 5D9SB 5DHYA 1KB5H 4XNDA 3T6QC 5K39A 3MRQA 3UMTA 3NFSL 3X1BA 3MLWL 5IHLB 2W59A 4JM2D 1GGCL 4QHMA 2BP0B 2VABB 3OKKA 4U6YB 4WV1C 4WWID 5DRZB 3MV7A 3RGVA 1OP4A 1JHKH 4FXGC 4U3SA 5CILL 3DRQB 1HZXA 1QTYT 1E3ZA 5I74B 1BQLH 3T4YA 4F7CB 3LZFL 5A2BA 4Y4HC 1WFUA 3SZ6A 1AD0A 3MXVL 5TDNA 4C4KO 3L2MA 5E08L 1G9MH 3QIUA 2R1WB 2ZKWA 2EVIA 4MJ6B 1L5GB 3QGVA 4AYEC 5J0BA 3EH3B 4WRLA 1FFNA 2R27A 4LAQL 4NRYB 3QXUA 2XWZA 2B5IC 5C2UB 3VXPA 1F4XL 2OW7A 2Y6TE 3EH5B 2WINB 1MCKA 1IX2A 3CMOH 4MD0B 4TPRL 5C0DA 5I19H 3GXUB 1J5OH 4C57C 3MMEB 2OMUB 2WWMD 4PGEA 1XDTT 1RD6A 4NWTL 3N1MC 3T3PB 2DM3A 5AALA 3ZPQA 1DBAL 2QTVA 5K93A 1EDQA 3F7YA 4HF5L 4ZNEE 1NCCL 2GTZB 4HS6B 1PX8A 1YZZA 3A67H 4LPVA 5BJTB 3K6IA 5JLZA 2PCFB 3CSTA 3ALWA 4NQEB 1I3GH 3CFQA 5IMOA 2GTWA 4NI3A 5EBWB 4A7GF 1B0GB 3BMVA 1BBJA 1U95A 4MLSA 4PMEA 4GQPH 3US1A 1KENL 5EN0A 4NP4L 4PGCA 5F7WC 2JKRM 5IQ7H 3CVDA 3LEVL 3EOTL 2EDQA 4N28A 4CADA 3O45B 2CO1A 4I2XE 1BAWA 1TTBA 4NKDB 2X5PA 3LZLA 5F6HJ 2GIXA 1E4KC 4M7LT 1IQDA 4WI7A 2FSEB 1OHZA 1U6AH 2BX5A 4J3BA 5G5DB 4C47A 1G1OA 1FNFA 4HG4J 2LFEA 2CRYA 1OAUH 4NC0B 1FE8H 4RRPA 4FI8A 3FL7A 1E5YA 4FTVD 5FHAH 5DZLA 1R3IL 5J06A 2IAND 3LRKA 4TSBH 1KIPA 1TEYA 1B6DA 1WBYB 3MLTB 4HAKA 5B3JF 5HD8C 1IVTA 1IEHA 4JCWA 1F45A 1X5YA 1JRHH 2PO6C 3UC0H 1ZLWK 4Q9RH 2IBBA 4B53A 5T3XE 3E80A 4B50A 4JR9L 1L0QA 1UGNA 3GMLB 4KKBD 3RUGF 2HLFC 5E24E 1O7DC 3W5MA 4I9WD 1YYLL 3OKNB 3SN6R 4ATTA 3MRIA 4PB0H 2X05A 3FT4A 4MXVF 1MCHA 3AGVA 1KGBA 2CK0H 3VWJA 4WK0B 2I9LA 4MWFA 4IMKC 2B1AL 2DMKA 2WLMA 3OB8A 4Q9CA 1JNHA 1EZUA 4J4PC 3BAKA 4YIQB 4QCIB 3V4VH 1J1PH 1BAFH 2D7PA 3X14A 1IL1B 1QNZH 3Q9PA 1FO0L 3PGFH 4X6CE 1BYOA 2JXMB 4Z76A 3SPVA 4LSRH 1TOXA 3Q13A 2ROXA 1GGCH 3T45A 1FG9C 2PYEA 1DUYB 5BMFL 2MNUA 2HX9A 1YLBB 1C16A 1JHKL 3QC6X 3NSJA 5F1OB 1T04B 4M6ML 4PGCB 4HSCX 5BW7A 2JI3A 2JKJA 3GSNA 3SGKA 4U1JA 3C8KA 1MF2L 2ZXBA 2BS9A 1JGUH 4MFHA 1CYXA 1YJDL 1V5JA 4FJ6A 4S2SB 4JM2C 3KEHA 4KNQA 2YAEA 2KDYA 2MPAH 4RAUB 4K8RD 4G7SB 2EP6A 1ES0A 4ADIA 3VD2A 3HE6D 4OFYA 4KAQH 1F4HA 3II1A 3N41B 1DQDH 4XBMA 3EBGA 4FQQB 4FX5A 3BLBA 5FFGA 3WAJA 2AXGB 3Q6FA 5CD5D 2AJZB 3PWUA 5A7EA 1M9SA 4LPXA 1JZ8A 5HI5D 2ILLA 4S1QL 4KH9A 4ZODA 1AGDB 3QBTB 4HGWB 1NGZA 2GABA 4MNGE 4ELMB 1EIBA 4HK3J 5BZZA 1A6TB 3BUBA 1RSYA 4AXWB 5IJVB 3NA9L 4MVBC 5L88L 3QUGA 1C3WA 1NINA 3BAEL 1JZIA 4UT6L 5DJAB 1OM3L 3KE0A 3NTCH 3V4PB 4APQC 3SPCA 1G7PB 2NZ9C 3ZW3A 1TT6A 1FV1A 2D3LA 2OL3L 4KTGA 4XXCA 3SJVB 1FFOB 2NZ1A 4MB5A 4TYUA 4XMZA 4EVNA 4NN7C 4OCLC 2OXGB 2UZXB 2KI6A 4JY4A 2OI9B 2LU3A 4NNPH 3ABGA 1MRCH 2WTOA 3OAUH 4NUQA 4LHUB 5IROC 3SQRA 4XT3A 5DQDL 1D3CA 4JFEE 4I1NB 5I8KL 4ZSOB 3OVUB 3KEDA 3GMQB 3T65B 1NCJA 5MP6L 4JREB 2CCLA 1TJGH 3WTYA 4FJZA 2P5EA 4I8DA 4JANB 3B83A 3LVEA 1PTZA 3GDCA 1I3VA 4I3RH 1UH3A 3ARSA 2NR6A 4TQEH 4B3EA 4EI5B 3IJEA 2FHCA 1JOIA 4UI2A 2Q86A 5L2JB 3W39A 5C0BD 3PAYA 1OT4A 1UQSA 3VXRE 1H3PL 3NRFA 5CHNA 1BF5A 1NDGB 5EO1B 4DKDC 2C9QA 4DTGL 1JF6A 1RZKC 1N2RA 3DROA 2XVGA 2PEDA 1E5UI 2CIIA 2P9RA 4GXVL 1XJIA 4HIJB 2YD1A 4RAUA 3MA9H 4GBXC 4NPYA 4U0QB 5D2LA 5CU5A 5I8OL 3GEFA 5EWIL 4PV8A 3KJ6A 2IALA 3G6DL 2NNCA 3DTXB 3GSNB 4JDZA 1TJIH 1CLYH 1I1AC 4JPKL 1KC5H 2AABH 4FQ1H 3T3MB 1EZSA 5GGSY 3OKYA 3I9PA 1MCWW 1CPUA 4Z7UA 5I6XB 2AK1H 5AAWC 1HSBA 3V4VL 4Q89A 2P5WB 4L5FE 4NQXB 4P5TC 3AM6A 2Z7ZA 2H32H 3PHSA 3FT0A 7FABH 2CDGB 1T2QH 2KL6A 2A6DB 5KYWA 3KYAA 4MS8C 3GMPA 3D48R 2B9AA 5E7FA 3MLXH 3B56A 3R7RA 1SGKA 1NDMA 1RZ7L 3D33A 3MBED 4PLKC 3JUYA 5HBBA 3S5LB 3NEOA 5TDOA 5J1TC 1ONQB 3VFTB 5KBDA 1KJMA 5HJBA 4B9CA 4LL1A 3VI4A 3VMOA 2APBA 4JANA 4PSRA 1A1OB 1JPGA 4WUKH 2XWEA 2CA4A 4NDMB 5CSGA 2UUDK 5D7HA 3VQ2C 1JXFA 1WYJA 4UOW1 5CR1A 1NAKH 1NCNA 5ID1B 2WOBA 1SFDA 7PCYA 2X1PA 1QLEL 4FNLL 1S7WB 4NN7B 1TENA 5A8EA 4DJMA 1X5ZA 4PJIB 5DRWB 3STLB 4U1MA 2BOCA 1E6OH 4ZFFB 4I9WE 2EIJB 1THCA 4XB7A 4R4FH 1WE5A 4PRBA 4YR6B 4E9LA 1G9HA 1YQVL 3ARPA 3SEPA 1JV2A 2AEOA 1OTSD 4BZ2L 2XIIA 4JFQB 1LEKA 3DMMC 1H8OA 3ETBF 4AW4A 3PGDA 3SDYH 1QACA 3S36X 2WIMA 4PD4K 4R7NB 4MSWB 3SPJA 4LESA 1B0RA 2Z64C 5TQ0L 1HTYA 4M6NL 4L8CB 4L9LC 3WLBB 5AKSA 5DHHA 2CUHA 1DJYA 4UAHA 1SM3L 3MACH 5D72L 1EX0A 1O7VA 4PH8A 4DGVL 5C86A 1UT2A 1RZJH 2X6AA 4HFWA 4L9DA 2W0FA 4I3RL 4P04A 4PJCF 3ZDXB 2JF1A 2P4AB 4A2DA 3SO5A 2IQAA 3V5DB 2XTJD 5ESVB 1K5WA 3U9WA 4Z7VF 3NOIA 3OE8A 1C5DB 2PPEA 2XWJA 3TBWB 1YN6B 3QHFL 1ZY9A 3P40A 1NICA 3BWUF 1TNMA 1CFVH 3NABL 2XTJC 1SQMA 2CBQA 2VZ3A 2WXGA 3BN9C 4LPUA 4TS6A 1NUGA 3OR6B 5KSUA 5C0FA 4XT1C 1PLGH 3D39B 3ATEA 4UQAA 3M46A 3MFFA 1Z2KA 2YMOA 3LSOB 4HGMA 4NWUH 5F6IB 3GI9H 2WVVA 2EEFA 3ODUA 3P73A 4WKZA 1M9WA 3I50H 5FIEA 2E6QA 1EXHA 1YUHA 3CWGA 4O2FB 3O45A 3QG6A 3D9AH 4KOBA 2F68X 3D69A 1E4WL 1A4KA 1UH2A 4PI0A 4DQAA 3BKJH 4ONFH 3A47A 3LD8C 1XF4B 2OJZL 4JZNB 4N85A 4S1SL 1X9QA 2ZPKH 1PXSA 3AU1B 5JR1H 1OAKH 5T1JA 1FC2D 4IU3A 3GS4A 4RVBA 1KNOB 3WELA 4BFFA 2D7NA 1UKTA 3VCLA 1FYHB 3L3OB 3QUMH 4GSRA 5FYJL 3K1DA 4JRYB 4CVZA 4M8QA 2R69A 4GW4A 1T1XB 5BZWB 4A2GA 4AMIA 1CF8L 2E74C 3SDCC 3D4ZA 2QTEA 4QRRE 1OPGL 4EI5D 1PFCA 3FMGL 1W72A 5I1HH 1U8LB 3B9VA 3H53A 5FYKU 4DOHB 3ZJAA 5CCHE 1AGEB 1KJVB 2IADB 1XFPA 4LRIA 3N1QC 5C0CD 5IIEB 3QXVA 4UDTA 5KAQF 1PY9A 3MV7E 1F3JA 2CXKA 4JL1A 5AZ2H 4AMKL 2UVFA 4L4TA 4F1ZA 2FEEI 2ZXEB 3N3EA 4JM2B 5E2TL 3STBA 4D9QE 5I1JL 5FFLA 4RMWA 3E0GA 3APFA 2HRGA 1LK2B 5E70A 1LO0L 2R2CA 2IFFH 2BW5A 1EFXD 2DH2A 3FTZA 1K6QL 1HH9B 5DQ9A 3TFKC 3VGAB 1CR9H 3QIBC 4WW2C 1FYTD 1W2KT 2QR0B 3KPRA 4G6AC 2IDFA 3C5ZD 2DWTA 1K2DA 2MCMA 2AP2A 3GBEA 3UTXA 1J8HA 1MW0A 3UX9B 5BJTA 1A4BA 1OY3B 5HHME 1URLA 4XO8A 1YECL 1AD9B 3AXHA 3NS0A 4MTMA 3GRBA 1DQQA 2FK9A 3BCDA 1W0WA 5F7AA 4MHHG 3G9VA 1NAMB 4PJAB 1FFPA 3ARGB 4YZWA 5DYOB 5AOIA 1IBBA 4N22A 5C07E 1FZOB 3HMXL 1I9RL 3OKLB 5MI0B 3DJTA 3SYOA 2QVMA 4KX8A 4UCFA 5I73B 5AWNH 3ASWA 1SY6L 4A63A 3FN0L 2Q8BL 1OGPA 4D0BB 1MFBH 1CZ8H 1MUJA 3TS8A 1KCSH 4PW9A 4YC2B 3C60D 4GAYB 2AQ3A 2IPUG 4NRXB 5A2AA 4Z95L 5DMKA 5C9KA 3EOAB 1ZLSH 2ATAA 5H2BB 5FO7A 1HWWA 4F20A 1AHKA 3VW3L 3BFWA 4OD1H 4KFZC 5KUKA 2HFGH 3QJQB 3IU4L 4LCCA 4PREA 2NTFA 4B0MM 3PJSA 1PU0A 4ZW5A 1P6FA 1OZTG 4OZGE 3P3TA 4UDTB 1S9XB 3JWNG 4PIRF 3DIVA 3WS6A 1C5BL 4U6XB 5H37H 1JGLL 2MNJB 4GW1B 8FABB 1BDYA 3ML9A 3EXJA 3FO2B 3HJEA 1ZANH 3H3KA 4MZIA 5D1ZC 3KYNB 1U58A 4MMXA 4WUUB 2YA2A 5I8EB 3DUUA 4D9QD 4EIBA 4NKOA 2YHGA 2A9MH 3QIWC 3TVMD 3QK0A 1KCUL 1L9TA 4LBEB 3L3OA 3DVGA 5IBTH 2RQ8A 4MQ7A 5DT1L 4ZFQA 3K71B 2A74B 2Q76B 1OSPH 4PJIE 5TF1H 1EXUB 5C0GB 3VXUE 5IHZA 2FD6L 5I76A 5L2KA 1HEHC 1J5OL 1YEFH 5CIPA 4LRNH 3ARZA 3A5VA 3U0PB 3VUAA 2JJTA 2ENYA 2ZNXA 4Y4FC 3V6ZA 2J5WA 3TH3T 3IU3A 4AJ0A 2F61A 4BQ8A 5IB4B 4H8WL 1ZK5A 1FORH 3GLEA 1TO5A 3WS3B 3HHSA 3LHPL 4GSDH 4H20H 4M4PA 2Y03A 1RZGA 2NY1B 5E1AA 5DFTA 1UZ8A 4YHIA 5AVYB 2WANA 3IB4A 4G72B 1RQ5A 3FUDA 2A0LC 2Q3XA 4OLEA 3SGDH 3SKNA 4DP4X 1E4XI 4ZPTA 2PETA 3DGGA 4AV5A 4AVKA 3PXHA 5F88A 1JTOA 1KXQE 5JO5A 2F7QA 4JAMA 2Y9RT 3DRTB 1WZ1H 2WZ5A 2ZUUA 4PWJA 1JHLL 1OGAD 3WFCL 1JERA 1U92B 1TNNA 1YAZA 4QYOA 5HYJE 4G6JL 4NRZB 4Q2ZB 3D2UD 1WF5A 2ZKMX 4JDTL 2VAAA 2L0DA 3U25A 4ZS7L 1TPXB 4DKLA 4HF5H 1Z32X 1KXVA 3VFOB 1I8UA 3NK3A 4IJ3C 2IVFC 2N56A 2W0FB 3SDCA 5CUSL 3OE6A 3SDXF 3HARA 3DIDA 3K5RA 1EDYA 4X9BA 3BGMB 4I4WB 1LLAA 3CZEA 3F62A 4AEIH 4ZQTA 4XVSH 3JV5A 4P2QA 2F5BL 1J9QA 3UZVB 3P4OB 4ZUWB 1KIUB 3PUCA 1ZGLP 4UAOB 3V55A 1AOZA 3VG9A 5C6WH 2QLVB 3WEXB 3L3HA 4GRWB 2H7WA 2GAZB 4RAHA 1MFEH 4OF5A 4R26L 4KXCA 4PB0L 3FU6A 4PJ8A 4HJ1A 5JORA 3CK0L 4XTRC 1X9UA 3FO9B 4M43L 1U93B 3STLA 3T0EA 2IG2L 2WNKA 3O41B 1YMMA 4PJ5A 3HZYA 4Z0BH 2GJPA 2ZUYA 1WT5C 4Y5YA 4BK8A 1A3LL 3EJUA 2DQCL 4JBSA 4RBPH 3INUH 4AIZB 4R4BA 2HFGL 3IU4H 2VQUA 5GZNA 1BREA 2CUMA 2BOBA 2XXFA 3DUSB 2JE8A 5DUMH 5E8DH 3X13B 3S4SG 3PGFL 3KJ4B 4FFYA 1D7FA 4QRSA 4D9RE 1IAKA 1ZJBA 3QUXC 3T8VA 5I0YA 1EHLH 4MA3A 5L4IA 2EH7L 1S8JA 2HA1A 2HVBA 1UHVA 4M7KL 4OKDA 2HLAA 1NBZA 4PPTA 2VAJA 4GIPD 1NFDE 2EZ0D 4QTHB 1JK9A 1H3GA 2GCYB 3BISA 1TTAA 4IM8A 3NRQA 4JUSA 3WL9A 4WTXA 3TA3A 5EH1A 4GUPB 1BHGA 1RURL 4E2OA 1NUNB 4KFMA 5DMGD 2A74C 3VX0A 2VWEE 2P5WD 1DQDL 3DUHA 2BNQB 1T3FA 4TSCH 4W4NA 5BRQA 4YLCA 1GTNA 2V9QA 1GS6X 3FB5A 3L1GA 4HPYL 4IHOA 4NP4H 5E2UH 2IAMB 1ZT1A 2W38A 4Y19A 4EN3A 4S1DD 1LO5B 3PABB 4GG6E 2BHFA 1XCXA 1HHKA 3QNZA 3FN9A 3S3CB 1D2PA 2M83A 4P5SA 3IU3B 1ODAA 3HG1E 4F27A 3LN5B 3AABA 5B8CA 5IW6B 3FYEB 4J3WA 5L88H 1DCEA 4GUCA 1LO4L 3T3MF 3KW7A 3P69A 2VM3A 2BC4A 2XJKA 3U6RA 3FBKA 1ZVNA 5IB3A 4QRRD 3OKOA 1EERB 5C09D 4NPYB 1CF1A 2EE2A 5GIRB 1GXEA 4U7SA 1WAAE 5HDWA 5AB1A 2GFBB 2VH5L 4HK0A 4TOYL 4LQ1A 2WSDA 5ISZD 3CXDH 1DEEA 5EO9A 2UY7B 1DBMH 4HUWA 4K2UH 4M9OA 2ZCHH 3ZYJA 3SDAC 4ELKB 4S1QH 3RQ3A 4LSQL 3VI4E 5L0QB 1SHWA 5KVFH 2EO7A 4N8VB 4G8FB 1JP5A 4UM9D 5FV1L 2WSKA 3WNLA 5CCKH 1MCIA 4UTBA 3JZYA 3NZUA 4OFDA 5B22A 3FRPA 3NA9H 1N10A 1QEXA 3GBML 4B96A 4KXZI 3KMDA 1TTFA 2VB5A 4ONOA 4LLMB 4OM1L 2C1PB 2DQIL 2KC0A 4NQVB 4F8QA 4PLOB 1HYSC 4NO0B 3A6OA 1I82A 2J3SA 1WITA 4HIEA 2HRLA 2JJTC 3UP6A 1TMCB 5SV4A 1KIQB 4HWUA 4AYGA 2WLYA 5DQDH 5GZNC 5EZIH 4I89A 1JUFB 1OALA 1W72L 3DC0A 4FQIL 3KLLA 2YUZA 2XICA 3OR6A 2TAAA 2PYFA 3N2JA 3K7UA 3FTXA 1TSHA 4G8GD 4LKCA 1U21A 2BNQE 5K1JA 3GF8A 4ANXA 1RP8A 1UCBH 2VJ0A 3IAQA 2EADA 1L0YA 3E6FA 5BZXA 3S88L 3O9WD 1R4XA 5DMJB 1QSFA 3I2CH 4Y2LA 4BUHA 3QI9C 1MIMH 4WAVA 3OPZH 5AB9A 4YSDA 1AAJA 1WIOA 3THML 1K5NA 4B41A 4BH7B 4X6DB 4BKLA 2GJ6E 4EQ3A 3DSFL 5KYUB 5C0AB 1HOCA 3QDCA 3ROOB 1ASPA 1KTDB 1XH1A 4MNQE 3L3IB 2DMHA 3ZZ1A 3WE6B 4K5OA 1IC7L 4GLRH 4R7NA 1JG9A 2K6ZA 2VERN 1MHEB 2WQUA 2GB2A 5KS9F 2XV3A 3OC5A 2IOOA 4IRJC 1QHQA 1RZ8A 5D1XD 3RWIA 5EEWA 1AZZC 4JHAH 2BSDA 5T1LD 1NC2B 5F6HI 1XV8A 5C0RH 1RUQL 3AW5A 1DSFH 2RMNA 1A9EB 3P3UA 2ZG3A 4OH2A 3NCJL 2G0LA 1JD7A 4Y16A 4E9YA 2IXQA 2CHXA 6TAAA 2EIBA 1N6UA 5I30L 1EHNA 1S7WA 4ZAKC 2PMZA 2KLTA 4LIQL 4O02B 3QT2A 2LAAA 4UQEA 5LAXB 2WVTA 1L9HA 3DBXA 2WBJD 4MVBD 4LF3B 4N0UB 1S9YB 3OSKA 3FU7B 4JNXA 2ICWJ 4U2YA 3QDHA 3R06B 1AACA 4N8VG 1E6OL 1ETA1 5TGBA 3UG5A 4BZ1L 3QDME 3GD1C 4N2OA 2D2OA 4WQOA 1CL7I 3M1CA 4WNQB 3PFUA 3RLSA 5D7IE 5DJ8B 5DRNB 1OTSC 2RFXA 3WFEH 1EHAA 3OWEA 4ODBD 1UD3A 4YHZL 3FT3B 1DBBL 4OF3A 4IGBD 5ESAA 5A2KH 2MHAB 2RGSA 1FGNL 3GSRB 4G11A 5DUJA 2P3YA 4WU5A 4P46B 1H3PH 5DJ2A 2WPGA 4C8XA 4NBYB 5B38A 2IMMA 4MD5A 3GLDA 2BY1A 1NC4A 3LPOA 3RX5A 4M4RA 2QADC 1BD2E 1GS8A 3A6BL 4R7DB 4HZ1A 4LEBA 3KCPA 3VVVA 4DGIL 2MWCA 4XPAL 3KWUA 1FYTB 4JL2A 3EMLA 4ZTEA 4BRVA 1X7QB 2A1WH 5GGUB 5SWZD 4D7BA 2VUKA 3GIZH 1QRKA 3RWCB 2EXTA 1XR9B 5D5MA 3V6ZB 1WEJH 1XIOA 3GBDA 4HJTA 1JGEB 3NPSC 1UTDA 4PHXA 2X4SB 1R5IA 3ZXAC 4L3EB 1MHEA 2VXQH 3KL0A 4OGAC 5TE7H 4LCCC 2V3EA 3I9GH 4FYRA 3SCMB 4NN6C 1OZUA 1DVSA 1AQ8A 2WCSA 3BUYA 4N2AA 2Z93A 3N55A 2L04A 2H0FA 1AR1C 3E9TA 5DD6B 1MCOH 3SYQA 3CN1A 1A5FH 2R7EA 1THAA 3MREA 2WLNA 3G5VB 3QDJD 3ARBA 2X6BA 3FUHA 4JO2H 3E8UH 1RK0B 4CAGA 4MDJB 4N1CA 4K3DL 1CFVL 3ZYIA 1QRNE 4EIZC 1SJMA 3F83A 1UFUA 4PJDF 4HLJA 4NRYA 2PO6A 4GUOA 4HUUB 1CTMA 1UXWB 4IRJB 5DMIH 2HT4D 3WAKA 4GRLA 4QT5A 1ZOXA 4PJDA 5IHBA 1DBKH 2I21A 1MAML 2ZUXA 1KACB 3AY4A 3K74B 3QEGH 1ZPUA 1GC1L 3QEQB 4I3GA 3FOLB 3TZVC 1X4ZA 1A6VH 4FFWC 2WD0A 3EDEA 4R5TA 5IB5B 3MGOA 5CMAB 2NY4B 1OAYH 4IOIB 1NMAL 3BAYA 5HHQB 1VEPA 2FYVA 1U8OA 4FLQA 1FIGH 1TTUA 3MNVB 1MUJB 3Q2NA 3WHXA 3CU7A 5ITFB 1YQVH 1JJUA 2QKIA 4LASL 4XRCA 4AMKH 5IKCA 3L9YA 3LQMA 4AXWA 2DJUA 4Z7WA 4MMZB 1NIDA 2GHWB 3AU0A 2I1XA 3PPEA 3IFLL 1I7TA 4UNVA 4LLDA 4NC1C 5LNDA 1ZRUA 3VRLF 4JMNA 3UONA 3GHBH 2R4SH 2VN4A 3LKQA 4R96B 3U36A 3TF4A 4PJFF 1TJHH 4X6DE 3QUYA 3HBQA 1YEHL 1N5AA 4NP9A 4PAZA 5F1IA 1I1AB 1MRFL 2BHYA 2R29A 4ERSH 2H3NA 3IMVA 2AAAA 4XVTH 3DMMA 1U8PA 2DM7A 3QFJB 4RWYL 1RVFH 2AJ3B 1H19A 3PU7A 3TBYA 3UACA 4YSTA 5CCJA 1X4XA 3QWQB 5EU5A 4GAGL 4IDLA 4AZ8A 1MCPH 2NLJB 4LPYA 4N0UE 4RCAA 2J8UB 1FLRL 1Z9PA 2OM5A 1NC2D 3EH2A 3MRGB 3QRLA 4HH8A 3BIKB 5DJXA 4LLVA 5C0AD 5E1HB 3BN9D 4X83A 1JD9A 5LWEA 1HQRB 4OJYA 3VXOB 5A2JH 5DHEA 4C4KT 3IETB 2IOMA 3L16A 1ZVHA 1HXMA 1QRND 3ECQA 3MI6A 3NJGA 4PRHB 1KIRA 2GIMA 4TUJB 5FO9A 3RGVC 3ZU8A 5JXAL 4MD2A 2OI9C 1AO7B 1OGAB 3CUPA 3KPTA 1DVFC 1LVEA 4WY7H 3MKKA 4HZLA 2F54D 1G9ML 3QJHB 3NFPB 2PPDA 3UO8B 3DTDA 4HEPA 5T3XD 3WY2A 3ZKXB 2MKWA 1TQCB 2P80D 1QUNA 4NQUA 4C83A 4FMKA 2H2PD 5MEOA 4CGUB 2HKAA 5E5MB 3GSVA 5HGAB 1J05B 2J88L 4GO6B 2YD5A 2X1XR 4BFIB 2VXQA 3TO2B 2X40A 3LY6A 5CBAA 2JQMA 4MJIE 1J9RA 4UT7H 5MENB 2QSTA 2AJUH 2ZOKA 1R34A 5EZJB 4LLAA 1AKJD 2DJMA 2VR4A 2JTDA 4KQ3H 2ICWB 5GS2D 3AS1A 3VI3B 4LP8A 1NCWH 5IB2B 2XA3A 3ZTNL 1I1CA 4XP1L 1MREH 3T0EE 3QQ4B 1S8DA 2F2HA 5AW9B 5E6ID 4YMPA 1TKWA 1RUML 2QGDA 5K59E 3P1VA 3X2QB 1YNTB 1ORQA 3JT2A 2NTSP 4P59L 1EK3A 1FZMA 1H8LA 5IMKB 1K6QH 1NCBH 4I0CC 2XN9A 3QH3B 4N0CC 1XEDA 1M6UA 1BF8A 1ZANL 2FSDA 4F91B 1FL5A 5EBWA 3U0WH 1KGJA 3ASNB 4A38A 5KZCB 5LBSH 1FVEB 2AV7B 3SDAB 2CM6A 2WLIA 2N01B 4LKXB 4ZUSA 4ENED 2FLRT 2HWZL 1VRSA 2APFA 5E99H 1MKFA 1VPOH 1PD0A 1EO5A 4NOFA 5ITCA 1DL7L 4P9ML 4O9HH 3B9DA 2UY6A 3ZDXE 1X5XA 5E8PA 1FNGB 3UBFA 1EVUA 3HMXH 2NUTA 4S10A 1JZDC 2EECA 3QH3A 3SE6A 4F93B 5BZDA 3MODH 1UD4A 1WFNA 2D3JA 2VRAA 2VN5A 3KCWA 4J3UA 4X4XA 3POHA 1RZIA 3BT0A 2HTLC 2EH8L 3KXFD 1X5MA 3G5XA 1IEAA 1W6WA 4XXCC 5DJDA 5ESQA 2XYCA 4U6VL 3ZGIA 4KUZL 5FKAA 4WENB 4DNLA 4GBXD 1JVLA 5B1CA 1XCQA 4GOSA 3N5AA 1M7IB 2X28A 4IJ3B 2F5BH 1RERA 4GMSL 4OLUL 2CHWA 3V0IA 1JF5A 4Z7UE 1T0NA 1L6XA 3BT2H 3OLGA 4Z0XB 3EDJA 1RJZB 3EJCA 2XN0A 2RA1A 1WAAA 3KVDD 3FT4B 2JK5B 4XN2A 4H25B 5LNGA 4N0CD 4KO6A 4NUJA 3MKGA 5DR5H 2WLLB 4BEYA 2DWSA 4TL3A 1QI4A 4BCYA 1H8NA 3EFFA 1D5MB 4PIBA 1W80A 2BRQA 2QHRH 4MA8H 4N2NA 4KK9C 3KPSD 2DL2A 1RJLA 1I8AA 2XETA 3O2WH 4X8GA 5D4QA 3SE3C 3PQYD 5IROD 4XVSL 3ATDA 1GKEA 4TNVF 4Z7VB 1TO4A 4PS4L 3T4AB 1QEWA 4GI9A 4TUJA 1XBRA 1P9MA 2BIMA 2A6IA 4G6ML 4ZO7A 1OQOA 5IBLC 4D8PB 2D7TH 4B9ZA 4OZHF 2XPGA 3GO1L 1TSRA 3HAEG 2XWXA 4HZAA 4G6KL 4Z7UF 3TN0C 1IBYA 4YDLC 5J9PA 1PXRA 1CU4H 4NQCB 4DESA 1MVUB 1C1EH 3CSBA 3STZB 4IS6A 2CK2A 2ZG2A 1N0LA 6PAZA 1QKPA 5D2LE 3PHQA 1F11B 1JI2A 2ZSVA 1MW2A 3QPXL 2AXFB 3RYMA 3PDDA 2CIIB 3KBFA 3UG9A 2CLZA 3MJ9H 2DLEA 2DMGA 3MRDA 2JB6B 1TEFA 2L7JA 3T4AC 1IFHL 3ZE1E 4H8VA 4EE2A 4JQIH 5DVLA 4Q9QL 3DETD 4OB5L 1QRNB 4Y4HB 4JDTH 1R17A 3HANA 3CZJA 4AQEA 5F71A 4TLKA 1QSFB 2BMKB 5ALBL 1JYNA 3OF6A 4WI4A 3IPFA 4PRPD 3MZGB 5LCVH 1X44A 4UOW0 2TSBA 3BKYL 4RDBA 3SDXE 2BZ7A 2XTSA 3NSBA 3AAZB 4I18C 5IBUG 3IDGB 4YDVB 3PGCA 4DAGL 4XCFL 1KPVA 2YSTA 3QORA 1KTJA 3GIVA 2IWEA 4FYSA 3QS3A 1CCZA 2VMJA 3MR9B 2W95A 3VGAA 4ODTL 2JLLA 4OUOA 4M7ZC 4WHTA 5DTFA 4WW1B 5GRJH 3DX9A 3RA7H 4BCZA 1G7HA 1LMIA 5GGVL 3SJVA 3TC9A 4X6EB 4U6YA 1K4CB 2YQBA 5CSZA 5CN1A 5E2VH 1TZHB 2Z35A 4HUKB 4CU7A 4P07A 3VXME 2Y5TA 4FC3E 4JPKH 4L4TB 4PBXA 2KS0A 4LQFH 4UT9L 3HBZA 4JPVH 5A1AA 3S8GB 1J8SA 3CC1A 4IJTA 1HC1A 1JVOA 3OE0A 1HX0A 4R97C 3CN2A 4PWEA 4BFBD 1ODUA 1WZLA 4G8FA 4HHWA 4WFGD 5FK9B 1BG1A 2FJFB 2GSIA 1LWHA 4Y88A 3GSUB 3HC0B 4HC1H 5LWYL 5HVWA 3UXFA 4NBXB 1J0JA 3UAEA 3ZK0A 4P2OA 3QUXD 4R0LB 1HL8A 2VDOB 2VLJA 4GINA 4K5NA 4ANKA 5C6PB 4PLJD 3NCEB 4HV8A 1FVEA 1VZIA 2AV7A 5F93C 1MEXH 3QSKB 2K1MA 5FCUH 2IQ9H 4Z7QE 4YGVB 5KVEH 4HJ0C 3WG7B 2EVGA 5BVJB 3WSQH 3K4AA 3X1GA 1EUUA 5F88B 4V11A 1QQDA 3KJ6L 3X3FL 5H94A 4JVPA 1Q8MA 1XBDA 3CFEA 4PJXF 1G7LA 4WWNA 3V9EA 2CKBL 3DO7B 1X7QA 3GO1H 3CFJA 4PP1D 4TQIA 1T5XB 3KXFB 4PCKA 1S7UB 2ED9A 4EOWH 1PPIA 3OJ2C 3SOTA 1INQB 1OB1B 1KV3A 2NY7H 4QHNA 4XO3A 2CO2A 3S88H 2H9GA 4GB9A 4MD5B 4MMYA 4I2XA 4ODWA 2PPAA 3FZUC 1UKQA 1D6VL 3FH5A 3L3JA 4U0RB 3WEAA 4DT2A 5M95B 4FMVA 1QG3A 2WWMC 4B6ZA 5ADOL 3RFZA 4JY5L 4MDRA 4TULL 4YN3A 1M7XA 2HLAB 3HI5L 3M7OA 3QW9A 2VH5H 5HHPB 2VLKD 3FQNA 3US9A 4KNFA 2EDJA 3MJ9L 4YJZL 4Y4KC 3AQDA 3QEHA 2HMID 2X89D 2E7LC 3V9FA 4XNBA 5IFJB 1KV7A 5I1IL 1A4CA 4DVBB 1CGSL 4JQIA 2VMCA 1KTLA 1ZLVH 1T0NB 4EEEA 5GRWA 4PJFA 5G2AA 2XWBA 3IDXL 1KJ2H 3IDNA 4CILA 2EKJA 5ABDE 1OE2A 2Z8VC 3QS2A 5C0EB 3N41F 4UTCA 3LQAC 3TEUA 3TWYA 1KTKE 2BXZA 1A6AB 1E4JA 5FYLD 1J1XL 2WUBH 1PDKA 4FA8A 4Q9BA 1VESA 5AVRB 1EVTC 4PJ5E 5D71H 3WEXA 2QPFA 3VRJB 3HC3L 4J39A 4QRQB 4ZFFA 5LGJB 3RWFB 4J4QA 5TF0A 3WTXA 4KXAA 4OF6A 3VI3A 4TRPH 3EYSH 4L1HA 5GRJL 4P5KA 2QSCL 2NR6D 4UF7C 4GKZA 1SXNA 2CUIA 3E3QC 1E9PA 2QFRA 3WY3A 2HPOA 5E2WH 4ABUA 3QIUC 4TNEA 1AQKL 1YEDB 3BVNB 1VFOA 3D4GA 5C07B 3PGCB 3V2YA 2Y1VA 4F7TA 3SKOA 3I50L 3S48A 2FQFA 4FFTA 4RZCA 3FF8A 1AZRA 3JTTB 2EIEA 3TCLB 1QLRB 1IW9A 3BPCB 2V7HB 1J5CA 1OTTC 2VMFA 4Z9KB 4V1DA 3ULVD 2G4GA 1GPOL 1NWPA 3IFOA 4L1BA 2YD3A 3SYCA 5C6TH 5DZAA 4WK2B 3M88A 3WKYA 1I8LA 4MD0A 4R96A 2WLIB 4ZUSB 3U36B 3ZN6A 2YCXA 2OTPA 2VXQL 2YUXA 3O3DB 1TZIB 2FT8A 2PR9A 4NN6B 5IK3A 3V5HB 1QR4A 4MLIA 1N0XL 4HZLB 3LKPB 4UILH 2C7FA 3CHPA 5J4MA 2AXFA 2X70A 1XF2B 3TA4D 2Q7AA 4KTDL 2WBXA 1UA7A 1K4CA 3PPSA 3IK2A 3V6OA 1DQVA 4IBQA 1IW6A 4P4KA 4M29A 1I1FA 4JRXA 5FA4B 2IBZY 3TBSA 3UO1H 5C0RL 5AZUA 1QFHA 1GCFA 1E5ZA 3KJ6H 1OAXL 1II4E 3VFWB 4LLUB 2VN7A 3DX6B 3FUEA 4XP9L 5CJ8A 1CXLA 4Z3FA 1MAJA 4BE6A 4NNXA 5TPWL 1H6EA 1A1NB 3FFCB 3RVWC 5ECJE 3ZSTA 1L9SA 2EE3A 4U6HB 1YVLA 2EINB 3QEGL 2IFFL 5I16B 1INDH 1OAQL 1MCRA 4MDJA 4H8PA 4BWBA 4U1IB 2X1WL 3NCYS 3VSQA 5DC9B 1JWUA 2NXZB 1T20B 3QJUB 2V5TA 2VO8A 3C6LC 3MOAH 3LKRB 5AENA 4AW7A 5IOPB 3EGSB 3UIYA 4MRCA 4LO9A 5IY5B 2BNRA 1IKNA 4LBAA 3NT0A 3PLYA 1GYVA 2AJXL 5DJZA 4MYPA 2VZSA 5C92A 3WIHL 4JFUA 5EUOB 2JMRA 3FQXB 1BPVA 1MN4A 2CR6A 3ET9F 4DQOH 3ARVA 1N64H 4W9CC 3FTUA 5DUPH 5GSRB 2W88A 3R1GL 2V9TA 4WI2A 4A7VA 5IW6A 1IAMA 3DOHA 1AIFA 1FJ1A 4G9DB 2IDQA 3DX9B 4JO3L 5TJWK 3WHE1 3RZCD 2UZXA 3MLRH 1MHHA 5KAQG 1KYUA 1VGKA 3IPBA 2F74A 4AZ8B 1MG3C 1ZHLB 2BNQA 3N1FC 3V2AR 3BWAB 3IKKA 1DZBA 3GB7A 2PP7A 1JXDA 1MCPL 1DO5A 1EJOH 4R7LA 2F7PA 4X5XB 1XR8B 1HL4A 2B39A 4RSYA 2APWA 4DTGH 3VW3H 3V5HA 3X11B 4JKWA 2NW3A 4HKXA 4EBQL 1XF3B 1AGDA 4HGWA 4LHQB 3S3JA 3EO1A 4J23A 3H9SD 5A43C 1SMOA 4KJYB 4Q6IC 3BZDA 3FFDA 4Q74A 4A39A 4B27A 2NY1D 4AJWA 3BD3A 3DNKA 1KC5L 3TWCH 1JGLH 3VSUA 5IREA 1NL0H 3HLKA 4HDIA 2V7HA 1IGCH 3UJJH 1WA2X 2D9QB 4XO5A 3VFRA