3QJQB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjqB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjqB02
4DAJA 5LDUA 3CODA 1AS7A 3FSWA 1JZIA 2R7EA 1SFDA 1ILUA 1ASPA 2J57A 4N4YB 3VGAA 5AWZA 3AY2A 5D4JA 2NTWA 4A68A 1XB3A 3OAXA 2DV6A 4BK5C 3NSYA 1S51A 4P5SA 1OCCB 3ZPQA 4EIYA 2IDTA 4AKPA 3EH4B 5LWEA 2YAEA 3EHBB 4L6RA 4N6HA 5H2LA 2WSDA 4E9WA 4XXJA 5F8UA 5F7AA 1XMEB 1S8JA 1JZHA 1OOWA 1DZ0A 2PPCA 3RYMA 3HARA 1DZEA 3JT2A 4N4WA 1UAZA 2PP8A 3AZUA 2G87A 2QPEB 1Q5IA 4TL3A 5FJGA 3N2JA 2JFCA 3CDZA 3OQRA 3S8GB 1E0PA 1JVOA 1KGYE 5G54A 5B7EA 4HALA 3UAEA 1CC3A 3X3CA 1QKPA 4YSQA 1YLBB 3PXLA 3CZUB 2I35A 2GC4C 1PY0A 2UX6A 5B34A 3AG4B 5TK4A 3X1NA 4F7KA 2YAHA 3WQJA 5B1JA 1L9OA 1GS7A 4XTNA 1FA4A 4UHRA 2YXVA 2QDVA 1X9UA 3HASA 1IKOP 1JVLA 5H2OA 3S3CB 1KCBA 2EIKB 2EILB 3HEIB 3IBOA 1L9QA 3WKPA 5ITEA 2GHZA 1J5CA 3NSCA 3VW7A 3FSAA 4GYBA 2YXWA 1KYAA 1JXGA 4DP5X 1QHQA 5EN0A 4YVNA 2Z73A 2ZXWB 1AOZA 1OCOB 2R4SA 3AYMA 4YSSA 1XIOA 1SHWA 3S3DB 3QBGA 1RZQA 5ETZA 1SNRA 3ABMB 2CUAA 3OMAB 3TA4D 1BRRA 4DPBX 1AIZA 1DYZA 2DY2A 5TK2A 1KBWA 3A7KA 2H5UA 2TSBA 3D12B 1MGYA 1AS8A 4L35A 1NINA 5AHZA 5B1BB 3EH5B 3OE8A 1J9QA 2FT6A 1AG6A 3X1BA 3MX0B 4HZ1A 1ZV2A 3PXOA 4BUOA 3CG8A 3ABWA 2BRDA 3QAKA 1AT9A 1C8SA 2BP0A 1U19A 2CBPA 2IDFA 2UXVA 2LLNA 4GP4B 3NSFA 2Q9OA 3AM6A 4HYXA 5J7AA 2ZZLA 3CVDA 5B6YA 3UADA 2DYSB 1E5ZA 3T6WA 2P80A 1TEFA 2PPEA 4DP8X 3NYKA 5I28A 3UACA 9PCYA 2E86A 4GP5B 4A67A 3X2QB 5I6OA 5PAZA 2QT6A 4Y9HA 3GXUB 2W8CA 4BDVB 1PXRA 3QJVB 4A2HA 3VHZA 3KW8A 1VJMA 4YSDA 3QJQB 4DP4X 2RH1A 5I5JA 3KW7A 1WS8A 2Y1AA 1CURA 4X4KA 3X1EA 2GI0A 1ZIAA 4EF3A 3UTWA 1ET7A 1GSKA 3AYNA 1J9RA 2IH9A 3FSZA 4JKNA 3H4FA 4DPAX 2YAOA 1NDTA 4KO7A 4G7QB 1SHXA 1OE3A 4YSAA 2WJKA 2X72A 3AG2B 4AKOA 4WAVA 1JZEA 1RKRA 1NIEA 5AKRA 1AANA 2FT7A 1H2SA 4M4RB 3VVKA 1MG2C 1ASOA 1T5KA 4GXFA 1JXFA 5BR2A 7PCYA 1FWXA 3T9WA 1NIFA 2GBAA 2BWIA 4E9VA 2XXGA 4HIPA 2W88A 1OF0A 4YSUA 2B3IA 2HRGA 2FT8A 2L6XA 3HB3B 1S54A 2ZIYA 3WKQA 3NSDA 1E12A 1S8LA 2YAPA 1GYCA 1CYXA 3T71A 3NJMA 3KJ6A 1UATA 3ABKB 5G53A 8PAZA 4MBSA 2R4RA 5I6MA 2GIMA 1BAWA 3NJIA 4HHWA 4MQTA 2PCYA 4E9SA 5G2DA 3V2YA 5IY5B 5G36A 2Y02A 3UG9A 4WW3A 1SF3A 1L9PA 1ET5A 4E9RA 1IXFA 1SFHA 3SQRA 5H2MA 2BW5A 2BP0B 2B08A 3IN0A 4E9QA 3UAAA 1OE2A 3FU7B 2J56A 4IARA 3FSVA 1HFUA 1FBKA 3HAPA 2HXAA 1ZPUA 3L45A 5I26A 4BDVA 1LN6A 4YL4A 3PAZA 1A4AA 4GYCA 1ETJA 2H3XC 1QKOA 4TXVB 4YSEA 1AR1B 3V2WA 4DPCX 5TGZA 1JXDA 2VSMB 5E9NA 3X1GA 4N8UA 1WS7A 3MBVA 5AZDA 1V10A 1S52A 2CCWA 1PY6A 4KNTA 1E5YA 1KG8A 2HRHA 2Y00A 1JFPA 4BXSV 4XTOA 2PEDA 1IUZA 1NPJA 2I20A 2AT9A 3HAQA 4UF7C 3WNJA 1PXSA 4IB4A 2VT4A 2FNWA 3RZEA 1I53A 3QBKA 4E9XA 1AQ8A 1TU2A 4HCFA 4BVNA 2LNLA 3PWHA 2A3TA 1EHKB 5AHYA 1SF5A 1WA1X 1X0I1 1HZXA 2BWDA 3VI0A 2Y69B 4L0PB 5AX0A 4W1TA 4WKXA 4GPOA 4BWTA 2VM3A 1JV6A 1A4CA 3ZBMA 5D4HA 2EI4A 3OE6A 5B6WA 4PAZA 1GS6X 1XJIA 2KS9A 3WIAA 4MFHA 1ZDQA 5I6NA 5I6KA 3OM3B 4EA3A 2Y04A 2AANA 2OJ1A 2VW6A 2DWTA 1BM1A 3TBCA 4QKTA 1QM8A 5H2IA 2XX0A 4HCIA 1VLXA 5ANHA 3GDCA 1HAWA 6PCYA 1NICA 4UANA 1M57B 2YAFA 3TASA 1W6LA 3IN2A 2YDOA 3RFMA 2JAFA 2BHFA 3H56A 2X88A 3NT0A 3FYIB 3PPSA 3UABA 4DP2X 1SJMA 1E67A 2YAMA 1S53A 2YCWA 3QJUB 3SBQA 3NS0A 1HAUA 3DTUB 3FU7A 1ID2A 4QLWA 2HX8A 5B7FA 1AACA 1C8RA 2I7OA 4KO5A 4A2DA 5B1AB 1NWPA 1BXAA 1ADWA 3C9LA 1J9SA 3IEAA 5FC9A 1IBYA 3REYA 1KDIA 1BRDA 4M3HA 1PZCA 4HWLA 1JZGA 1QLEB 4MD2A 3UTVA 2VM4A 4QIDA 2XYBA 1JGJA 4HYJA 5H2PA 1H68A 1BYPA 1AZRA 2P80D 3BVDB 3NP4A 3PCYA 3NY9A 2I85A 3CVBA 3G5WA 4A4MA 4BWBA 3NJNA 1GR7A 3FS9A 3UZAA 3QPKA 1CYWA 1JERA 1F88A 2ZOOA 5JJNA 2AVFA 5DHHA 2AZAA 1AAJA 3NJKA 4HHGA 1A3ZA 1AS6A 2I7SA 1UCQA 2RACA 5B7MA 4GRVA 3EF4A 3ZPRA 3T6VA 2CJ3A 5I5MA 2HPYA 3DKHA 1PMYA 1JV7A 1M56B 3X3BA 5H2HA 4JHUA 1J5DA 1M9WA 3NJLA 1TKWA 4GBRA 4PXFA 1BRXA 4RH4A 5JJEA 4E9TA 2YDVA 1B3IA 1GW0A 2YAQA 4DP7X 5H2KA 2HX9A 5AFAA 1IW6A 1ET8A 2I21A 1BYOA 5ITCA 4FBZA 4DP9X 3ABGA 5B6ZA 4JKVA 1L9RA 2KSYA 4G71B 4LDLA 2BZCA 4F2FA 2UXGA 1W8EA 3TBBA 3ZIYA 2ZONA 2F95A 2F93A 3QDCA 5EHFA 2AZUA 2XV0A 2JAGA 2Z55A 1IW9A 3DIVA 1PNCA 1TN5A 3OE0A 4BEZA 3BQVA 2PP7A 5I5IA 3WI9A 4YSPA 4AZUA 3T45A 1F56A 1M0LA 3PAUA 4KO9A 4KOBA 5B0WA 2PPAA 1GZMA 1OCZB 2J5WA 3QBIA 5A44A 4A66A 4FA7B 1AZUA 1WA2X 2J55A 1A4BA 1WA0X 5JJJA 1BQ5A 5PCYA 3ZDWA 3MBWB 4BWUA 3S3BB 5B2NA 4YVUA 2EINB 3ASNB 4W9ZA 4NAJA 4BWWA 2IH8A 4BEYA 1TEGA 4LDOA 3ODUA 2VN3A 1VGOA 5A45A 1KV7A 2GC7C 5B1JC 1N70A 1URIA 3T6ZA 3UGEA 2UXFA 5G28A 4A2FA 1GU8A 2XWZA 2EIMB 1BQKA 5G2CA 3AG1B 4E9YA 1X9RA 1R2NA 2IWKA 2PPDA 3N55A 2FQGA 5DYSA 1JOIA 1ZIBA 3V9EA 4HCGA 5B1KA 3C9MA 3WG7B 3IE9A 1JZJA 1NIBA 7PAZA 3NYAA 1NIDA 1BXVA 1P8UA 4J4QA 3NJJA 1P8HA 2WJLA 4ENZA 4MQSA 2I1XA 1F50A 3P0GA 1C3WA 1CUOA 3X1FA 4AX3A 1M0MA 2IDQA 5A7EA 1L9HA 1PZBA 4MD1A 1PLCA 2J4YA 1MG3C 2VMJA 4DKLA 1PLAA 3H4HA 3OD3A 2BZ7A 1V55B 3QQXA 2MRYA 5A8EA 4XTLA 1GUEA 4K5YA 3ZX1A 2H47C 5B3SB 2JKWA 4GP8B 3UTXA 4X32A 5B6XA 2MTAA 3NP3A 2Y01A 5I6LA 1GY2A 4X31A 2JXMA 4FPDA 2ZFEA 3EH3B 2XLLA 4FAAB 5KKHA 1OV8A 3UTYA 3ZEVA 6PAZA 2VSKB 1MZZA 2X87A 2Y03A 3HAOA 1RCYA 2HLEB 4G70B 4Q89A 1QNIA 1P8IA 3TU6A 1IC0A 1NWOA 4G72B 1BXUA 3GYRA 3T6XA 3NJHA 1NTDA 4UG2A 4BXVA 2GSMB 2IDSA 1ZDSA 4UAHA 2EIJB 2OCCB 2QPDB 1OCRB 1GY1A 4JR8A 3U25A 1KBVA 3SBRA 1XB6A 2BP8B 4QRYA 3AG3B 1CWQA 4DP0X 1L0MA 3NJGA 4WTQA 5AZUA 1W6WA 2NTUA 3C75A 1IBZA 1NPNA 2GB2A 1NIAA 1PCSA 3UONA 1KCWA 4HAKA 3OMIB 4A2EA 2XV2A 1PAZA 4DJHA 1M0KA 5D4IA 3FYEB 1SDDB 1E30A 4KNFA 3QBLA 1AZNA 1OE1A 2HZHA 3HANA 4LDEA 1X0SA 2M3GA 4X1HA 4XT3A 2YARA 3FU9A 2XV3A 3NJFA 3FQ1A 1FFTB 3FPXA 1KMEA 1AG0A 1J9TA 4KOCA 1ASQA 2TSAA 4CSZA 3QJSB 1A8ZA 1KDJA 1JZFA 4YSOA 3QAPA 3JTBA 5G2AA 4PXKA 3NSBA 1E65A 4OV0A 4YSRA 2PCFA 4YSCA 1Q5JA 5H2JA 4BV0A 2FWLB 2FTAA 1R84A 1AZBA 3FT0A 2CALA 1ILSA 4ZK8A 2VW4A 2HX7A 2R7EB 2PLTA 3QJTB 2IWFA 4P5RA 5B35A 3NY8A 2WO3B 2BO0A 2IAAC 1BEXA 5I6PA 2PPFA 2YQBA 2N0MA 3FPYA 4NERA 1L9TA 2YCXA 4AMIA 2IWEA 2XVBA 4NC3A 3PAVA 4K9JA 4AKQA 4QI1A 2FJSA 3PBLA 2FQDA 2FQEA 3PQRA 2BW4A 3OMNB 2YCYA 3FQYA 3SN6R 1A65A 3ERXA 4DP6X 1EZLA 1QHJA 2NRDA 2KSAA 3CDZB 1PZAA 2FQFA 4XT1A 5C1MA 4DP1X 1BQRA 1GS8A 1MZYA 3AW5A 4KNSA 4Q8BA 4IAQA 1TN0A 1N68A 2QDWA 1R1CA 2UX7A 3S8FB 2XX1A 3FQ2A 3CAPA 4KO6A 2UXTA 4YSTA 2BP8A 3WNIA 4NB7A 3DQBA 1MDAA 2OV0A 4CSPA 2DWSA 2XU9A 3CVCA 3UZCA 1V54B 5BR5A 4AMJA 4PCYA 4F2EA 3FU8A 1KG9A 2XUWA 3COCA 5AX1A 2XXFA 4JQ6A 3PDSA 2ZWNA 4KNUA 1L9SA 3SBPA 4AI7A 1SDDA 3VG9A 4EJ4A 5B6VA 2VW7A 3QJRB 4JHVA 3ASOB 5F7BA 2Q5BA 1PNDA 2KSBA 1PF3A 1KGBA 1AP9A 4A2GA 2AFNA 4GY4A 3D4SA 1WAEA 3ABLB 5DHGA 2WO2B 4G7SB 1O0AA 3DDLA 1AZCA 2CAKA 3V9CA 2IDUA 1RZPA 1F4ZA 1X0K1 1XB8A 3EMLA 1NZRA 4G7RB 5H2NA 2DYRB 2PP9A 3OE9A 2YCZA 3PLYA 4KLYA 1FBBA 1PLBA
chains in the Genus database with same CATH superfamily
4JHAH 5LDUA 3CODA 3NFPB 2Z92B 1JZIA 4GRMA 2J8UF 2C3WA 4L37A 4TSAH 4DUVA 1KULA 4J3BA 2I60L 3UJTL 2OCFD 4KTEL 3OAXA 2OX5B 1PX3A 3DXAB 1H8LA 3BFWA 3BZFA 3FN0H 3HUJF 1OCCB 1RPUA 4EXPX 4H40A 4RSVA 3H9YA 4DEPB 3VFGH 1E8ZA 3HE6D 5F0JB 3VYNA 1MPAL 1F90H 1YEIL 3FSOA 4JQIA 5FJGA 5INDA 1ZGLP 1BZOA 5HVFB 1KB5L 5F71A 1MCPL 3CU1A 4ZMLA 3CFMA 4IDLA 3TIEB 3ULVH 3C8KA 1PSKH 2KLSA 1PZDA 1J9CT 4AIZB 3QA3A 4ZO9A 2UX6A 5GHWH 5FKAA 2A5UA 2WLIA 4FG6C 2BMKB 4XTNA 4HFUH 4BA0A 5BJTA 3I84A 4FQQB 4N8PA 3WSQL 4OI8A 2YSSB 3CLFH 3F64A 3QDHA 3EYSL 4W9CC 1HWWA 2D4FA 4U6YA 5TH2A 2PABA 4XMTA 4PJIA 1QQDA 4RA3A 3C6LC 5T1KD 4LLMA 3TL5A 1RJYB 2YMTA 4YDLB 4NO0A 4G6AC 4POYA 4B9ZA 4FXLA 3QBGA 4PRDA 1YUHA 1UGKA 1SY6A 5AVRB 5SX4I 4MB3A 4J12A 2F08A 2O5XH 1E2WA 2HB0A 2J1YA 5A6MA 2ZPKL 1P53A 3DVIA 3F5WA 3TO2B 3D12B 1NINA 4HV8B 3U48A 1SYVB 4ELMA 5JIQA 4WTZA 1RULH 4PN6A 3TXAA 1UM5H 1XD1A 1U19A 2GQHA 1QLRB 2J71A 4WHTB 3WMQA 1PZUB 3VWJD 3QZWB 5CXPA 1BAGA 2YZ1A 5B6YA 4LRNH 4CC4C 5KVGE 1SVCP 1YSOA 3IJHB 4XMVA 3VQ1C 4GI6A 2J43A 3HZMA 3QG7H 1H3PL 2P42B 2XIIA 4GAAA 3VHZA 4MAYD 5L4MA 3QPQC 5ICUA 4Z77B 3RZCA 2R23B 4EI6A 1OALA 4L3FA 3TN0A 5DJ6A 4GKLA 3DX6A 1AZZC 3ULVC 1ZIAA 1MFMA 3I3DA 4Z7UA 2Y24A 3J07A 3T8MA 1J1PL 3FSZA 4QRUB 3ZR6A 3HMWL 4QJ3B 3EDKA 4QXVA 4U6HA 1N5YL 4M9OA 3V5KA 1NC2A 4R7DB 1MCRA 1O5PA 3QFGA 3OKMA 5JYLA 4PJDE 1NIEA 1SBSL 1TETL 5G4NA 4AQEA 4IJ3C 4U0QB 1UJ3C 3I50H 1ASOA 2NXZC 2FX9L 2CGYA 4MJIE 5J7CC 5ITBL 3UEZA 1XSKA 4ZMQA 2OBGA 4O00A 4L9LC 3LKSB 1LTXA 3MRLA 3V6OC 4UB0H 3L17A 4FKHA 4K2UL 4EI0A 2Y1VA 2D7PA 3I9PA 4CADA 3RDTB 2X4QB 4FMFA 5EEZA 4LOUD 1EDYA 4HJTA 1OT4A 3ZMNA 2VDQH 3FHAA 3RU8L 4JN1L 2FBJH 4YE0A 5LB1A 2XTLA 32C2B 3ZMRA 4HHWA 1V7NL 5IY5B 4H0LC 2Y02A 1UWXH 1G87A 2NYYC 4QGTA 2DDQH 1GHFL 4GNKB 4GAYB 3SJVA 3L9RB 3KPOA 2EUXA 4E41E 1Q94B 3NN8B 4MZ3A 4X5PA 1LN6A 2GUOB 1ETJA 4NBXB 3VGFA 3A4EA 3P3YA 5EFIB 3VI3F 1JPEA 5JHLL 3LPFA 1FC1A 3QQ9C 2CHZA 4D9RD 3HN3A 4L8BA 4LPXA 2OYLA 4U3XA 1G5AA 2Q7YA 2HRHA 2DWDA 4Y4FD 2JIXB 3KYAA 3BKYL 3KWUA 1AOHA 1HZHL 4MBRA 3ATDA 1RZJL 3OMZA 1MJUL 5D6CB 2P8MB 5I18L 1KCSH 3GK8L 5T5NG 3RBGA 1AQ8A 2ZOLB 2J12B 4RRPA 1KPUA 1FFOB 2Q8BL 2Q86A 3MROA 4G1MA 1CS6A 4TUJA 4PJCB 3PWHA 1MXGA 3MO1A 2WKOA 4J6IA 3VI0A 4NN7C 2VDMH 1WICA 3E6HB 4ODTH 4YDZA 1A4CA 4LK4A 3ZBMA 3ML9A 4OT1H 3DC0A 5D4HA 1IZJA 1M53A 3GSWB 4P5TC 2C4FU 3ZO0A 3BKCL 4XNQA 1RJLA 2KS9A 1T21A 1X5YA 3S5ZA 3P02A 5CEZD 1IBDA 2V5TA 4R3SB 3CSTA 5L4FA 4XN2A 4L3ED 5I75C 4O02B 3GUTB 1IT9L 2AQ2A 2NNFA 4PRNA 2XX0A 3QUZD 1WFMA 2Q3AA 3WMPA 1ZVSB 1A9VA 3V4VA 3HB3D 1U3HB 2XQYG 3MJ7A 3VM7A 3JTSB 4PS3A 2YRPA 4WIQA 3ZZSA 3PQYA 5IJKC 4R4FL 1TVDA 2WSKA 5AVQB 1KJ2A 1GYVA 1I4FB 5E4OA 3LEXA 2A38A 3C08L 3CFDA 1AKPA 1XF4B 5GRYA 2CBMA 2B1OA 4N8VA 3RWDB 4KO5A 5CJ8A 1NEZB 2JELH 5SX4H 1MHHA 1CFSA 3N5AA 3O0RL 4HUXA 2B1HL 3IMTA 3LZNA 4ABWA 4X4YA 3I6LE 2EIEA 1CJYA 1BRDA 1DVFB 3W56A 2CQVA 2DYPB 5IP4A 1QZ1A 2Q7AA 4JM2C 3SE3A 1YHPA 2N59A 4LLDB 3BVDB 2H7WA 1GAFL 4K55A 2FJGB 3MRPA 3JWNE 2EH8H 4YK4B 1J1XH 1N64H 1EHNA 1QSFA 2ENQA 3MV11 4A2LA 1INQA 3B5TA 5GGQL 1UCQA 3MBEC 3OKNB 3HR5A 2X1PA 3FRUA 3FT3A 2QVFB 2ED9A 1IKNC 2FWOA 4L1DA 4UV7L 4X9IA 3TC9A 5HHMB 3VSQA 1M9WA 3QIBD 4FLSA 5DJ8B 1QR4A 4KZDL 3IETB 1E4HA 1DQLL 5LO7A 1FNGB 1DQML 2J6WA 2CUMA 3DVGB 4H0GA 3RWGB 2ITCA 2KSYA 3O8XD 4YQXL 2NX5B 2JB6A 2W9EL 5EIIG 3WJMA 2G2RB 1UVQA 4LLWA 3KWVA 3P9MB 4UV4L 3D06A 2B1AH 2NMSA 4K8RD 3WNMA 1EANA 3AXHA 1XH2A 1EMTH 4Y2LA 4AZUA 1MW0A 1YJDH 5DZVA 5MEOA 1WIUA 4PJXE 4QCIB 1UCBH 5EDXA 4KXBA 5EG6C 5BZXA 3MTXA 4JHBA 4PJAF 4X4XA 5BXFA 5HBBA 4Q9QL 1RIHL 5JJJA 1R75A 4P4KA 3OPZH 4LCWB 3RFZC 4E41B 3BEVB 5GIRB 3DLQR 2W1NA 1OAQL 2OMZB 4BEYA 2UZXA 4JR9H 1FZJA 3L3OB 3TJPA 5IFAH 4NOFA 43C9A 2R1WB 3AAZA 4G43A 2HVKB 4LDEB 3BP6A 2H6UA 1OM3H 1JF5A 4N1CA 1B4LA 5C6PB 2FEEL 4X80H 3AG1B 1R3LB 2WB1A 4H1LB 2PXYB 4AYDC 3IXAB 4ZUWA 1NDGB 3TTYA 4DN3L 3TVMA 2CR3A 2LV4A 4WWPA 5D7IE 2IF7A 1ITBB 4ACPA 1FAKT 4M5SA 2CDFB 2Z93A 3X14B 2GAZA 4KTDH 3HE6A 3GSNH 3PGCB 5AW0B 4B95C 2UV3A 3NACH 1M0MA 1Q90A 3QI9D 2VDKB 3HFMH 1GJUA 3O3EB 4QRAA 3G6DL 4LIQH 1PTZA 1TCRB 1WP6A 3MZTA 1GUEA 2E46A 4XWGL 1HC1A 3QULB 4KVNL 3FT4A 2R2EA 1ZTXH 3OG4B 3P2DA 1UJTA 1DLFL 5I6LA 5HHOE 2YRLA 3L9EA 3BZEB 1OTSC 3SBWC 1R3JB 3FQTB 1CGUA 4GW4B 4OB5L 3HG5A 1ZA6A 4JFQA 4QTFA 1M05A 5DD0L 5E1AA 3EXJA 1P8IA 2XTJB 1LL1A 1ML0A 1VFAB 1MCCA 5DJAA 1NGYB 1UXWA 2B2XL 4JW3A 4OLUL 4Z18A 3UYRH 1CIDA 1K8DA 4JPIB 3WEBA 2ATKA 3PWNB 4XCCH 2GFBA 5C0FA 2KERA 5T1KA 3CFCH 1BFOA 3BGAA 1AD0A 1CWQA 3HG4A 5AZUA 1WD9A 2ZX6A 3C75A 1G1OA 3QWRD 4Z95L 4ZFFB 4LCCA 1QSEE 3OMIB 4UQIM 5B1CA 2OXHB 3QJFB 5I1IL 1HQRA 5E2VL 5K39A 3PUUA 2VR9A 2BNRB 1I8IA 2OMWA 4TNVK 1O5DT 4DEUA 3SYPA 1H5BA 5HSFA 3ZU8A 4ODBD 3N40F 3ARBC 3T4YB 4H26B 1NFDF 5HDQL 3KBPA 1O7SA 1USZA 5E99H 4I9XA 43CAB 4IRSC 2OFQA 3TV3L 1KDJA 5DFVC 3U46B 1PG7H 4HPYL 3VWJA 2BS8A 3VXRB 5J5EA 3L8QA 4CJ0A 2VT0A 2CR0A 4EKJA 5B3JE 3KG5A 4L8SA 2X2YA 1X5MA 5E6IC 2EJ1A 4O9HH 5CMAB 1JK9A 1JE6A 5D1QD 3CN1A 4GSDH 1Y6MR 2IAAC 3VGAB 4HS8H 4MAYA 4JZJC 4I77H 5TF1L 5LG6A 3AY4A 4XPBH 5IB1A 1HHJB 3WFZA 1G9MH 4KGJA 4TQ8A 2BP5M 2PW1A 3PAVA 3LS4H 1UCTA 1CLVA 5K9QI 3LB6D 1JI1A 5HHOD 4QT5B 3GS4A 3EZ8A 4WFED 5GXBB 3FQYA 3SN6R 5DHYA 5BVJB 4XRCB 1T5WB 5FGBA 3V6OE 3AM8C 2ZXAA 3L7FA 5FA3A 1HINH 5F7EL 4UTAL 5GS2D 3ZHLA 1FPTH 1FIEA 3JZ7A 4LHUG 4PIBA 4Q6KA 4MAUH 1CK0H 2QDWA 2YUVA 2A74C 2WLHA 5I19H 1TJXA 1YAZA 3Q3GB 1NAMA 2OV0A 4MMXB 1LEGA 4EZLA 2ADJB 4NIYE 5IB3B 1AO7D 1P1VA 1WFUA 2XUWA 5IESH 1A14H 1G0YR 2BRQA 2ZWNA 4LNRB 3SDXB 4AV0A 4DEWA 4YDMA 2V3EA 1KBGL 1J48A 1SDDA 4U7KA 3BFOA 4XMUA 2CLVA 1G4RA 3RJOA 2Z31C 5C08E 1FGVL 4MZ2A 1WAEA 4Y7MA 3ULUF 1OO2A 2W60A 2WO2B 5E8PB 2UWEB 2GSIA 1SLWA 1B0IA 1N5AB 1XB8A 3EMLA 5MEPB 4F91B 1BFVL 1JZ8A 3ULVD 5D1ZI 1QR1A 2PP9A 4NENA 2YCZA 3PLYA 1DBMH 1S51A 1S7WA 3PCYA 4IIQB 5DHVB 2NY6C 3PUCA 3W2DL 5D70H 1UT1A 2HFGH 2J57A 1R3IH 4JN2B 4CA4A 4A68A 4OM1H 4M5TA 4WI5A 2HN7B 1QKZH 3S5LG 2F15A 3C6LB 2ZUSA 4OCRH 3K6DA 5AB9A 5IFJA 3ASWA 2P5WB 4M6OH 5F8UA 2JJSC 2WUBL 4Y4FA 5EBWA 3HOGA 3GMNA 4BH7A 1A7QL 3CUPA 4ZPVA 1DUYA 5J6HB 2XRAH 2ADFH 4LARL 1P4IL 4FI8A 4QHMB 3MLXL 4TKWA 3WIHL 4RX4A 5CCHE 5CLXA 3X3CA 1O6SA 3LHPH 2HJLA 4PYGA 4I13B 1T5XA 5DLLA 2O5YH 2YK1L 3IJ8A 5FYJE 4F7KA 3KEDA 3GGWA 3BSGA 1J8HA 4ZMYA 1FA4A 1T1YA 3GB7B 2NYYD 1M1SA 3MYZA 5GS0H 3SYCA 2FR4B 5D2NC 4O51B 1GPOL 4L3EA 2BLFA 3W39B 5A2KH 3QUZA 1AOZA 4UM9D 3DO4A 5I0ZA 1HILB 3D0VA 3Q8FA 2C7UA 4Q58C 4HLEA 3ZKNC 1GVIA 4BFKA 4KKAD 3VH8B 1PGRB 5C08D 3UMNA 1BZ9B 3ULUH 5C0BE 3ZN6A 4MCYB 2XZAH 4U1NA 3ARSA 4OZGE 4K3EH 5LCVA 3GBLA 2I32A 4EZKA 5JW4R 5BW7A 4PS4H 4TULL 4HZ1A 4U1HA 4XMZA 2W80C 1AT9A 3HC3L 4IJ3B 5HDWA 3B9KD 1SJEB 1RFDL 2E7BA 3NSFA 3MOAL 4NNYA 1HU8A 5JIPA 1W15A 4PJ7B 2WVVB 5J1AB 1FO0B 3GSOB 4KI5F 3ZUNC 1COBA 1M2VB 1A6VH 5GZNC 4WI0A 3ZIMA 4MVBC 4OBRA 4Y9HA 2YSTA 2ZWKA 3CK0L 1MFNA 2IBBA 5IV2A 1NAKH 4LXFA 4A2HA 3NPSC 3EJJX 5I1LB 1VJMA 4YSDA 5E5LA 4WEEA 4BFJA 5D72L 2A6JA 3IWUA 3DECA 3QWOA 4WW2F 1UYWH 1AR2A 3IT8D 3MRQB 3QIBA 4MD0A 4AG4L 4AQAB 4JZOB 3B9EA 5ACZB 2Z64C 2VLKE 2BRRH 4DPAX 5KYWA 3C6EA 3ARGC 1MFEH 1XHHA 3MJ8B 1JPSH 3QEUB 3HS8A 3O8XA 3FUEA 4XPAL 4O2FB 5GRUL 4PJ9B 4ZUSA 3GLDA 3B2MA 2FYYA 4UYQA 1AANA 4F8NA 5DMIH 5BZDA 4OZIF 1HHGA 3PWUB 1FSKC 2OK0H 4YO0B 4X5WA 3W11D 1LP9E 2NY5C 3AADB 3R1GH 1A7RL 5J89A 4V11A 4P46D 3OKYA 3PGFH 5DD5H 1OF0A 2V17L 3K72B 4P2CG 1FNAA 4BV1A 2OJZL 4MYWB 3KYOB 4GFXA 3MV01 2PWEA 2CWRA 4MZIA 2E9WA 4NQXA 3MLZL 2F8OA 3P0YH 2NDFA 3S2AA 1RMFL 2X6VA 3UAJD 4XODA 3OHXA 4AM0B 4YUEL 3VXOA 4JQIL 5AWNH 3F6LA 4I5BB 4KQ4H 1YYML 1EEYB 3MBED 4N87A 4NCC2 2WQ8A 1M7DB 4E9RA 4KRMB 3FU3A 3OKOA 2X1OA 2L3BA 4NN7B 4TLSA 5MEQB 1QASA 3NCXA 4DPRA 5SWSB 5EA0H 1MJJA 4LOEA 1DBBL 2E9JA 2GY5A 3FCSB 4Z5RB 1JHLL 5IW1A 3PV6A 5F7NC 3VI4A 4YBQC 1P0SE 3LRLA 4GYCA 1OAYL 2Z91B 3A47A 4TXVB 5T1DH 5ES4B 4MCMA 3TPUB 5I75B 4I3RH 4DKFH 3D1MC 3QI9A 4NSKB 4NGHL 2CD0A 2F53E 3K6FA 5E2TH 2YPVA 2ZG1A 4BFIA 1DFBH 1FAIL 2WZAA 3TEXA 2ICWB 1A47A 2WXGA 5KUKA 4FXGA 4G2AA 4J3VA 3VFMA 3WXVL 1IUZA 1NPJA 1H8SA 2FEDC 3WNJA 3TURA 1KYOK 4IB4A 1WG3A 3IDGA 1I7UB 1SY6L 2C26A 3IFLL 2XBDA 3CFKA 3N9GL 4L05A 1OPGL 4CN4A 1ZMYA 3KJ6H 3UBXA 4ERSL 4WO4C 3QUMH 1A4JA 4BVNA 5J13B 2MPAL 2IPTH 2W9DH 4YAQA 4OTXL 1KG0A 3LQAH 5BOJA 3VACA 4WFGE 3VU1A 4K7PX 4JM2B 3S36X 1T2XA 2OAAA 1HH9B 4O2EA 5C0EB 3WIAA 3LKOB 3MA7A 4P23D 5HY9B 3KHQA 3P11L 3EJTA 4W9EC 3QWRA 5IVZA 4JFDA 4FJZA 4JDZA 3T0XA 3I6GA 3VFOB 4K07A 3SPHA 4HXAL 1GOFA 1GJWA 3KDMA 1HAWA 4NQDD 5CBEB 3C8DA 2E9GA 3VNZA 3GUFA 2FLBT 3R8BB 2F74B 4OIFA 4L3AA 3UJJH 4OQ1A 1ZHLB 1MY7A 1Y0LA 3QE5A 3OAWA 1K3IA 4PJ8B 5AL0A 3UG3A 5C2BL 4R0LC 1EJOH 2P8PB 2H26B 1J9SA 5EU5B 1IBYA 3L4ZA 1MWAB 3TO4C 3KYNA 1GTNA 5GSRA 2OLDA 1HXMA 4YHYB 5D1QA 3PHQA 1HCZA 2LW3A 1H68A 1XGYL 4U2YA 4IBLT 1E90A 3FU0A 5KAQG 4IBUA 3G5WA 1CLYL 2X5PA 1TPXC 1BIHA 1FH2A 3FS9A 5E23A 3UO8B 1CYWA 5A6IA 5B38A 1GMIA 1CVRA 5KYXB 2OL3B 1AS6A 5DD3H 3MV7B 1XWVA 2F7OA 3GHEH 2ICES 4PJAE 5I5MA 1ZV5A 3SDCD 1KB3A 2EXTA 1UOKA 2V5RA 4CU7A 4QRRB 4FP8H 4YWGH 3ZTNH 4P2OB 3IKCA 2W91A 3DOSA 4HJJL 4YHPB 4BZYA 2V33A 1KGWA 3TJEH 3B4NA 4L3CA 4W81A 1F42A 4FQCH 1VACB 3HMXH 4JMXA 1BVNT 4H8PA 3I9GL 3TBBA 4MS8D 2MNWA 3LNGA 4L0YA 5I1AB 4MMZA 3SDDC 2R2CA 1RZFH 4OAWB 1AO7A 1U8JB 3JWOH 3IS0X 3WI9A 4CRPA 3DGGA 4JG1L 5IOPB 4Q0XH 1M0LA 5D7SL 4HMCA 4LSSL 4YL9A 5BZZA 1I1YB 1S7RA 2UYLB 1GCYA 4J5VA 1KLGB 1KPRA 1QFWM 3A24A 3HI1A 4IRJA 2IBGA 4HGKC 3S3PA 5D2LF 5EOCL 4JGMA 1CLZL 4M00A 2J55A 1IM9B 1Q9KA 3ZDWA 2YFOA 5CLWA 1LE5B 1FVCA 3DPBB 1EAOA 4BWWA 1Z2KA 2YUXA 4N2OA 3L5XH 4LDOA 4JO4L 3M1CA 4MJHA 3T6ZA 5I8EA 5EZOL 2W81C 4E5XA 1HCFX 4XN9A 5F89B 3QWNA 4AXWB 3DHPA 3V0FA 3DBXA 1V7MH 1K6QL 2WCGA 1A22B 1ULVA 4JZNA 3EYUL 1ADQH 4OVVA 2AF2A 3JVFC 1L0QA 3HZYB 1E4XI 5EC2A 3FMGL 5EZLA 5B8CC 2A1WL 4N8CL 3W9EB 3ZDYE 5EO9B 1VADB 2R0WL 2ZYSA 4B7IA 1N19A 4B3VA 4U49A 2VOTA 3BUPA 5IBUG 3MOBL 5D2NE 1MW2A 3L4WA 2ZKMX 5EU7C 3QR1A 1MWOA 4KKLC 2VZ1A 3ARBB 4XVJL 3V4VL 3ZTDC 5KSAC 4GAJH 1OZTG 3PABA 1DL7H 4FPDA 3SKUD 3WNOA 1KJ2L 2J8UA 2DEYX 3DV4B 1GYWA 4XCNB 5JLZB 2MQGA 1IVLA 1JV5B 2Z31D 1BG9A 3OKDB 1V5JA 4ANKA 3HUJA 2VN4A 4WSGA 2AEPH 2VE6A 3WXWL 1ES0B 2WLMA 4BK5A 3VU2A 4NO5B 3E1F1 4NHCH 2DQCL 4UM9A 4DOHB 3ECQA 4H2AA 4ODHL 4G42A 1JHKL 3SOBH 4F57H 4XN8A 3HLAB 1MHCB 3BE1H 3QNZB 1IC5L 5DRWB 3OWRA 4DJHA 5C97A 1M0KA 1U93A 1X7QB 3FYEB 4MAZA 1JF6A 3I9IA 3TBWB 4AEHL 3HTLX 4LQFH 2RR3A 4Q9RH 3BAEL 1R3KA 3HC0B 2G0LA 3P0VH 2ZWYA 1KY7A 1JP5A 4PSPA 1OP3H 3Q9QA 3X3FL 2VNCA 3BGFC 4FNLH 5DMKB 2DZEA 1C16A 3B9KA 3TA3C 3QAPA 4PJCF 2PW2B 4NN6C 3HN8A 3L3DA 4FL4B 1E65A 2F5BH 3QPXH 2ZXGA 3NIFE 5LGJA 1QBLL 3STBA 4YSCA 3NA4A 1TFHA 2FTAA 3KR3L 4JFEE 2YEQA 1SXCA 2ZX5A 4OKVB 2VW4A 2HX7A 5E2JA 4ZS6D 2R7EB 3QJTB 2Z6FA 2WO3B 4OLEA 4QHKJ 5DYOB 3AQXA 1HIMH 3K91A 4GO8A 1AIFA 3BJ91 1IKFL 5HHXH 2JI1A 3EDDA 5EPMA 1QBML 4K9JA 2ICWJ 2WXHA 4QOKA 1XX9C 4A7VA 4AIOA 2QVKA 1IGIH 3WNPA 2BERA 2JSFA 3GBNL 4UILL 3RILA 5HI3C 1YEHL 1U3NA 1UM6L 4ZFZB 2O26U 4G6KH 4PR5B 4DIXA 1PZAA 3ECBA 4PV9B 4BSJA 3K2UL 4YGVA 3BQUA 2FJFA 2IVFC 4YHOL 3CZLA 1R1CA 1OANA 3CAPA 4Y4HC 3O9WC 4H0HB 4LEXH 4GB9A 1X44A 3ARDA 1YEGH 5HYJE 4P46A 2HPOA 5DDHB 2G2NA 1EUUA 3ETSA 3DUSB 4PGEA 1KG9A 1QAWA 1OAKH 2VSDA 2Y1YA 1IFHL 5B6VA 2IH1A 3V6ZB 4MCZA 4WDIA 3BPNB 2HKHH 3G5ZB 3Q44A 4HBCL 5AZ2H 3UAJA 1I9RL 2HT2D 4PB0H 1F6FB 4S1DC 2P8LA 1F3JA 3QUKA 5DZPA 1G1CA 1AP9A 4KK8D 1WYJA 3D4SA 3K8MA 5E2UH 5F93C 1AQDA 4ZTOH 5E1HB 4IOFC 5I30L 2BFGA 1MIML 3ZDYB 3UPRA 2NY1C 1C7TA 4HHGA 4PRPD 1TQCB 1NCBL 2HFFB 1NCCH 1R3HA 1RK1B 1QX1A 3FCUB 3VQMA 3LPOA 1TXKA 2F5AH 5IHHA 4BSWB 1ZT7A 2VDPB 3LZFH 3KYKH 1O6TA 4K9EH 5GS0D 3RWHA 5MERB 3L08A 4G5AA 2Y6SD 5F9OH 4HW6A 3GSRA 1HZKA 4KVCH 3RYMA 3ZMEA 1PX8A 2JLPA 2YGNA 3GMQB 4I3SL 4XH2B 3ESMA 3ESOA 5CINL 3AZUA 2V2TA 1KF9B 3G7TA 4RIRB 1P84K 3WUWG 4DGYH 4N9GA 3ULUD 4U7MA 4QY8A 2XWJA 4HDIA 3ZDZE 4AQOA 4QHUB 5AYQA 4GG6E 2ZCZA 2BNUB 1G4MA 3S88H 3NGBB 2EIZB 1FG9C 5DUML 1S9YB 3MODH 5B34A 1L7TH 1JGUH 1JGLL 3WS3B 3L5WA 4X5LA 4KZCA 1IGML 3VI3A 1B0RA 3HASA 2FWSA 4KDVA 2X4PA 3GO1H 1QZNA 3LKQB 5F9AC 4P23A 5D1XC 5HHPB 1ZGLB 2HJFB 3NSCA 3QDGE 3DVNA 4G6FB 2SODB 2GTWA 4L4TB 2KT6A 3UFIA 5KG9A 4NQDA 4M29A 4YBQD 1DVZA 2CIIA 2VR5A 4Y4KD 5C0ND 3CC5B 2ZJSL 3ABMB 3NIFB 1TZAA 2D03H 1YQ2A 2DMBA 1YECL 2DQIH 3RVXC 1TENA 5DHDA 5DA0B 5C8JB 3P54A 4TSCH 5K59F 3EYOB 3MKGA 4Y8DC 1G0XA 4C56D 1IL1A 1BQHG 3IDIB 4EO5A 4X0KA 4GG8A 2FEDD 4U1LA 3MX0B 1DJWA 5D9SB 1DVUA 4MQ7B 1Q9OA 5B39B 4NWTL 4BGDA 3LXAA 1LJMA 2UXVA 3WIIH 2C9QA 3UADA 3QFDB 4U4BA 2X6AA 4FTVE 2LU5A 4XN1A 4HUVA 4DK6A 4M7LT 4IMLB 3S36L 1FDLL 3E0GA 3TV8A 4BUQA 2KKQA 2ESVD 1NAML 5FUZL 1FNSH 3H42L 3BAKA 3H3PH 5F96L 1XH3B 2WYIA 2OYPA 5DJDB 4ZYKB 2DRUA 3AT9A 3DX3A 1FQ9C 3T0VA 3LMJL 1VJSA 4NJAH 3SDCA 3BVUA 4KK9D 4ODVL 3L1GA 3BWUC 1KYUA 3UO1H 3UZEC 1KXHA 5MEND 3UTTE 5C6TH 4P5KA 1T66C 4JKNA 1Z5YD 3ZDXE 2L7UA 1BBDH 1YNTB 5FOBA 4H1LH 2LFGA 3AG2B 2X72A 4XP4L 2J7LA 3FF7A 4AKOA 4G1EA 4J7RA 1TU2B 2EYRB 3EO0A 4WUKH 3QUXC 4NQEE 4HFWB 5A43C 2P26A 1BBJA 1A2YA 1A6WH 4KI5D 3QQ3B 1E5CA 1TJIH 1JYNA 2EDOA 2RQ8A 3KWWA 2FO1A 3RIAK 3VWKB 3MLUL 4X6DF 2VDKH 3WIFB 1I3GL 1U8LB 2ZSWB 3U9PL 4CVZB 1AGCA 2B3IA 2HRGA 3A6BH 1TFPA 5I5RA 1J05A 1S54A 3W9DA 1C5DA 1KN2H 5D1ZD 1CF8H 3K5SA 3KPRE 2YXMA 4L8DA 4NJ9L 4C47A 1WFNA 2EEFA 1VENA 3O2WL 2VZOA 1J88A 2SEBB 1I1CA 2YQ2A 1A6ZB 3ISYA 3SE9H 4JFZH 5LBSA 1KEMH 2AW2A 3WJLA 1E5BA 3L2NA 2X7LB 4JCWA 3SB3A 2NYZA 3IMRA 1JG9A 1PYWA 3V0AC 3D85B 2XOTA 4Z7NE 2JKTM 5H2MA 3P4MB 2V0AA 5C86A 5C0JB 3AM8A 2X09A 3T77B 3D30A 3WFBL 2E6PA 4YXHL 5LNDA 3SPJA 1DTUA 2APTA 2AV1A 4S1QL 5EU7E 3O6FC 1FJ1B 1FBKA 4AC4A 3L45A 1IBBA 4N2HA 3KLQA 1OGAB 2AQSA 3CFJB 3V95A 1QKOA 5CEZL 4BCZA 4RZCB 3IMSA 4AGOA 2BVQA 5D7JB 3GINA 1S5HB 3QGVA 3SDDD 3SDXF 1CD1A 3U9UA 1CXEA 3UTTD 1Z6JT 5IVXB 3ZZLA 3D0LA 4FNRA 4I2XA 4KGLA 2AT9A 4XBPA 2GK0A 4HGWA 4CJ1A 1M3JA 4I0PB 2FNWA 2FRGP 2OR9H 3I3EA 3D2UD 2F7QA 4N0FA 1OW0A 1HYSD 2UWEF 3UTQB 2Z31A 3VE0A 4WUUD 4FQIL 5LCVL 2G5RA 2APVA 3HAEG 3OGCA 3GMMB 1AFVL 5LWYH 1XGQA 1RZGA 4UIKL 4B9CA 4FLHA 4AVKA 1IEBB 4NPKA 3OAYK 2A77H 3DRTB 4MD4B 2RQEA 2E7LA 2A0LD 3HRZC 4MFHA 4KJYB 3S96B 3KPRD 4EOWL 1I8LC 3INUH 1KTBA 5GGUA 3NTCL 4MDRA 5DUBB 3RPKA 1KT2B 5SX5K 3BUQA 5KYYB 1MH5B 5ANHA 3TCTA 3QXAB 1ZLUK 3VM5A 1HHKB 1ED3B 2WMPB 4H7VA 1WD8A 2YDOA 2FECL 3BO8A 4OLZL 3GMOB 4PW4A 5KYUB 2P43B 1TITA 2IPKA 2G3ZA 3GMPA 2WXPA 4FTVB 4R7XA 3RA7H 1KTDB 1YMHB 4DP2X 3GIZH 4WLCA 1Z9PA 2VDRL 3W81A 1T2QH 3KVDD 1I8AA 5EU3B 1J10A 4KZ0A 3W0WD 1OB1B 3KJ4B 4TVPD 1WV7T 3NCEB 2JVUA 3I02A 4X7TA 4F93B 1RUQH 4K94L 4RNRA 2CRYA 3S37X 3JVGC 1A3RH 2XYBA 1PY4A 2Q6WB 1CI5A 3VFWB 3V4PH 3ZDXB 1IRAY 3M1BB 4K8RL 5EEXA 4PGDA 5C09E 4BWBA 1BOGB 1S7SB 4X98A 3QPKA 5K9JL 4TNGA 3VSUA 2B4CL 1MJ7H 2AVFA 4LHJB 2BJML 4NQEB 1W80A 1A3ZA 3H2WA 3QORC 3FO1B 1NFDA 1UB6A 1JV7A 4QHKI 4B53A 4GFTB 4RH4A 5T5NF 5T1MA 1IJ9A 3DV6A 4M8QB 2OTUA 3CDGB 1NGPL 3QHZH 4JB9L 4KQ3H 3VSVA 1IBGH 5TE7H 1KXTA 1FLRH 1IW6A 2ICWI 3VFRB 4PBDA 1RV6X 3O11A 1TZGH 2JXMB 3LRSA 4JKVA 2H2PC 3CU7A 4HKZA 2VDLH 2F93A 2WN3A 3CVIH 4PJ7F 2IG2H 4XMLL 3BP5A 4NZUL 4X42A 3V9FA 2IGTA 3RJDA 1BHGA 4ZMAT 1IU1A 4KOBA 4Z7NB 1KCKA 3VXSB 1P6AB 1GZMA 1OCZB 4S2SB 1J0IA 1FZMA 1CL7I 4NT6B 1ITCA 2GEEA 4PRHD 4N2AA 3D69B 3JV4A 3L7EB 1MQKH 4LE8A 3MBWB 3S3BB 3ES6B 4NAJA 2IH8A 4PLJD 3UEQA 5DQDH 4XPGH 1CU4L 4XO9A 3H3KA 1LXMA 4HS6A 1VRSA 5E9AA 3NCJH 1MCWW 5SWQA 3LH2H 4PRPA 2LOEA 5F7WC 1X9RA 1DO6A 3N55A 3DO3A 5DYSA 1JOIA 4Q2ZB 5JXEC 1T7YA 3FTGA 4AGPA 2OR8A 2DMCA 3Q5YA 4X5QA 1P8UA 4J4QA 3WFDH 3O9WD 1JWMB 4J8RA 1BEYL 4DZBB 4Z3HA 3ENEA 1PLCA 4OIIH 3WO4C 2VMJA 4Z7VB 2ICEB 2XZCH 4FA6A 5DJYB 5D1XE 5JDSA 4AW7A 2G0KA 1X3DA 4URTB 2IO5A 2WVUA 1TKWB 1DEDA 4ENEC 5IJDC 8CGTA 2Y01A 2IJ0C 3ZY7A 4FULA 4UIMB 4P3WA 1BM3H 3EH3B 4XP9H 1HHHB 4S1DD 1KYOJ 1TO4A 1IC7H 2VSKB 4I3GA 1RAMA 3IVKA 3FXIC 4M1CD 3GMLA 4DCQA 1XXDC 4XVSL 3FUDA 3FKUS 4GXVL 4P0DA 1IC0A 1BXUA 2WINA 4N90D 5C1MB 2ED6A 1B4JH 1M4KA 3GS7A 5A16A 3PWJB 5I1CL 2NY1D 3FCBA 3U25A 1M1XA 3OLDA 4HAGA 1ZANL 2V2WA 2ZXCA 5KVEL 2BP8B 5I66A 5TE6H 3NFSL 2PO6B 2MWCA 4LSPH 3LVTA 1KJVB 4Y4KA 5E2WH 5L88H 4DKEL 3RDTD 1KCWA 4UZSA 35C8L 1ANUA 3WENA 3H0TA 3HS0C 5DR5H 3FB6B 4PWGA 4C56A 1G7HB 4WV1C 3WNLA 1KCUH 1GC1H 3FUJA 3SIKA 5C09B 4F9LC 3V8CA 1XVSA 5CLYA 4QTHA 1XF3B 2X4SB 3ARFA 4W9HC 4ZFOB 4OV0A 3JQOB 3EOBB 2GTZA 1ZT4A 2VQTA 1A0QL 1Q5JA 2MJWA 5DQJA 1AZBA 4JHAL 4XN5A 2ESVA 1ILSA 2XPGA 3NZ8A 3GSXA 2BSTA 2IAMB 5F7FA 4OZHF 1MCKA 1T1ZA 2H3NB 2PTTB 4F9PC 1EAJA 1MNUH 3QDJA 4F7CA 4OFDA 4U1IB 3P3TA 4K0OA 3FN0L 3VRLF 3DI2B 2DBJA 4PU2A 1R46A 1CTMA 1PKQE 5DRNA 3UTZB 4L1TA 2JIXD 1CXHA 2JLLA 4ZW6A 1NGWB 2VLLA 3GI9H 3IRPX 3WBDA 1DO5A 2PF6A 4LLYA 5MENA 3CZSA 2Y36H 3VFGL 4AC2A 3VXTA 3NIDB 1F90L 2Y7QB 4N0RA 4OV5B 2COVD 3OL2A 3ERXA 2MEJB 4YZFE 1TJHH 1U91A 5ECGA 3POCA 1X6LA 5IT2L 2VMDA 3ULVL 4QF1A 1PSKL 3UYPA 5HI5C 1MZYA 2JKLA 5JR1H 4ZUUA 2JTDA 5GHWL 5FYLE 1KNOB 1QHOA 1UD8A 3D39E 1U92B 3EBAA 4HFUL 1NBCA 1OARH 2HTKC 2AI0H 4TQEH 5CCJA 3CLFL 4N0UE 3C60A 3ARVA 2VISB 4WTZG 2G2PA 4F2EA 5LG1A 5D1ZA 2VC2H 3MV9E 3NCMA 2XXFA 3TBYA 4WW2A 2NW2A 3ELQA 4KNUA 3PIQA 1LLAA 1U3HD 1AGDB 4OGAC 4C59B 3T04D 4IJTA 2FL5B 1FBIH 2WXFA 2J1KA 1H9DA 3L16A 1GC1C 1D5ZB 4XNAA 2NY0C 3Q8AA 1YRKA 3W82A 5JW3H 1FNLA 1EX0A 4JRWA 1CFVH 5AAWC 1G7PA 2C1OA 2MTPA 3QUMA 5TDOB 1GL4B 1X0K1 4JDEB 4OZIA 3EJUA 1DUZB 2R1YB 4U6XA 3NA9H 1CL7H 1T66D 5DZOA 3R19A 1DVFD 1RULL 3MGTB 1EGJH 2DYPD 4XO5A 1E7UA 5DWUL 1ASPA 1UM5L 2IANA 3CMOH 4DUWA 2G60H 1G6RB 5FECA 3SOTA 1WFJA 3FQ4A 2VLME 3SPVB 4LRNL 3ZPQA 2G5BB 3EHBB 4IRZH 1R24B 2H9GA 3M86A 4N2FA 5DURB 1XAUA 1DZ0A 1QSVA 3C5SA 3KCWA 5DEGA 2MCG1 3ZYIA 3QR2A 1MVFA 2LU7A 1IO4C 4CSSA 2ZF9A 3RX9A 3SCMC 1QYGH 2QV4A 3D2UA 5DC0A 2OMVB 3CFBA 4PJEB 3FT1A 4WUUA 2PCXA 3MREB 3LNFA 3P40A 2WXOA 2YQ3A 2Z4QA 2NX5D 2Z1KA 5L0QC 3LRMA 4GUOA 4WFHE 1GS7A 1RY7B 4JCLA 4NKQB 4Y2OA 1CFNA 5JPNA 4F2MA 3MV9D 4UQEA 3MLSH 3FSAA 3I50L 1P5UC 2QZQA 1ETZB 1JXGA 1A1MB 2OZ4H 3O6FD 1LMIA 1U3YA 3FB8B 3HG0A 2QV2A 2VUYA 5F0LB 1ZAGA 3HBGA 4UB0L 4MA7H 2YR3A 4LCWD 3VXUE 3SGDH 3STZB 1M3IA 1A1OA 3W0WA 2FBJL 2BNQD 3GF8A 4MD5A 4F92B 1O9WA 3OZ9H 3NFPA 3O4LB 1YNLH 4K5LA 3HAEB 5FO8B 1PKQB 3QAKA 5A2JH 2CBPA 3WU1A 2GPZA 5EU6E 3HMXA 5DK2B 1XEDA 2DDQL 2Q9OA 3T3ME 4GW1A 2F8IA 3M17B 3NCFB 4S1SH 1RI8A 9PCYA 1OAXH 4UT9A 1Q38A 5PAZA 2DIEA 2W8CA 2W9LA 3A22A 4RRPM 5T3ZE 2YS4A 2ZCLH 3O2VH 4NCDA 3WLWC 3HJ0A 3BCFA 3DX2A 3OSKA 4KRNA 3ZYOA 3VG9C 3TIEA 4AJ0A 1FZKB 1CDCA 2LGNA 3T4AC 4CAGA 2IDCA 1DJXA 1ET7A 5KANG 4AIZA 1JZ7A 1J9RA 3U1SH 3H4FA 1M7XA 3FONB 2BMKA 1KCSL 5TQ0H 3U2JA 4FQQA 4RMVA 3P2TA 2W5PA 3D3VE 4WVRA 5AKRA 2FT7A 1UXSB 1NSNH 1B4TA 3C2AL 2VDML 5BR2A 1ADQA 1NANI 4ODTL 4GMTH 1NIFA 1NCAH 2HFEB 4OT1L 1S3KH 1U8HB 4N8VG 4FERA 3CZNA 2FZ3B 5IFHL 4N1EA 4Y5XB 3SSGA 2FT8A 3VA2C 5AW7B 4PRHA 1ZD6A 2ZWLT 5D7LE 2HWZH 1XL6A 3BZ4B 1BP3B 1CDUA 4GIPD 2BNRD 4Y2NA 3TO2A 5D55A 5E7FA 2CO2A 4NP4H 1SYVA 4JKMA 4MBSA 4ALAL 4HG4K 1C5CH 2OYMA 4PTUA 1JK8A 4TNWK 1YG9A 4WHTA 3GXTA 4WJG3 1H3WM 3QZWA 5EU6D 4APXB 1AY1H 5IJVB 3MMEB 4R5TA 2XI9A 3E1ZA 2B08A 3WKYA 5GJTH 2AXFA 4ANXA 3QEQB 2CIKA 4A7TA 2JELL 2ARJA 3T0AA 3HRZB 4U05A 4HWNA 3KM2A 3ZQXA 2NUPB 3ZUCA 3FFOA 5CN1A 5GS1C 5HYQA 1UQSB 5BZWB 2H2PD 3AQYA 3CZFA 4Z77A 2R23A 4H5SB 5D2LA 1F3DJ 4Y2DC 5EZIL 2ZTBA 1EFQA 4LPTA 4FMKA 3TFKC 3VVWA 2Q1EA 2EH8L 4HUWB 1J1XL 1N64L 3LDBB 5DC4B 4QRUA 1DQQB 4HC1H 2QSTA 4ZDHB 3TCXA 2BX5A 1KIPB 3TF7C 2YUWA 4R7DA 4H8VA 3MUUA 4F8OA 1BYNA 1P84J 1B3JA 3ET9F 5BOPA 1SF5A 2XG5A 5TE4H 1JV2B 3HJEA 4XNZB 5CBAB 3ME0A 3GNMH 4HCRH 4XOEA 4Y5YB 5JNYB 5AALA 2R9HD 1X4XA 3LKSA 2BP3A 5AB1A 4MKTA 4X9GA 1MCWM 2N1TE 1KIQB 3D7PA 5EBLB 2P44B 4XVOA 4YNYB 4H20H 2CUIA 4CVWA 4HUNB 3FH5A 5E9DE 2B1AL 5EOTB 3QHFL 2X4QA 1ZV9A 3RDTA 1BLNB 5JXED 3OKLA 3QORB 4FHJA 1YJDL 4NQCD 32C2A 2B0SL 4U0RC 1KCLA 3HN5A 1QNZH 1UCBL 1SYSB 3FYIB 5DHMC 2H2SC 5KZCB 2YCWA 2AXJA 3IFPB 3MFFB 3OPZL 4ZOBA 3U0TB 1B6UA 3NS0A 1NCIA 1KWGA 2C1PB 2CDEB 3AQZA 2DKSA 1C8RA 1QUPA 3EYVB 3P9LA 4JR9L 4FABL 2ETWA 3BUYA 5IFAL 4LLQB 1ZOXA 4ENED 4Z7AA 1OM3L 3LZPA 5FGCE 5JOPE 5EFIA 4X80L 4Y5VC 3RGVB 1F97A 4XBEH 3D18B 1ZA3B 5AG8A 2D31B 2VERA 4YHLH 3UXFA 2P5WD 4MJJA 4R26H 3S3SA 1WAAE 3NJNA 1GR7A 2JIXA 3GBEA 3LRHA 3V7AG 4B9GA 2AZAA 2XA3A 2VITB 4MHHI 4KTDL 5D6CA 3D3VB 3GSNL 3JBG7 3NACL 4UDUB 1A6TA 2Y1ZA 1A9EB 3VSTA 5ABDE 3HFML 3LNHA 1AE6H 1JNHA 1FFOA 4LIQL 4OF7A 3BP7B 4PJCA 4GBRA 4UQAA 2V37A 3HW7A 4GSRA 5ALBL 5EUOE 2ZICA 4X8GA 4M43H 4HEPA 1ZTXL 3E6HA 3BH9A 4HKJB 4QTIH 4XC1H 1HEJC 3TYGH 1CDYA 3GSWA 1KBPA 5D7LB 1L5GA 2VDPH 5CCGE 4PW3A 3WDJA 1Q9WA 1E4KC 1SDAB 5GGSB 4XBMA 3ZIYA 2EDYA 3Q5TA 2D0GA 1XF1A 4PJFE 3FQWB 5E9DD 5KVDL 4XVUC 1JGEB 1HL4A 4O02A 3GUTA 4DFIA 3F7KA 2H1PL 2A7BA 1M6OB 4UOQA 1ZVSA 3UYRL 4XCCL 1W72H 4Z7QE 5I0WA 3K2KA 1U3HA 4EN3B 3CFCL 2X1XR 3JTSA 3WO4B 4ZW3A 3ZPDA 2APFA 3GC3A 3BJLA 1HKFA 1I4FA 5I82A 3WTWA 2VLRB 4ZUTB 2HJKB 4LB8A 1BQLH 5HGHB 4S1RH 3O3AB 3QP3A 4U7SA 3RWDA 1KWKA 1NEZA 2XKSA 2XKUA 2DB8A 4R8WH 4LCUB 1YNTF 1AGBB 3C6SB 1DVFA 1SN2A 2OMUB 2DYPA 1UXLA 1TQWA 5E99L 4CMMB 1FNEB 5E1GA 4H8WH 3IJ9A 5TD4A 1XTMA 1PG7L 1WISA 2DN7A 2FHCA 1UKSA 4E2OA 2FJGA 3HZKB 4UDTB 4J1UB 1UWEH 4ZT1A 5HI5D 4APQB 1BJ8A 5I1HH 4O9HL 5KAQF 5DJXB 2NY4C 3OKNA 4Q9CA 1EO8H 4JBSA 4GSDL 2F1AA 5IMOB 4HS8L 2BHYA 5JW5B 4ODXA 5L6YH 4I77L 3KXFB 1WQVT 3AUVA 5CD3B 4J3OF 2DWEA 5DJ8A 4BK4A 4DKDC 1G9ML 4I18C 5I1GH 1FNGA 1U41A 2W0FB 3CBKB 3CGTA 1RLWA 1RIUH 2AK4D 2VWEC 4HX1A 3RWGA 1TNMA 3PRZA 5GGVY 2NX5A 4GKZB 4PJ9D 2NY0D 1GW6A 5IB4A 5IEKB 3TEWA 3TH3T 3UTSD 5G2NA 3P9MA 3VJ6B 3VXMD 1KIUB 2JWYA 3B2UC 5DJ0B 1HINL 5BS0E 5K93A 4KBPA 3QJOA 4OJCA 2OCCB 4MAUL 4G8GB 4XP6H 5FLVA 4F58H 3ZVVA 1JTTA 4FFYA 3WFHA 5I19L 4HOZA 3S9DB 4OZHE 4QCIA 2DOCA 4M5ZH 3MRKB 4WZ9A 4F15C 3O4OB 4P2RD 1ZJBA 4LCWA 5HTSA 3U7AA 4ZZFA 1NGZA 3T65B 5IESL 3BEVA 5GIRA 3ZT5A 1A14L 1OWRM 2OMZA 3OTTA 5IVXF 1JGIA 1PAZA 1MY5A 4HISA 5FGCB 2D7QA 5D4IA 3L3OA 4TL5A 2JKIS 3P9WB 5CN3A 4M1GH 2BNQA 2EH7H 4LDEA 4P57B 4XT3A 5ESAA 5I6XC 2UZIH 5F6IB 4N6RB 2YKLH 1R3LA 1MFBH 1RPQA 2HLFC 4H1LA 2H0EA 3SCMD 5SWSD 3IXAA 2KL6A 2KZ1B 1NDGA 3NSBA 3GM0A 2Y7SA 5C0DB 2BVPA 3EG9B 3R8QA 1DBML 2CDFA 2OTWB 4LU5H 3X14A 3PGCA 4L1LA 5D70L 2QKIC 2HFGL 3NG5A 5EUOB 4RQQB 3O3EA 2BO0A 4OM1L 3L4XA 1RZKC 1QKZL 2HUHA 5I6PA 4J3UA 2VM9A 4PS8A 4OCRL 3II3A 1TCRA 3WEXA 5ITBH 3V0WH 2AQ3A 2W0LA 4M6OL 3TCLB 3U6RB 3JWDC 4YFLI 4D9LH 1FIGH 2XC8A 3S6CA 2RMNA 5AW1B 3BZEA 4KJQC 2B14A 1BPVA 1R3JA 3FQTA 2I26N 5HDOA 3AMLA 4GW4A 1BQUA 1Q1JH 3LQMA 1MCPH 3WE1A 5JZ7C 2XRAL 2ADFL 3FH7A 1EZLA 3GRBA 1N12A 4NC1E 4AEIH 3L9YA 3OJ2C 5HDBE 3NZHL 1VFAA 3CSPA 4XGZA 4ZAKC 3V0JA 1NGYA 3LHPL 5EDSA 4JPIA 2O5YL 4NUGH 3UJIH 4FOMA 1YPZE 5JQIB 1QFWH 3WSQH 4OM0L 4EUPB 4IGBC 2P5EE 5GS0L 3GTNA 4ZFFA 1V54B 1PD6A 2OXHA 3DIFA 4Y7OC 3FUIA 3RP1A 4A37A 2IQAB 2BNRA 4K71C 4AI7A 4X6CE 4BCYA 4RAVA 2FE0A 1UM4H 3CHPA 3T4YA 5JW4M 2V8MA 43CAA 1WIPA 1DBKH 1YQVH 3ULUL 1QFUH 3EYFB 4GY4A 3VXRA 4TUOB 1XCWA 4MX7A 5D7KE 1WC7B 5DHGA 2XZAL 4PJ8D 4G7SB 4X6FB 5C3LD 2IDUA 2VR7A 3H9SD 1F4ZA 3EADA 4K3EL 4LVNB 3SDAC 2UY7B 4RWHA 4G7RB 2DYRB 3ARXA 3HE7C 5CS7A 4ZXBB 4ORZC 2X3AA 5CMAA 2ZUQC 1ZK5A 4PS4L 1JRHI 3BN3B 4AK2A 1T89A 3FQUB 4QRPD 3VGAA 4PJHE 2XZQL 3ZZQA 2DQ6A 4XWOD 4MA1C 1BLIA 1XD0A 2KYIA 1WCBB 1H6FA 1A6VL 5F6HJ 4B6ZA 1F11B 3MV7D 4QT5A 2D3JA 4Z3GA 1JN6B 3BISA 4N4WA 1NAKL 3IJSB 5BVJA 4XRCA 2VTFA 1B4RA 4JO1H 1E28B 4W6YB 5TDNB 4QRRD 5KEZA 1IIKA 1JVOA 2ZD0A 3DROA 1W2KT 1UYWL 2H6PA 2V2XB 2WQRA 4HALA 4P2OD 1JWUA 1X4ZA 2XTSA 2E8YA 1QP1A 1YLBB 2ALAA 3C8HA 2DJSA 3HMWH 2BRRL 3CZUB 4GT7A 3Q3GA 1RERA 4PI2A 1MFEL 5DVLA 1JPSL 4MMXA 2ADJA 4O5LH 4GRLC 2R29H 5CEYB 5J11C 3ESPA 5H2OA 1TETH 3IBOA 3WKPA 1TDQA 3HEIB 1SQ2N 4YFLF 1B0WA 2BWQA 3BPCB 2GHZA 4P2YA 3SDXA 2FX9H 1S7UA 2C9AA 5BCAA 5BV7B 2A83A 3RIFK 2CBQA 5C9JB 3R1GL 3MXWL 4NQCA 4WU5B 4P5MB 3ZKMC 2AXHA 3PGFL 5DD5L 1IM9D 5A2IH 2CUAA 4Z7VF 2JH2A 4AE1A 3FCGA 2UWEA 3TFKD 2GJ6B 4ODSH 3FDWA 4KDTA 1Z9MA 2WUCH 1QRND 3GPSA 1EEUA 1MGYA 4KWUA 4PRAB 4TVUA 4IIQA 4EKXA 1AG6A 3SPIA 3X1BA 4LHUD 5AWNL 1CGTA 3NEEA 4KQ4L 1IV8A 3O3BA 3REWB 2RBLA 3CC1A 1D6EB 4JN2A 1LE9B 4HJ1A 5KOVC 2HN7A 2IDFA 1URLA 5HYSB 4FRWA 1EK3A 4XCEB 5EO1B 1NLDH 3F7YB 5EA0L 1DEEB 2P5WA 2PPEA 3UBXG 4WEBH 2WYZA 3SKOB 1JMXA 3X2QB 3FQRB 2P5PA 1IQWH 1FL6B 3ZYZA 5T1DL 4PGBB 3LH8A 4M3KB 3BD5A 4ADJA 5LGKA 4I3RL 4DKFL 4QHMA 3ZE1E 1A6UH 4HEMA 2JKJA 2XVLA 1AGFA 4XI5D 5E2TL 1UWGH 2GI0A 4MNGB 4KFZC 1HZHH 5HHVH 1YYLH 2XFXB 4CNIB 4EIBA 1CE6B 2H0FA 1A7PH 3MLPA 4D3CL 3CD4A 3GB7A 2VRQA 2Q8BH 3WTSA 1OAZL 4WAVA 4PVLA 2FR4A 4Q4IA 2O5NA 3QUML 4X6CB 4X99B 5LBGA 3AT0A 3BVNB 2IPTL 2W9DL 2ZNWA 3LQAL 3DUUA 4XMPL 4YBLB 1NCJA 3MGAA 3V10A 4J39A 1HILA 1T6VN 3T9WA 3BKCH 4EAEA 4E9VA 5CNHA 1B2YA 1CGSH 2EACA 3ISRA 5D93C 1OTUD 4U1GC 1MVYA 1UXMA 1BZ9A 4Z23A 3GSQB 3NCCB 4MCYA 3TIDA 5AVUB 3T3PB 2YAPA 1GYCA 1I3UA 2RIKA 2UZPA 4MQXC 3UZVB 3N41B 4OCNC 5E0QA 3T2NL 4XXDB 3B56A 4U1KB 2GIMA 4PJHB 3NIDF 1I1RA 1U8IB 1VB9A 3T0ED 4E9SA 4PCKA 1II4E 3UERA 5G2DA 3ELAT 3U36B 3C5ZC 3UJJL 3MUJA 4AGMA 4PG2C 1IXFA 2WWMC 3C08H 5ACMA 2BP0B 4PJ7A 5FKPB 2WNXA 3WELA 4FXKC 2EDXA 5J1AA 1FO0A 3DGDA 2BVTA 1M2VA 3WFEH 1TYJA 1EJOL 4U3CA 4IM8A 4TM9A 4H8QA 1D5BB 2VWEE 4TPRH 1EJ6A 1A4AA 3FO2B 3GXPA 2ITDB 2B8OT 2BSED 4N24A 2K4WA 3B2PA 5I1LA 1IQDA 3KVPA 1AR1B 1TZ8A 1FV1B 1ROWA 3DMMB 2CLRB 4N8UA 4HSAC 4OF6A 3MRQA 1H15B 3HBQA 4KNTA 4U0RB 1E5YA 2ZOWA 2Y25A 2N7AA 4XTRD 3RUGF 2YD0A 4JZOA 2JK5B 1I31A 3CFEA 5ACZA 1JFPA 2WOBA 1SM3H 1PS3A 1JTPA 3QAQA 3MJ8A 4UQ3A 2AK4A 5DD3L 1AMYA 4PJ9A 5GGSY 2DMGA 4ZO7A 1E42A 2GK2A 5DGRA 5L8JB 3L3JB 4YPJA 3VXMA 3DSFH 2J2ZB 2D0HA 3MNZA 3KS0H 4TVPL 4OCWH 2RD0A 1DQJB 5DTFA 4YWGL 3ZTNL 2BWDA 4YO0A 3RX7A 1NUGA 3PHSA 4WKXA 2E7DA 2FATH 3FBKA 2AEWA 1PG7W 4A6YB 3TJEL 1YMMB 1F3DH 3K72A 4FQCL 2W9EH 3HMXL 3PPEA 3K81A 5JPMB 3L48A 1QI4A 5F72S 3RTQB 5I6KA 4BGLA 3KYOA 3U0PB 4X50A 5I1KH 2A4EA 3WTVA 4P2RA 3MLVH 1RZFL 5C07E 4E5XG 2NUTA 3JWOL 1L3NA 4OKDA 3SY0B 4Q0XL 3FB5B 1EEYA 3TYFA 1M7DA 1VGKA 1WWWX 2EADA 3WTUA 1NBZA 4OQTH 3SCMA 2OPCA 5KSBE 5SWSA 4PJEF 1KXQE 3KPNB 5EUKB 3L5XL 1SLXA 4OFKA 1RSYA 3EJQA 2GJPA 1VZIA 3CFIC 3EJZC 2CKBH 3ZW3A 3ZL4H 4AJWA 4HWLA 2K1MA 1V7ML 4PI0A 2ZCKH 2XWTB 2P80D 4TVSa 4DN3H 1NFAA 1FN4B 4B27A 1ADQL 4IYKA 2ICWA 1E27A 3DURB 2ENYA 2Z1PA 4JJHA 1MVUB 1MCOH 4PW9A 1I7UA 3RIAF 4C57C 5F3BB 4BRVA 4D9QE 5C0AB 4M5YH 2GT9B 3T8VA 3PJSB 4DVRH 2ZOKB 2NY2C 2YIHA 3OR6B 1G1YA 4N5ED 3KM1A 1MELA 4XWGH 2ADIA 4HBQA 3BKML 3FH8A 1YC8A 4GRWB 3I9AA 4QD2E 5E03A 2FCBA 5E08H 4GAJL 2EE6A 3K6OA 3N44B 1DL7L 4PREB 1QLFB 1HH9A 1YY8B 3X13B 5C0EA 2PWHA 2HKAA 1EGJA 1TF4A 3LKOA 4UI2A 1TZIB 2HLFD 1UH3A 3EW3B 5HY9A 3QDCA 5EZJB 4G6FD 1F18A 4IMKC 4L4TD 2AEPL 4FCHA 1NUDA 2WBJC 2NY4B 4IRZA 3E3QC 1HQ4B 3B37A 3PAUA 4KO9A 4K3GA 4NHCL 2NLJB 1LWRA 5B0WA 2F74A 4F57L 3SOBL 1G9NH 3RURA 3ZSSA 2QADB 4H25B 3AXLB 1AZUA 1ZHLA 4NNXB 5CILH 3BE1L 4GKNB 2L7JA 1HWHB 3G9AB 4PJ8A 3GXIA 1WRFA 5DZAA 1DN0B 1H3XA 3H9SA 4Q9RL 3ODUA 4LQFL 2E7CA 2H26A 1VGOA 4MB1A 2JTYA 4J6RL 3WOVA 3P0VL 1MWAA 2O6FA 2X4UB 4HPHA 5LLIC 1X7TA 4HG4J 2G9HB 5LQBH 4FNLL 4HPYH 4P3CH 5FM5M 3V8OA 3IPFA 2FQGA 2F5BL 2WZ0A 3U7WH 3QPXL 4ODUA 1BVZA 3G04A 4NUMA 3U6XS 1N59B 3D87B 3FT2B 2OZ4A 1UOWA 4F15B 5KYXA 5E4AA 3PV7A 2OL3A 4LGPB 3MV7A 3VX1A 4GT0A 4ZNEA 5IIEB 5A7EA 1WT5C 1HIML 4D7PA 4PG9B 4QRRA 2AQPA 2LHAA 1YNKH 5AKSA 5HHXL 3WE6B 4P2OA 4BFFA 3UTXA 4MRBA 4UNIA 3HAEH 1IGIL 5F6HI 1ORSB 4ZO6A 2ZXQA 5DGQA 2P47B 4H4NA 1VACA 5C07B 5ADPH 3ZEVA 2X87A 4MASA 2ODHA 2WLZA 5I1AA 1U8KA 4G6KL 1JUFB 1MRFH 3LKRB 4OAWA 1U8JA 4UOW1 2WGXA 3ATFA 3HG1E 1CXKA 3O3DA 4FQXB 1ZDSA 5EF1A 3VWKD 3HE7D 5IOPA 5ICYB 5GQBA 3I75A 3B7RL 1I1YA 4LEXL 4XXCC 5FFGA 3WY4A 2QQQA 2AXWA 4NZTH 5I2IA 1KLGA 4I1NB 5F7MC 1AHWC 1YEGL 3IXTB 3F00A 4R5XA 3NJGA 3T8XB 4C4UA 5AAMA 1IM9A 1LE5A 3DPBA 3LCYA 1OAKL 2XV2A 3ILQD 1YAIA 3SKJH 1QRNA 2ZKXA 3QBLA 2ARWA 2HKHL 2HZHA 4NUQA 4TTDC 1EJFA 1OGSA 3QUYB 5DJ2A 5AYUH 2MQ0A 4PB0L 3CSYB 3D85D 5F89A 4AXWA 3FQ1A 3E9TA 1FGVH 4J3WA 5LGYA 2TSAA 2ZAGA 3FZUD 4Y1AB 4I88A 4ZTOL 4YSRA 3OLEA 1F1AA 2YHGA 3HZYA 4IGBB 5JMRA 3CJJA 1Z32X 3OAYH 1P7QB 2EKSB 3W9EA 2VSCA 2F5AL 3HKFA 5EO9A 1XCXA 3NY8A 4GRLD 4K9EL 1A66A 1DSFH 3MJ6A 1BF2A 2R27A 5C7XH 5F9OL 5SX5H 2QL1A 1P9MC 1I8MB 1WZLA 1ZLUH 1HESA 4I0PD 4LLVB 3PBLA 1RJCA 5LNGA 4HIJA 5FF6A 2VXQH 3IPEA 4R97C 3DV4A 3L1FA 4DGYL 4HWZA 1JV5A 4OJDH 3SDAB 3OKDA 5I24A 1JDDA 4NIKB 2E6JA 4L5FL 3GKZA 4S0SD 5E95B 1ES0A 4MTMA 3KHOA 3S88L 4YPGB 3AW5A 3OF6D 3FQ2A 1CTOA 4KV5E 3QIWB 4FQJH 3MODL 1L7TL 5IF0B 4EDWH 4YZWA 5D71H 2PTVA 5CFHA 4MA1B 4HF5H 1MI5D 3HLAA 2DWSA 3NZSA 1S7QB 3GO1L 2BVOA 3CVCA 4KRPC 5I9QC 3UYOD 4Y5VA 5SWZE 2QGBA 4B9KC 1V8HA 2FSEB 3FFCB 3G5VB 2YUZA 4QYOB 1X7QA 3U4EB 2CHWA 3TBWA 1OQXA 3FTYA 4WW1B 1CZ8L 3L3IB 5IHZB 4XO3A 3GTTA 3HC0A 3IFOB 1EHXA 2C3VA 2ZP9A 5KWYC 2WVTA 4JHVA 3T0EA 1F58H 1T83A 2KSBA 3PG2A 4W70A 2D03L 2DQIL 4ABVA 4EI5C 4AOFA 1BVNP 3DX9B 2PW2A 2JJUA 4TSCL 2ZXEB 3CDYA 2CCVA 3QR0A 4WFFD 2L8AA 3HHSB 4R6UA 1H8NA 2OULB 4KLYA 2L0DA 2PR4H 5GISH 2OMNA 2WO4A 4OKVA 1KACB 2L04A 4W9GC 2R7EA 2ZWZA 2Y2YA 2K4AA 3BPLC 1F1GA 2BSEA 2RGSA 3QFJB 1BREA 1RD6A 3WIIL 4B9FA 1XTLA 3V52H 3LY6A 4KH9A 1F0LA 1KLFB 4HWEH 4QRTA 1TQBC 4F7EB 1P4LB 2VZTA 1QWUA 4LPUA 4Q74A 4FFYL 5E4EB 3MNMA 2VXVH 5FYJU 4NO3B 1FNSL 2XV6B 1YY9D 3H3PL 3RVVC 3GBMH 2ERJC 3HG1B 4LRIC 3E2HC 4PPTA 5FA4B 2YC1A 4ZFZA 3SD2A 5GJSH 4XX1G 3SE4C 5K9KA 2OCJA 4NJAL 4RGNE 1KGYE 2KQNA 5IM7B 5G54A 5KW9H 4TUKH 3R0NA 4AG4H 1ETA1 2LR4A 1CC3A 3CBJB 4GXUM 5C6TL 1T4KB 5AW3B 3O6KL 5EC1B 2F0CA 2I35A 1YN6B 2G3NA 3AG4B 1BBDL 2EECA 2JJTC 5GRUH 1T0OA 3ETTA 4FEIA 2EIKB 4WUKL 3DUSA 5DD6A 2WWMD 5ITEA 5B4MC 1A6WL 3CPLB 4GYBA 4KC3B 3HI6H 4NEHB 1T04B 2W38A 3V6ZA 1A7RH 3VXSD 2CNZA 3UC0L 4JRXD 2V17H 5FDYA 3S35L 2VDKL 4NO2B 4GQ9H 2Q87A 2OJZH 5CWSB 3F2LA 4UQ9A 4QNPE 5I1DA 1KN2L 5T5FH 1CF8L 1DYZA 4V2CB 2ZUTA 3ZE0F 4Y88A 3MHZA 3MRMB 3MZGB 3OHMB 3SE9L 4P59H 4JFZL 4YUEH 1KEML 4JQIH 1RK1A 4NZFA 1OD9A 4PTTB 4YX2H 4BUOA 4FNUA 4BSWA 3PDOA 4WWOA 2BRDA 5J4MA 2X53A 1UA6H 4KKBC 2X4RB 5KANI 5MERA 4R96B 2P80A 5DMGC 4AGNA 2XVGA 3AACA 5JW4Q 3BWAA 2Q3ZA 2NOYA 4F27A 2Y3AA 4TSBH 3A6CH 5T1LD 3GMQA 1OAYH 4XH2A 1ZLVK 2LAGB 4AYMC 4KK5C 2QFRA 3MYJB 3QZPA 5I5JA 4PJ5D 2XWDA 2BVUA 3QZLA 2BNUA 1I9IH 3KL3A 1IGYB 2EIZA 3E3QE 3AYNA 1SY6H 3WS3A 1OPGH 2OR9L 2QSCL 1NDTA 5SWZB 1ZHNB 1MCDA 3LKQA 3IGAB 4IU2B 1ZGLA 3F7VB 2HJFA 5C0IB 3IJYB 4EMZA 3VVKA 2XWRA 4L4TA 5LWYL 3RL1A 1U8NA 2EXWD 4C4KT 4ZOEA 1PL3A 3BC9A 4HIPA 1U33A 2A77L 2BCMA 1SMOA 3EJZD 3CC5A 2ED8A 2QKIA 5J1TC 3P11H 2L6XA 5HGBB 5C8JA 4N22A 4NUPA 1E12A 3INUL 3RIKA 1HKLH 3OKKB 3EYOA 2IBZY 3IDIA 1G84A 3LHAA 3ALXA 1EAPB 1LO2H 1I75A 2CRMA 4NPYB 1RUAH 4KX8A 3K1DA 5D9SA 3WY3A 1CGXA 2JB5H 4HJGA 4MQ7A 5B39A 3K0YA 3RA7L 4KVPA 1RK0B 2NY2D 1T2QL 3IDJB 4R2GC 4IMLA 4JFPB 2COQA 3WAKA 2W07B 4DJMA 4DGUA 1RUQL 2RA1A 1EFXB 5KTEH 4M7LL 4RGNB 4YL4A 1XH3A 5DJDA 4ZYKA 2IFFL 3V2WA 2IADB 1A3RL 4YEEA 4OGXH 4JL2A 5ESVB 3ALWA 4NQVB 3SYOA 5L2KB 1L9NA 5FCUL 2WBJD 1KG8A 1OTTC 1MJ7L 2BVEA 3FC8A 1XH1A 5CF3A 1A21A 1YNTA 3OG6B 3MDJA 4WSKA 5DLMH 4M7KL 4KKPA 1TU2A 2EYRA 3G6JF 4HFWA 1T7WA 5MI0B 3TOPA 3QQ3A 2A3TA 4KQ3L 3BSHA 1MFAH 3QHZL 4PJBE 4WAFA 1IBGL 5TE7L 2BXZA 1FLRL 4LVHC 3VWKA 1KMGA 1TZGL 3OE6A 3WIFA 2LE9A 1U8LA 2ZSWA 2DM7A 3I9GH 2KDGA 3BUBA 2VDLL 3AMKA 3HHMA 4KKCC 1HL8A 3D2TA 3CVIL 2EDEA 2IG2L 4LT7A 1MEXH 4NAMA 1DN2A 3JXAA 4Z7WE 2JKSA 2SEBA 1WBXB 4QKTA 1A6ZA 2AJUH 5CIPB 1IMHC 2VIRB 3H7LA 3RZCC 4OF0A 5AKVA 4AENB 1JYWA 1GGIH 2G3XA 4G5ZL 3TN0C 3D85A 2XY1A 5DZ9A 3K8LA 1MQKL 1W16A 5C0JA 4MS6A 2EE0A 3ALPA 4HMDA 5C0GB 4CMHB 1BVKB 3MCG1 4XPGL 2E8ZA 1NUFA 4IKNA 5EZOH 4OR1A 3NCJL 1RURH 3LH2L 5DZNA 1OGAA 3CFJA 2HT3C 4NOBA 2MKLC 3MLTB 2IALB 5C0CE 1QLEB 3UTVA 4K4KA 1PQZB 2I25N 4RZCA 3UC2A 3QRFM 5D7JA 4GRLA 4OCMC 1S5HA 3EYUH 3NY9A 2VXUL 5IVXA 5DURD 4C83B 1E9QB 4FQ2H 5CU9A 2VJXA 3LKNA 3GIVB 4F24A 1MCEA 1PEZA 4KJWD 1A7OH 4R9HA 4XP5H 2EUWA 4I0PA 3QCVH 4ZMOA 2BC4A 3MJ9H 1F2XK 2I7SA 5B7MA 3Q01A 3EF4A 4OIIL 5ICZB 5H2HA 1J5DA 1N2RB 4XVJH 3MKKA 3GT6A 3GMMA 3A4FA 4JRYD 1HEZB 1GZHA 1IEBA 3OF6A 4TTDD 3UBFA 1BM3L 3ZOAA 1VA9A 4MD4A 4XP9L 3ABGA 3A21A 1IC7L 4TNWF 3S96A 2XVKA 3MRIB 4ZD3H 1MI5A 4FADA 3L3KB 5EHFA 4Z76A 1FO0L 5I15H 4NS0A 8FABB 5DUBA 2EIDA 1KT2A 5D6DA 1TN5A 1B4JL 1BDYA 5KYYA 1N8OE 3QXAA 3FJTA 1F6AA 4PBVC 3VFTB 1J8SA 2XPYA 1ED3A 2WMPA 4JLRB 1M6UA 2E27H 2PPAA 4KFMA 1SLUA 2NCMA 5EN3A 5KYUA 4LSPL 4P8QA 1KTDA 1YMHA 2DI9A 5H4ZA 5IB2B 1FVDB 3FUHA 5L88L 3HVNA 2GBVA 2MMXA 5DR5L 3LN5B 4CVXB 3KPMB 1N6UA 4KK6C 1AP2B 5G28A 3RWEB 2EDHA 1GC1L 2F6AA 3H8NA 3OB0K 4BK8A 2I9TB 4UWQB 5C0CD 5DUJA 5ITFB 2Q6WA 1HJBC 2R29A 3VFWA 1I85A 2IMMA 4JREB 4QXGH 3QDMB 3U4BH 5ANMA 3M1BA 5BV7H 1X5ZA 4ILDA 2MOGA 1S7SA 1JZJA 1CO1A 7PAZA 2QELA 4WWKB 2JQMA 5D5MB 1P8HA 2WJLA 4GS7B 1PW3A 4OFYD 1T20B 2NY3C 1C3WA 1MNUL 4HT1H 4JDVB 4UM8B 3M88A 4ZJ9A 5I76B 4V2BA 4KRPD 4JGUA 3RNQB 1UT9A 5ETUA 3H4HA 3T3PF 1OIOA 2BZ7A 5FHAL 3SGEH 3QQXA 5DRZA 5EOQH 4FFWC 4HIEB 3TWCH 3QWQB 2P9RA 2YPLE 2YXFA 2QQLH 3VQLA 3VFRA 2Y36L 1NGQH 3EFDH 3MR9B 5DVPA 1GY2A 2JXMA 2Y7MA 5DJZB 4L4VD 5ENWB 5HHNB 1HWGB 2J5LB 2WKGA 1TJHL 5FYKU 3TU6A 3VGBA 4LKXB 2EVJA 1UZGA 1SOQA 4GJTB 4BIKA 2P45B 3G5YB 4PD4K 5ICXB 1GY1A 1NFKA 5FDWA 5CFAA 3VXSA 3SBRA 3SE3C 3WKML 3IAQA 4RFNC 4DP0X 1OARL 4NT6A 2AI0L 1OGTB 2LLGA 1R5VB 4TQEL 1FYTE 3D69A 3L7EA 4LSDA 5DEZA 3RG1C 3MBWA 2ZSVB 2VC2L 1FP5A 4FHBD 2DKMA 3IS1X 4H13C 4JVPA 4UOZA 4WEUD 3AT8A 1OE1A 3T2PA 1FBIL 2WTRA 1T6WA 4JFFB 5CJ5A 1M2OA 3BXNB 5JW3L 1K9TA 3B1UA 2ZAHA 4ZSOE 2LLLA 4YHKL 5CM1A 4Q2ZA 4PXKA 3QEQD 1U8OB 3PP4H 4CN6A 4ZODA 2CKNA 2ZX8A 4N20A 4RLDA 5H2JA 3WJJA 4BV0A 1HX0A 1CL7L 3NA9L 4GINA 2HA1A 4JFYB 5I9QB 1EGJL