3EH3B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 36
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh3B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh3B02
4WKXA 1ET7A 3HAQA 4MD2A 1RZQA 2QDVA 2UX7A 4KNSA 1JXGA 1ET5A 4A4MA 4GP5B 2Y69B 4AI7A 7PCYA 2XX1A 3OE6A 1J9TA 1PAZA 4TL3A 1RZPA 2FT7A 2XXFA 5B6ZA 4HCFA 3C9LA 3EF4A 2OV0A 4YL4A 5TK2A 2I20A 3JTBA 4Y9HA 1KDIA 5B1JC 5G36A 4E9XA 1BQRA 4G7RB 1NIDA 2M3GA 2Q9OA 2NTWA 2G87A 4Q89A 1AS6A 2B08A 8PAZA 4UG2A 5H2OA 4KO6A 3IE9A 1L0MA 4BXSV 2PP7A 2X87A 1AAJA 1QKPA 1VJMA 4IAQA 5D4HA 4A66A 2RH1A 3NJNA 3NJJA 5J7AA 1S54A 1Q5IA 1HAWA 3VG9A 3CDZA 1PZCA 5B7FA 2FQDA 1BRXA 1X0I1 3UONA 1YLBB 3DQBA 3IN0A 3L45A 4XT1A 1VLXA 1ETJA 1DZEA 2ZZLA 3AG3B 4L35A 4DJHA 1F50A 4FAAB 2UXVA 4RH4A 1GU8A 5G54A 3OM3B 3RZEA 2GSMB 1WS8A 2VM3A 1AQ8A 4K5YA 5JJJA 2Q5BA 3BVDB 3UTWA 2PLTA 1JERA 5ANHA 2P80A 4DP8X 4L0PB 4YSUA 4QLWA 5I6LA 3QAKA 4J4QA 1AS8A 3NJFA 1AZUA 2WO2B 3FSVA 4WTQA 3X2QB 5I5MA 2YAEA 5A45A 1W6WA 5I6OA 3WI9A 2BWDA 4HCIA 3T6WA 5I6KA 4LDOA 3QBLA 2CUAA 1X0SA 4PXFA 2UX6A 2BWIA 1L9QA 3UGEA 1T5KA 5AX1A 2VN3A 1OOWA 1V55B 2AVFA 1IKOP 4AMIA 1OV8A 1FBKA 3UG9A 4BEZA 1ASQA 3AYNA 2XYBA 3NSBA 4N6HA 2TSBA 4KNTA 4A68A 1XJIA 1NWPA 1JV6A 4X32A 4DKLA 1GY1A 1J9SA 2AZUA 2GHZA 3U25A 3UADA 4GP4B 1LN6A 3V2YA 4GYBA 3CAPA 4P5SA 1ILSA 1KG9A 3C9MA 2PPCA 5TGZA 1ID2A 3SBPA 3KW7A 1N70A 2TSAA 4GY4A 2PPAA 3AG1B 3GYRA 4MQSA 2VW6A 5H2JA 5LWEA 2UXFA 2Y04A 2IDFA 1AIZA 3UTXA 1TN0A 1PCSA 2XUWA 4A2HA 4KOCA 2QT6A 1GS8A 2Y00A 4N8UA 3FU8A 4NC3A 3V2WA 2XLLA 4YSPA 2EIMB 4MFHA 2AFNA 4MBSA 1F4ZA 3FYIB 5H2MA 3OMIB 1S51A 5B1JA 1E5YA 1AANA 5ITCA 2ZONA 5DHGA 1JZFA 1X9UA 4F2EA 7PAZA 5FJGA 1BQKA 1SHWA 1SNRA 2ZWNA 3ZIYA 3UAAA 1KG8A 1SF3A 4KNUA 4AKQA 1PZAA 4BWTA 1C3WA 1W8EA 1AR1B 3FS9A 3X1GA 3OAXA 1AZRA 2BO0A 2VSMB 4YSDA 5F7BA 5PAZA 3S3BB 4IARA 2Y1AA 2YAOA 2CJ3A 3HAOA 5AHYA 3COCA 4HYXA 4F7KA 1TU2A 3VHZA 1HZXA 2ZIYA 3WKPA 1ET8A 4HHGA 4FA7B 2Y02A 4BK5C 1ZDQA 2PP8A 3NY9A 5ETZA 1GY2A 1BYOA 3IN2A 2BW4A 4UANA 1HAUA 5JJEA 3QJQB 3A7KA 4N4WA 1HFUA 1XB8A 4DP2X 4GXFA 2BP0A 4A2DA 2N0MA 3QJVB 3ASOB 4IB4A 1DZ0A 3NT0A 2HX8A 3VW7A 4HIPA 4XXJA 1NTDA 1S52A 1MZZA 2VW4A 1A4CA 5B1KA 1M9WA 2HRHA 1E5ZA 1JV7A 4WW3A 2YXVA 1SDDA 4W1TA 1NIAA 3AYMA 1SDDB 1UATA 2YAFA 3AG4B 2FT8A 5F7AA 1IBYA 1TEFA 1JZIA 4GYCA 3UACA 2L6XA 1NIBA 5DYSA 1QHJA 2FTAA 4E9SA 1PY0A 1X9RA 3OQRA 3AW5A 4E9RA 4GPOA 1OCCB 1A65A 1PLCA 3ZPQA 5B1BB 4QKTA 2YXWA 4WAVA 4EA3A 2FQEA 4YSEA 2JKWA 2PP9A 4X31A 5B34A 4FPDA 5G28A 4UHRA 1IW6A 1KGBA 2YCYA 2GBAA 1OF0A 3IEAA 1JZJA 4MD1A 2AZAA 1JFPA 3C75A 3S8FB 2PCYA 2OJ1A 4L6RA 3ZPRA 1AG0A 3VGAA 5G2CA 2W8CA 4A2GA 4NB7A 1ASPA 4X1HA 1N68A 4Q8BA 1FWXA 4P5RA 3RYMA 3NP4A 3WKQA 1AZCA 1S8LA 3T6VA 4HAKA 1PMYA 4AKPA 5BR5A 1W6LA 4JHUA 1R1CA 1KBWA 2IDUA 1L9SA 5B6YA 4JKNA 1L9RA 3X1FA 2FT6A 1H2SA 1NIEA 3KW8A 5PCYA 3SBRA 2IH8A 4YSOA 3WQJA 1I53A 4HYJA 2HRGA 4KNFA 2R4SA 1SJMA 5B7EA 3UABA 3V9CA 1AOZA 5TK4A 1UAZA 3CZUB 5I6MA 2F95A 2H47C 2IDTA 1EZLA 2PCFA 1BXAA 1GYCA 2FQGA 1IC0A 2YCZA 3FQ1A 5I26A 3PAVA 2QDWA 1KCWA 2J5WA 5EN0A 3S8GB 1OCOB 2EINB 2Y01A 1OE1A 3T9WA 1GUEA 5F8UA 4CSPA 2X88A 2FWLB 4E9WA 3NSFA 1QNIA 1UCQA 1DYZA 4KO7A 3TA4D 4OV0A 4AZUA 3FU9A 4QIDA 1QM8A 4A2EA 5I6NA 1U19A 1WA2X 2KSAA 4KO5A 2R7EA 2YCXA 1PXRA 4FBZA 4BWUA 2R7EB 4A2FA 2J57A 9PCYA 2E86A 3N55A 5B2NA 1JZGA 1ZV2A 3TASA 1PLAA 1R2NA 1WA1X 1KV7A 5AZDA 1FA4A 1E67A 2VT4A 4BXVA 1CWQA 4HCGA 1H68A 1KBVA 5B3SB 4N4YB 2VW7A 2YDOA 2OCCB 5D4IA 2HZHA 1JZEA 1KDJA 3WIAA 3ERXA 3FU7B 4W9ZA 1BEXA 1OE3A 2DWSA 4HHWA 1JZHA 3WNJA 3X1NA 2Z73A 1TKWA 3WG7B 4UAHA 5ITEA 1SF5A 4DP1X 5E9NA 4DPAX 1M57B 3CODA 1PNCA 4EIYA 1RCYA 3IBOA 2FJSA 1M0LA 2JXMA 1KCBA 2YQBA 3H4HA 2HLEB 3HEIB 3NJMA 3QPKA 5D4JA 3X3BA 1BXUA 3VVKA 3UZAA 1FBBA 3NY8A 4DP0X 1IXFA 1V54B 1F88A 3TU6A 2HX9A 3PCYA 4QRYA 2VM4A 4G7SB 1WAEA 4PXKA 2BZ7A 4BDVB 3PPSA 2MTAA 4BWWA 3MBVA 3QJRB 2H3XC 2PPDA 2A3TA 1SFHA 2WO3B 1M0KA 1P8HA 3HANA 1JVLA 5LDUA 5I6PA 1ZIAA 5A8EA 4HALA 1AG6A 3WNIA 2QPEB 2NRDA 2IWFA 2YARA 3AM6A 5G53A 4GRVA 3RFMA 1TN5A 5H2KA 3FPXA 2CCWA 2GC4C 1PF3A 1JVOA 2YCWA 1OE2A 4YSSA 1PY6A 1A8ZA 5H2NA 2JFCA 3NSYA 3NJIA 4DP5X 2I35A 4GP8B 3T6ZA 3FQ2A 3ABLB 1E65A 4ZK8A 2YAHA 1L9OA 3AY2A 2PEDA 4G72B 1ASOA 4DAJA 1CYWA 1MDAA 1NWOA 3CVDA 1MZYA 2BHFA 3DTUB 4E9YA 3AG2B 1ZDSA 5AX0A 3T71A 3SN6R 3OE8A 4G70B 2CAKA 4YSCA 4YVUA 4UF7C 6PAZA 1PXSA 2Z55A 3QQXA 3ASNB 3OMNB 1L9PA 3CVBA 2J56A 1NICA 3EMLA 3ABGA 2EIKB 4DPCX 2EILB 4TXVB 4GBRA 3FQYA 4K9JA 3TBCA 3D12B 4M3HA 3NJLA 2HPYA 4HZ1A 5AHZA 2F93A 1IUZA 2I21A 1SFDA 2YAMA 3FPYA 3HB3B 2I7OA 1VGOA 4DP6X 2I1XA 2DYSB 1GR7A 5G2AA 4LDEA 2FQFA 3G5WA 2XWZA 3H56A 1S8JA 5I5JA 1Q5JA 2XX0A 1J5DA 1URIA 4DPBX 3UTVA 4XTOA 3PXLA 3MX0B 2XV2A 2X72A 3ABWA 4BWBA 1GS7A 1P8UA 3QBGA 5AWZA 5KKHA 3S3DB 1BXVA 3PAUA 2DYRB 1L9HA 3KJ6A 3HAPA 2I7SA 1RKRA 2XVBA 4PCYA 2UXGA 1MG3C 1JXFA 2IH9A 3S3CB 3FT0A 3X1BA 3H4FA 2YDVA 4ENZA 3FYEB 3FSZA 2R4RA 3PXOA 2PPEA 2WJLA 1J9QA 3JT2A 3NS0A 2XXGA 4XT3A 5H2PA 1NIFA 5H2IA 3PWHA 4YSRA 2CBPA 2AT9A 1BM1A 1BAWA 1JGJA 2IWKA 2P80D 5B7MA 2BZCA 1CURA 2DWTA 1GSKA 1A4AA 3QJTB 4JR8A 1JXDA 5BR2A 5B6VA 1XB6A 3V9EA 1R84A 2QPDB 4BUOA 1TEGA 4JKVA 3PAZA 1E30A 1BRRA 3ODUA 4M4RB 5I5IA 3EH4B 3CDZB 1BYPA 2CALA 4XTNA 5A44A 1QLEB 1S53A 1MGYA 3HASA 4X4KA 1ILUA 4BEYA 2KS9A 2WSDA 1V10A 3NP3A 3EH3B 2HXAA 3PLYA 3NJKA 3SQRA 5AFAA 1AACA 1PNDA 4JHVA 1AZNA 5DHHA 2BRDA 6PCYA 3BQVA 2XV0A 1KMEA 2EIJB 4F2FA 4LDLA 4BVNA 3DIVA 3QJSB 5G2DA 1E12A 4G71B 1ZIBA 1PZBA 1BRDA 2IDSA 3TBBA 5B6WA 4E9VA 2J4YA 4KOBA 3NJHA 1KYAA 1BQ5A 4E9QA 1A4BA 3UTYA 1WA0X 2LNLA 3FU7A 1NINA 3D4SA 5IY5B 2DV6A 4YSQA 1L9TA 2GI0A 1XIOA 4DP9X 1SHXA 1JOIA 2BW5A 3OE9A 4AKOA 1NPJA 1C8SA 5B35A 2FNWA 4JQ6A 1KGYE 5FC9A 1FFTB 1GS6X 3NYAA 2JAGA 1OCZB 4E9TA 3SBQA 5H2LA 2DY2A 1QHQA 2H5UA 4DP4X 2KSBA 1B3IA 3NSCA 2ZOOA 2JAFA 3ABMB 4DP7X 3EHBB 3HARA 1ADWA 2WJKA 4EF3A 4BDVA 2J55A 3FSAA 1AZBA 4QI1A 4YSTA 5AKRA 3VI0A 2Y03A 3N2JA 3T6XA 3QBKA 2UXTA 2KSYA 3T45A 2B3IA 1NPNA 3UAEA 3DDLA 3ZX1A 3DKHA 3QDCA 1QKOA 5A7EA 2IWEA 1GZMA 1C8RA 3ZEVA 1XB3A 1ZPUA 1M0MA 4AX3A 1M56B 3QAPA 3UZCA 1P8IA 1IBZA 3EH5B 2I85A 2ZXWB 3AZUA 3CG8A 3MBWB 4KO9A 4NAJA 3P0GA 2XV3A 3OD3A 5I28A 3X3CA 4AMJA 5AZUA 2IAAC 2PPFA 3NJGA 2EI4A 3NYKA 2XU9A 2BP8A 1AP9A 4YSAA 2BP8B 4EJ4A 1GW0A 2YAQA 5B0WA 5JJNA 1AS7A 1EHKB 1CYXA 3ABKB 3ZBMA 1O0AA 2GIMA 3PBLA 4BV0A 1J9RA 3FSWA 4PAZA 3OMAB 4XTLA 2IDQA 2VMJA 1A3ZA 1WS7A 4HWLA 1CUOA 2LLNA 2W88A 3ZDWA 2AANA 4MQTA 2GB2A 1OCRB 2GC7C 2NTUA 1MG2C 1E0PA 3QBIA 3CVCA 3GDCA 3OE0A 1IW9A 1NDTA 5C1MA 1PLBA 1J5CA 1XMEB 3X1EA 4CSZA 2RACA 4KLYA 1CC3A 1X0K1 3GXUB 4YVNA 5B6XA 2BP0B 2YAPA 2MRYA 3NSDA 1NZRA 5EHFA 3PDSA 1F56A 5H2HA 2ZFEA 2HX7A 1AT9A 3REYA 2VSKB 3PQRA 4NERA 5B1AB 4A67A 3QJUB 4G7QB
chains in the Genus database with same CATH superfamily
1AD9B 2J8UF 1PKOA 2CKBH 3DSNA 1OGTA 3F01A 4L3EA 3D4YA 5KYYB 4PJXA 4PJIF 3N0PB 4JFFD 4OF6A 1VENA 1WCBA 3KYMB 3HNSH 3MR9A 4UU9A 4YHOL 1EK3A 1F4XH 4U3HA 4NWTH 1S9WA 2AXGA 5FGCE 5CCGE 4KVNL 1KIQB 3O0RH 1HSBA 1AJ7L 4X8XA 1XIWD 4B95C 2R0WH 3DOSA 2EKSB 1BFOB 2XACC 5AVZB 1O5PA 4ELME 4PVMA 4BXSV 4OTXL 4FFVC 5CIPA 3MA9L 3FN0L 2H32H 1IJ9A 4UYQA 5IV2A 3OHMB 4O2FA 4BK8A 3B2XA 1Q5IA 3P0VH 3WD5L 4ZOBA 4BSWB 4P2YA 2FQDA 5IESL 3QI9B 1UZ8B 2F53B 3AITA 2B7DT 3NGBB 1MWOA 4L35A 3WJLA 2JKNA 1SM3H 5FW6A 1LNUA 1MVUA 4UV4H 3SE4A 4I87A 3RZEA 3NH7H 4CU7A 3RGVC 4OFYA 4OJCA 3D39E 3C60D 2O6FA 3M8OL 5DLMH 2HN7B 1MW1A 1XR9A 3QCTL 4U3CA 3B6SB 5J89A 3LHAA 3QXDA 3QCVH 3GSOA 2NY1C 4X6BA 4HCIA 3BZEA 5I6KA 2OPCA 2CJUH 4M6ML 3ZRSA 2F19L 1F4HA 2BK8A 3OHXB 2QR0B 4GUOA 2XYBA 1P7QD 3G5XA 3RBSA 3ZSSA 1XJIA 2V33A 4ALAH 1TTCA 1RQ5A 3GKWL 4QTHA 2VDRB 2YPVH 3CFDA 3H9HA 4XGZA 2A1WL 4WK4B 1I8KA 3VO0A 4JFQB 4HWBA 2X4SB 1RL1A 4IHBA 1H8NA 2LAGB 4UOW1 4ZPTB 3T6QC 5J6GA 2DAVA 2PUQT 3RVUD 3AS3A 1N3NB 2VW6A 1CD0A 4QRFA 4WAFA 1LM8V 5C7XL 5JW4N 4NQEB 3BCDA 1AZVA 2UYLB 5E5MA 4WGVB 3TT3H 4PRPD 1CG9B 2C4XA 1C5DB 4KUZL 3RDTD 2VN4A 3APMA 3BEVB 1UFUA 3OQ3B 3T1FB 4WIQA 2GJPA 5J3HD 1BWMA 3A6BH 4I3SL 4PJCA 4C8XA 4Y4FB 3PL6B 3IGLA 3KHOA 2IOMA 2XOTA 5I2IA 1SF3A 5ANMB 3DJTA 2WNGA 3L48A 2HKFH 3MCKB 2J5LC 4BWTA 1WK0A 3HE6B 2WKOF 5I16A 3F83A 4GRLC 2VSMB 1H5BB 2Y1AA 3T0XA 2ZYHA 5AHYA 4HYXA 1MCNA 5IB1A 2VZTA 4DO4A 4I1PA 5LXVA 2ZIYA 3WKPA 3C8HA 4HH9A 2Y7NA 4QHKI 3RAJH 2CSPA 3MI6A 3RWJB 4FQLL 4WWPA 3CGTA 4J28A 2XICA 3KBEA 1RFDH 1Q1JL 5KVGE 4A2DA 4ZFGH 2XZCL 3MAWA 3L3KB 3BVTA 4LSUH 5HJBA 1XBDA 2VL4A 1DZ0A 1E27B 2C9XA 3TH3T 4X4MA 1DVSA 4HIPA 3O45B 2P43B 2ROXA 5MEQB 5GGVH 1ZA3B 3LVEA 5TQ2H 1ZXQA 3CDGA 1LEIB 2YAFA 3AYMA 3GKZA 4ILDA 2I9LA 4X42A 5FYLD 3OKEB 3MROA 3OXSA 3FH7A 2J20A 2PNDA 4LSDA 3KH4A 4E9RA 4LRIA 1A65A 1Q72L 4K9EH 4H7VA 2A6KA 2X0UA 3PFQA 3IU4L 4JZJA 2ZAGA 3ISRA 2ZYRA 3D50A 2N01B 2NY6C 4JPSA 4DZ8A 1MCCA 2YMTA 4YC2C 5D7JD 4F37F 4N22A 4AV5A 1XGQA 3VGGA 4XCCH 4JK0D 4KHTH 1JHLH 2QADB 4MXQC 5IBUG 4NB7A 1PX4A 2JF1A 2L8AA 3CFUA 2AEOA 1O9WA 5C6TH 4OIIL 1MHPL 2F8XC 1GKOA 4NM4H 5TE7H 1S8LA 4MJIE 4HWEH 5BR5A 5DMYA 1A14H 1MNUH 1QZNA 1VPOL 4WTZG 4PG9A 2H1PH 4WFED 1C08B 1A22B 5IQMA 1ML0A 3UJIH 4CVXB 3D69A 1HEHC 1WWBX 3F6JA 4YSOA 4ADJA 4KX8A 3EYSL 2IPTL 4JQXC 4KNFA 3DGDA 2VWEC 3B2VL 2YPKA 5MENE 1WCQA 4UAOB 3VA2C 2F95A 3CZJA 3U4BH 4X98A 3UIZA 2GKIA 4JGUA 4U05A 5A40E 3IGUA 4NZTL 2YCZA 2HVKB 2X2YA 2QDWA 3ARSA 3S96A 5EN0A 3S8GB 4FP8L 3PV7A 2Q86B 2DWYA 3PRZA 2YN3A 3ROLB 3OTTA 2X88A 4N2KA 3P4MA 2ZXQA 3T4YA 4ICXA 3FCTA 4R97C 4P2RA 2OI9C 3NZHH 4ZFFB 3V6BR 4L8BA 1J9CT 2JKTM 1NLDH 1DLHA 4E42B 1A8JH 3ALPA 2WQWA 3ML8A 3FQNA 3BZDA 2WXPA 3U0WL 4RMWA 5TDNA 3BAXA 2X2HA 5T1KA 4IBTA 1U8NA 1F1DA 3S37L 4UDTA 4PG2C 5DMIH 3O6FD 5MEPB 1OE3A 2DWSA 3WNJA 1D9KC 2BLFA 2EQDA 3B2PA 3DURA 4I77L 4IIQB 4XWGL 1HKFA 3LPGA 5DHDA 3VXMD 3FTXA 2AXHA 5TGBA 4BHUA 1M57B 35C8L 4OGZA 3RLSA 3W2DL 3B2MA 3KPQA 5FYJU 1SHSA 2AAAA 3ESOA 3EJYD 4WU5B 3NJMA 4HHAB 3OZKA 3HEIB 5J7CC 4NQQA 3LV3B 4DP0X 1FBBA 3FHQA 3MLYL 5JZ7D 5D2NA 2O30A 5EU6B 2AF2A 3MLRL 2HX9A 1ZLWK 1CBVH 3SDDB 1WBXB 4PXKA 1HWHB 3TTSA 3P9LB 1BQUA 1QFUL 2BNQD 3SGEI 1UC6A 1MFUA 2H9GA 2IEPA 5ITFB 3DHUA 1VF5C 3UL4A 2F1EA 3TXAA 2MKWA 5K39A 4JKPH 3O0LA 5FWQA 4ADIA 1J8SA 2O93L 2YOAA 1KYDA 3AU1B 3BRGC 1JWUA 3FH5A 1Q1PA 4NI3A 4MAYB 4A63A 4FMVA 4U7KA 1BFVH 5IGXL 2VDNB 4KNQA 2Z4QB 4J23A 3RFMA 5T3ZH 3KBFA 4L5FH 3EGDA 1SJEB 1K4CB 1JVOA 2FJFA 3B7RL 3EF7A 4K5NA 2NW3A 4I85A 1KENL 5KYWA 2JFCA 5BVPH 2FATL 4Y2LA 1NDMA 1MFEH 1CDUA 4Z7WF 1J1PH 3GHPA 2DWDA 2WBJA 1MKFA 2BSDA 1NWOA 4E9YA 4Z78B 1IB5A 1F45A 3NAAH 4OCYH 4NXKA 4G70B 6PAZA 4KXAA 3IXAA 4JDVA 4LL1A 4PB9H 4J2XA 3R7RA 4FFZA 1MXDA 4Q4IA 3HNTH 4YPGA 3JSSA 4IU2A 3MLPA 3T65B 4UT9L 1AGBA 2B1HH 3SPCA 2X7LA 1R19A 3FPYA 1OHQA 4I3GA 4R7NA 3H56A 4L4TA 4NZUH 4LP4A 1XSJA 4BQ6A 2XQYA 1CDGA 1IM3B 1BREA 4Y19B 5E2WL 1MI5B 3U6RB 5EBLB 3MBXH 4HPOL 1K9TA 2DQTL 2CPCA 4Y5YA 3F5WB 5BUAA 3U4EA 1Q9OB 5HYJA 1MFCL 4Z3EA 3O9WC 3WXVH 3MUGA 2IWGA 3D4GA 5D1ZB 4MMZB 1J05B 1BD2B 5ERWB 1UA6L 4WUUD 4JW3A 3RRQA 3M45A 4I0PA 2HFTA 3O2DH 4KTDL 4NFCA 1RZJL 1EDQA 3NS0A 2J1XA 5JZ7C 1IGTB 1U36A 1J8HB 1FYTA 1SMDA 3AT0A 4QXGH 2FBOJ 2GSGA 4U1JA 4A6YH 1FFRA 2BZCA 3PNWA 2Z9TA 3IRCA 1CURA 3SZKC 4JHWL 3SB3A 1A7QH 4V33A 3TZVD 2CUMA 3RIAF 2AABL 4LPCA 5HYSB 4AYMC 1KPRA 1E30A 2OJZH 4JRYA 4GKNB 1D5ZB 1HEZA 1BM3H 1TENA 4AGQA 4Q9RH 1P4LB 1EWHA 3NA9L 5EULV 1G9ML 1XCTB 3OKNA 1IFHH 1LILA 4I8DA 4ZW6A 2FHCA 3IU3B 4Q74A 1DLFH 1CPUA 1W72A 3QDMB 5E00A 4FNUA 1WAAE 2UV3A 3SGKA 3SJVA 3CMOL 2VISB 4F2FA 4QXUH 4ONHA 2QSCH 2QHRH 3NUKA 1KTBA 1KYAA 1XAUA 3KYAA 1T0PB 1Z9OA 1M6OA 3QZPA 2BNUA 3CIQA 1LK2A 1ZSHA 3AGVA 1BAFL 3RWCB 2GSIA 4QWWD 2VQ4A 3EGXA 1JOIA 5F9OH 5FLVA 2IQAA 2R0LL 2OM5A 4Y4KC 1QG3A 4KI1A 1KGYE 4MMYA 4P04A 2RA1A 4DP4X 1O6TA 1KCLA 1O9VA 4ZD3H 2AEQH 4LVNC 3A67L 4EF3A 1TJMA 3V5DB 3PPEA 1AE6H 1RPUA 1CXKA 4OQTA 2BFGA 3HC3H 3QFJE 5F1NA 1CDIA 4GXUN 1Q0YL 1YEWA 2YD1A 5F72S 5SWSB 5C07E 2IWEA 4W9GC 1S7UA 2Q0ZX 1M56B 2A4ZA 3QA3B 2XV3A 3HZVA 5E9DA 3H7LA 1ZOXA 3LXCA 3P0GB 3GMLB 4PS4H 5M95B 3DX8A 5HXMA 2YO3A 2ZUVA 3WO3B 1HWWA 5DD0H 3EG9A 2P5EE 2Y1YA 5C0DB 3NZ8A 3T0EE 3G6JE 5KAQG 4LIQE 4RFNC 1URLA 2D3VA 4PP1D 4G8IA 4U6YB 5DJ6B 1A7RH 3IJYB 3ILQD 3K81A 2AANA 3L3DB 5AW8B 3CVIH 3CFKA 4BGLA 2E9JA 2HH0H 1EMTH 1RJZA 2WIIB 1YECH 4CRPA 4KI5F 3K71A 3VWJD 4ODWB 5EZJA 2BOBA 1WP6A 4RWHA 1JDCA 3STZB 3VJ6B 1U8KB 1E28B 1FFPB 2EXTA 4OH2A 3U1PA 4BFGA 4CJ0A 2YAPA 3U36B 3TS8A 3K0WA 3P9MA 2ZXEB 3GGWA 4L8DA 4P2CG 4WV1C 5MEND 3IDNA 4UQEA 3MLWL 3FTGA 1DR9A 1DJIA 2ZCKL 5FDYA 4LCWB 3ZE2F 5T3XD 3QBTB 3AB0B 3VQMA 4I9XA 1AD9A 2WTPA 3GIZL 4HJGB 4PGZA 2VNCA 1VJSA 4XP5L 2EDLA 5DMGC 5KYYA 1M7DB 4GG6F 1BQLH 1RZQA 4ZYKB 4OZIE 2UX7A 3QQ4A 1RHFA 1TJIH 3KYMA 3OLGA 4WNQB 3TYFB 1QABA 1EFXD 4A7TA 2F15A 2AP2A 1BMZA 1TDQA 2YD6A 1AI1H 4Y1SA 4Z1PA 4IQHA 3P0VL 2R1XB 1KIQA 2OL3H 5I74C 4I48B 3QIWB 2ZXCA 4JEGB 1RURH 2Z31B 4X9GA 4WWOA 5FA3B 2EKSA 1BFOA 4TMPA 2NXZD 3SE6A 2YZ1A 4I2XE 4IIZA 1A6WH 2YHGA 1SM3L 1NCUA 1UFGA 3H9SB 1FYHB 1F0LA 3VD1A 1FVEB 4JPVL 5DFTA 3LKRB 4U0RB 4BSWA 1BJ1J 4FG6D 3QI9A 1XT5A 4PS7A 1UZ8A 1BLNB 2F53A 1Y07A 4HUVB 3QO1B 1F50A 4RH4A 4JFYB 4L37B 5I1IH 4YOKA 2ESVD 2R29A 2HN7A 5D1QB 1UYWH 2ZG1A 3B6SA 3QCUL 1UCTA 3TO4D 4AXWB 2EDQA 4KK5C 3QK0A 2YPVL 3ZY7A 2YAEA 4G8GB 3GEWB 1FNEB 4Z8FH 1XCWA 3EYFB 5E2JA 1FZMB 4IKLA 2YR3A 3OHXA 1FHGA 2UVFA 5IP4A 2QR0A 3DRTB 4MHHG 4X5QA 4ZO9A 3UBGA 2QQQA 4XOCA 1C5BL 3UCRA 4YDLC 5JXEC 3OG6B 3F00A 5D93C 3TT3L 5FYJL 4F20A 2H1LM 5IQOA 4JFQA 1OAJA 4G1MB 1UWXK 3NEEA 3JVGA 2X4SA 3QG7L 4MJ4A 4ZPTA 3W11D 3MLUH 4KKQA 3O8XD 3WN6A 3W38A 1NFAA 3WMSA 1FV1B 4NQEA 3MRRA 2UYLA 3CPUA 3LEYL 2YGPA 1CG9A 3WNPA 1AGFB 2P47B 2OK0L 1C5DA 4X83A 4Y89A 3BEVA 4PW3A 1CDJA 3BQUB 4W6WB 2EIMB 2ZOLB 3KLLA 5DD6B 1A21A 4LASL 3FH8A 3L3JB 3PL6A 4Y4FA 1NC2D 1NLBL 4P99A 3MLTB 5EF0A 2YEZB 1SNRA 5ANMA 4JPKL 4PBXA 2AGJH 5EU3B 4ZODA 1HILB 3HE6A 1OD9A 2E8YA 2FLRT 1RFDL 4XPGH 1H5BA 4DWHA 4FABH 1IGFL 4DGVL 5TE4H 4GSUA 3KHQA 3VHZA 4OBSA 1ZTXL 4TNWF 4P4RA 4HHGA 4FG6C 4RX4D 4DTGH 2VXUH 3K5RA 1T66D 3RWJA 5TQ2L 1BYOA 4IU3B 3DMMC 2H1XA 2BW4A 4UANA 4X6FB 3MC0A 2ALAA 5D7HA 1Z2KA 3L3KA 1E27A 4L23A 1MJUH 4WSGA 3RL1B 3O45A 3ULUD 5B1KA 5MEQA 3BAJA 1E5ZA 3AROA 1YEEL 5L7XL 1OO2A 2DL2A 2FT8A 1LDPL 3OKEA 4JANB 4MCZB 5F7AA 4XCCL 1F90H 3NJVA 1T1ZB 2LW3A 1HH6B 3LJ3A 4JFZL 2Z35A 5TFSL 5C6TL 4DS7E 3CHOA 5DT1L 5E99L 1BPLB 4V2CB 1LO0H 2Y7LA 1P4IL 2H1PL 5CN2A 5IWLC 3B7UX 2DLEA 1JZJA 1MEXH 2XIDA 2VDQH 5C0FB 2BOLA 3W11C 2AJSH 3FU0A 1FP5A 4XAKE 4J3OD 5DEGB 1OM9A 4HPYH 3D05A 5F1IB 4FFWD 2BC4B 2I24N 1X9QA 1W6LA 5ADPL 3BT2H 4DPRA 1C08A 2CHNA 2FSEB 4PGBB 5GS0D 1HQRB 2YD4A 2JVUA 1LO3L 1F2XK 1F6AB 1UCBH 4CVXA 4K23L 2WYTA 1YMME 8CGTA 4GI9A 4X6EB 5FM8A 4L4VE 1HNYA 5AKTA 4OU3A 4Z0BH 1HN1A 1P7KB 3UZEA 1GW6A 4I1NB 4XNZB 2HVKA 5D70H 4Y2DB 1E6JH 4NFDA 1OK8A 2Q86A 1JTTA 4E5XB 4MD5B 3ESMA 1E5UI 5SX4H 3ROLA 4DQOH 4XO4A 5IFAL 2A9DA 2IH1B 1GUEA 3QUMB 3P0YH 5D72H 4GO6B 1TJXA 2V5RA 3KYNB 4TL4A 4D7PA 1IC5L 3GLDA 4N2AA 5DO2D 4NIKB 2FIRT 4A2EA 3QJHB 4AZUA 4ZFFA 5C07D 2I60H 2P7TB 5MERB 4N0CC 4ADGA 1MPAH 5EN3A 3D87B 4E42A 4AL8L 4HULB 2CGZA 5B2NA 4P9HH 2QELA 2WAHA 4NCC1 4BBWA 3RVXC 3OKDB 2G3XA 5B3SB 1QWNA 2N1KA 2P5ED 2OQJB 5MEPA 1EQWA 3ERXA 4P06A 5EN2B 2HTLD 4IIQA 3MJ8B 1CBVL 3UYOD 3FUMA 4P2QE 5C0IB 3LRSB 3SIKA 1OL0A 4Y4HD 4Y8AA 4WU5A 4NN6C 3KWXA 4Y9EA 1YEKL 4GUPB 5I0DA 1XGRB 3LV3A 5FLUA 4PJGF 3HZKA 4B27A 5EU6A 2H2PD 1AMXA 4ZFOA 1AR1D 3SDDA 2OS7A 1BFVL 2OSLB 1WBXA 1FZJB 4JRFA 5E5UB 4IGBC 3P9LA 4Z7QB 1GOHA 2X1XR 4BWWA 3B9AA 3MSPA 4J3OC 3MBVA 5FCUL 5ITFA 3B8SA 1L7IL 4XCFH 5LDUA 4WFFE 5HVFB 3MJWA 4FFWC 4ZMZA 5BVPL 1U95B 1MFEL 3WIIH 3MV9E 1J1PL 3AU1A 4MAYA 5AVVB 2Z4QA 4KC3B 2F7RA 4P5KB 4GIOA 3KPPA 1A1NB 4G80A 4OCYL 2A2QT 4MB4A 1SJEA 3EAKA 4F8QA 1K4CA 4NM8H 5E8DL 1JZ3A 2VH5H 4PB9L 4FHJA 5H2NA 3HNTL 1EUTA 1G43A 3APCA 2K6YA 2WLYA 5CZXD 5INDB 3OGCB 1TQBB 1YEGL 4Z78A 1BQHA 4RETB 4H20L 1GYVA 4ZW7A 4WCYL 1KXQA 1NCIA 2P24A 3CE1A 4NZUL 5JIMA 3V55A 4BFJA 5K59E 2Y72A 3EYQC 1ORSB 2VR7A 4IK6A 1B0GB 5CSBA 5GQBA 4KK8D 3T65A 4K9JA 1HSAA 4ANUA 4AEFA 3GXNA 2UWEE 2R2CA 5DYOB 2VXQH 1QBLL 2I07A 5F97E 2I1XA 2E0PA 4LCUB 2J6EH 3NIGB 1IM3A 3NIFB 2KPWA 4RAHA 4Y19A 5EZIL 4AMKH 1MI5A 1QBMH 3TBVB 3U6RA 5EBLA 2ADYA 2K70A 4Y0GA 4QOKB 3T0EC 4AY0A 2HFGH 4N2EA 4OM0L 3F5WA 4BE5A 3MREB 1A4KB 1Q9OA 1P8UA 3C6LD 4F7CB 3GXFA 4PJBE 5D1ZA 3U82B 1G7MA 4Y5VC 3TJHD 4MMZA 1J05A 3QUYD 1BD2A 1SUHA 5ERWA 2YK1H 3S3CB 1TZHA 3BFQG 2OJZL 1T5XA 1XBRA 4S1QL 1P0SE 1BM3L 4UIKL 2WJLA 1J9QA 1IGTA 1EJOL 3RZCD 3VNYA 2BXZA 1IO4C 1IFHL 2H2SD 3SOTA 5IROD 2IBZY 4PJHF 2WAQA 4CDHA 2HTKC 5A43C 4OD3H 4NKDB 3X12B 1DQVA 1DJSA 2DLIA 2HCZX 4BUOA 4H0GA 5HYSA 1SY6A 3IGKA 4GKNA 1D5ZA 1XD0A 2F5AL 5TJWK 3JWOC 1GRWA 1P4LA 3OXRB 2XWTB 2IANE 3BUIA 1XCTA 2QSCL 2GUYA 3C6SB 2H4EA 1DO5A 5LJYH 2IQ9H 1B0IA 3WMPA 2FH6A 1ZGLP 4RNRB 3QDMA 5KSAD 4AG4H 3SOBH 4LHUG 1YAIA 2VISA 4M61A 2VTFA 3RVWD 3MRPB 4Z7UE 1TZGH 1DVFA 2VDPB 5KSBE 4OQ1A 3SKMB 3BUQA 5D2LE 1F2QA 3PU7A 3ES6B 4ZOCA 5HVHC 3RWCA 2AEQL 3A4DA 1CWVA 5CBEB 4RMQA 2GI0A 1AE6L 1SHXA 3QWRD 1OTUD 1CO1A 1CFVH 4P9MH 1ACYL 1HL9A 2XC8A 4HU2A 2B59B 5A6MA 4WJKB 5IJDC 2Z1KA 4OUOA 4XXCA 3R06A 4OGXH 1GZHA 1JZ5A 1RPKA 1YEFH 2WYHA 1GGIL 1DBKH 2PCPB 3V5DA 1OSZB 1OT4A 3KPMB 4JZOB 1QACA 1TZ8A 4PS4L 4EMZA 4RAUB 1SYVB 4PYGA 5IVNA 1PD6A 4JM0A 1JIBA 4N2GA 1W0VB 5CR8A 5SWSA 4TSBH 3TJHC 5DS2A 3QA3A 2O5YL 1LE9B 1QI5A 4LFHG 3U46B 2IV8A 1QLEH 1IGIH 3MZTA 3P0GA 4P3DB 3GMLA 2FGWH 3KPRB 4YHZL 1QSZA 2O5NA 4JRLA 1MAMH 3K46A 4GSXA 4IK7A 4HUNB 2DEWX 2HUHA 3RZCC 3QUXC 5KS9F 3QDJB 4TXVB 2YAQA 5C0DA 5IROC 4X5RA 3UMTA 4MJJA 2B15A 1EAOA 2E46A 3O2VH 4U6YA 1CQKA 5DJ6A 2XCMC 3IJYA 3OF6A 4XAKD 3MV8B 2M8XA 2Y6SC 4ZMOA 1J18A 5AW6B 3STLA 2NY7H 2WIIA 4GQPH 4MCYB 2GBTA 1BF2A 1UZGA 4ODWA 1YNKH 4UBDC 2CK0H 2BSED 3E7JA 5HSFA 1IAKB 3STZA 3VJ6A 2E7BA 1U8KA 1E28A 1FFPA 4FQXC 1YN6B 5CU5A 1EVUA 3U36A 5LN8A 2FEDC 5DK3A 1TJIL 1YMMD 1TJHL 4OKVB 2A77H 3VD7A 2QVIA 4L4VD 1AI1L 1ZMYA 1F3DJ 4LCWA 5I1LB 2VSKB 2OL3L 4A67A 5J12C 3ASWA 1S5HB 2AQTA 3PUUA 1A6VH 4HJGA 4X9IA 5FHAH 1M7DA 3UIYA 4AGOA 5AALA 4F5CE 1A6WL 4LVOB 1ANUA 1RIHL 1OAQL 4PR5B 1BFTA 4WNQA 4ZMLA 3NSJA 3FSOA 4KXDA 4PWEA 3TYFA 5A6IA 1SXAA 1QR4A 4PHXA 5FV1L 3EF4A 5D7KD 5DD5H 4I0KA 2I20A 4I48A 5L4IA 3QIWA 2Z31A 5FA3A 4AJ0A 3GI9H 4HGMA 4J8RB 3WUWB 3I6GB 2CMRL 2ZUQB 4IBWA 3QUZD 4FJ6A 4FQJH 2O1AA 4Y9BA 3H9SA 3N41B 3BKJH 3TEYA 4FFZL 1FVEA 3QUKB 3LKRA 5I1IL 2VUOA 1KCKA 1HAWA 4F8TA 2IOOA 3MV7B 2D9CA 4AE1A 3ZDXB 5B7FA 5CN3A 1BLNA 3IFNH 5TD4A 1PW3A 4HUVA 3GJFK 4FCAA 2QL1A 4P2QD 4XMKL 1TCRB 4Z8FL 3K91A 4JFYA 2EE3A 2W60B 3OX8B 4L37A 3CQQA 5G54A 2ZX9A 2X41A 2FDBP 2YA1A 3EJRA 2Q5BA 5E6IC 2MNUA 4GUCA 5D1QA 2VZSA 3P3RA 4DP8X 2VR9A 1NCHA 4C56B 3TVMD 1RD6A 4AXWA 3BSZH 3K6NA 4UUJB 3QULB 2R69H 4NQTA 2KT6A 2GITB 3PWLB 4CKQA 1BVNP 1M3IA 2M26A 3EYFA 5AVTB 3DSFH 1FZMA 3F58L 3MLUL 4WFFD 3HG1E 3D3VB 1NFIA 3DRTA 4RSYA 4PV9B 3MV9D 2AEWA 3UG9A 4A68A 2LTQC 4N0RA 3BN3B 3WFCL 4G2AA 1UM6H 4G1MA 4N20A 5FOBB 2GFBB 1N8OE 1FE8L 2WLKA 1ID2A 2ARJQ 1CS6A 3BP5B 4OZGF 3RURA 5BZDB 2D7MA 4P5TB 1FV1A 4Y9GA 5IJVB 3FO0H 5HGAB 2Y7QB 4UT6A 3KNBB 4MGXA 5C0CD 4GW5B 3NBNA 2Y04A 4Z7AA 3ZTDC 1WFJA 3KWVA 4H0HB 1AGFA 1W72L 5CSZB 1J10A 3FULA 2DKMA 3BQUA 1FDLH 4DZBA 4CADB 2Y23A 4P59L 3E1F1 1D6VH 2ZOLA 5DD6A 3T2PA 1I75A 3L3JA 4JUTA 4KQ3L 2X3CA 3MLTA 1VEPA 3S4SB 2YEZA 1WICA 3EJJX 1E9PB 1EO8H 3BUBA 2OMVB 4LCYB 5EU3A 1KSRA 1HILA 4FD0A 1C3WA 4TUOB 4PHZA 3X1GA 2NNCA 2A6IB 1JFQL 2UY6A 2C9PA 2D4DA 5IJCC 5DZNA 4NZRL 1CGSH 2YAOA 3PWPE 4YWGL 2CJ3A 3JBG7 1MJUL 2XHNA 1T2QH 3IMVA 1HZXA 4BFIA 1DVZA 5KJRL 1X5XA 1ET8A 4Z7IA 4XPHH 4B6ZA 2VERA 4IU3A 2YUZA 1OAYH 4DEUA 1Y1DA 1U8LB 5SX5H 1LO2L 1QD0A 3BUDA 5JJEA 3R4RA 4X6FA 2COVD 3OAUH 5C08E 1MVFA 4OQTL 4N2DA 3RGVB 4XVJH 3RL1A 5EC1A 1PQZB 3D18B 4NPYB 3MUJA 1REIA 1BMGA 5HPMB 1M9WA 1LO0L 4R83A 2FO8A 3HMXA 3U1QA 3QZMA 4DKFH 2E3VA 3TIDB 1OWWA 4JANA 1NFDF 5AL0A 2LQRA 3Q05A 2EVJA 1TEFA 2NY1B 3T8XB 1IQDB 3REWB 4HGKC 4E9SA 1D5BB 1T1ZA 4H0LC 1IU1A 4XMUA 4GAAA 1HH6A 3ZPQA 1YN7B 1BV8A 1DE4B 3DPBB 4HJIA 2JELH 3AQXA 3BT2L 5LCVA 1CTOA 2YBGA 5C0FA 3FZUD 3C75A 1SOXA 3MCG1 2EDKA 2DL9A 1UWEL 2DIAA 5DEGA 5DGRA 5I30H 2BPBA 4LGSB 5F1IA 4P5RA 5DZJA 3NPZB 2BC4A 1IAIM 2EIBA 1R33A 4R7LA 3TPUB 4Z0BL 3NACL 1XX9C 4PJ7F 2ZUTA 2FSEA 1EV2E 4PGBA 1HQRA 1E6JL 2E7HA 4NKOB 5GZOC 4R0LB 2YD2A 1NQBA 4WNSA 1F6AA 3C5SB 4X6EA 4Z3FA 4IOFC 5DQJA 1GJWA 3PABB 3VACA 5BV7C 1XIWB 1PEWA 2ENSA 4NENB 1P7KA 4URKA 5I6MA 5KN5B 2J5LB 1BEYL 4Y2DA 1WSST 2EH7H 4GRLB 4MD5A 4IJ3C 2LHAA 5D7LE 4P9HL 1L9MA 2IH1A 3QUMA 5K69A 3ZJAA 5BUPA 5LBGA 3N43B 3KYNA 1LYQA 3QH3B 5ECGA 5I1AB 3K6FA 4AEHH 3QJHA 1OP5H 4MBOA 5MERA 4X5LA 1YNLL 4CW1B 1KCUH 3HFMH 1PXRA 2J57A 4LLYB 1P69B 3FUIA 3HBQA 3NCJL 3H7BB 1PG7W 3NCEB 5F7DB 3OKDA 4PRHE 2VXSH 2VT4A 3C60B 4I4WB 4Q9QL 2YLKA 1CD1B 2OQJA 4JY6B 3WHE1 3E3QE 2D8KA 4IRJD 2BWQA 5EN2A 1QYGH 2HT4D 3MJ8A 3ARPA 5HHOE 5LG1A 3I3BA 1E4XL 2B3RA 2Z73A 2C34A 5LGHH 2Y5TB 4EI5D 3LRSA 1ZLSH 4WJG3 4JO2H 4S1DD 3Q5OA 5KVEH 1OPGL 1XGRA 1P84J 2FUTA 3WIIL 2NY6B 1HJCA 4U6VH 4YC2B 1M7XA 1PX8A 2WWOA 2N4IA 1F18A 1TT6A 1WFIA 1Z6JT 2OSLA 3MNZB 3TU6A 5DS1A 1FZJA 4PI0A 3CXFA 4ENED 4M5YH 4G7SB 2GJRA 3Q8AA 4NM8L 4EUPH 5HYQB 2WO3B 2ZKHL 1OAKH 3EO1B 5JIPA 5I6PA 4H8HA 1QPKA 4MQXD 4NO0D 2VDRL 2NRDA 4LP8A 3QE5A 1X5AA 4PRPB 5ETUB 3RDTB 4P5KA 4A7QA 1A1NA 2OW6A 4PJEA 3MTXA 1YAZA 2P8MB 2EDRA 3LB6D 3FPXA 2CO1A 4UTCA 3DOIA 2WQVA 4X5XB 2EVGA 5DHYB 2NY2C 3CX5K 4BA0A 3WKNA 1Q0EA 1JMXA 3OSKA 2I69A 5IZ7A 3ABLB 3OGCA 3HJEA 2MQCA 5INDA 3V4PH 1RUPH 4PS3A 2VYRE 3N41F 1M7UA 5BRZE 3HG4A 2R15A 3WE6B 4R4FL 5I1EL 2Y7MA 5F1KC 2XQ0A 2Z55A 4HWNA 4U31A 4XC1H 1ORSA 5CMAB 5EOTB 1ZK5A 4NKMB 3HCVB 1KB5H 2EZ0C 5EEXA 1B0GA 2EIKB 2ZCHH 2HFGL 4GKSB 4GBRA 2OI9B 4OSUL 5DD3L 2WZ5A 2G5UA 1D7DA 3R8QA 4KGLA 3U9PL 3AWFA 4XNUH 5DYOA 1P5UC 4YX2L 4N28A 1JZ4A 2YK1L 2VAJA 1SBBA 3G5WA 4U1HA 1DVTA 4TVPL 4HVBA 2AQPA 3TBVA 1T03H 2E7LA 1WE5A 4QOKA 4HD9A 4DPBX 1RJYB 2DQDH 1CICC 3VRJB 3MREA 1A4KA 1E4HA 4F7CA 5MI0C 5AWZA 4MA7L 5HDQH 4XNYL 1D9KB 3EDEA 4D9LH 2OMZB 4EI5C 5CS7A 3HG1D 4P46D 3PJNA 5FM5M 1GYUA 3FF8A 2YDVA 2AQRA 3P1VA 5F2FA 5JNYB 3TF7C 1MW2A 2X3BA 4U49A 4NC1C 4JGMA 5D7EA 1A3QA 3EJCA 1O7DE 1JGJA 1W9XA 3EYVB 3ARDD 3AXHA 4L3EE 4NKDA 5DXWA 3X12A 2ZWLT 4R3SB 4AG4L 1N5YH 4ZNCD 3X17A 1YY9D 4WUKH 3IDJB 4RCAA 5JW4M 3Q13A 1GGTA 3OXRA 4MMXC 2XWTA 3GLZA 1BYPA 2R23B 3HE7D 1BF5A 4BEYA 2ZZUT 2WQ8A 3MV11 4Q6KA 4RNRA 3PLYA 5ABAA 4AQAB 3MCLH 3NJKA 1HYSC 3QIBC 1CI5A 4YNYB 1IQWH 1ZT1B 2LU3A 2E6JA 2BRDA 2ITDB 1EIBA 2DMHA 2EIJB 2XN9B 4BVNA 5DWUH 3MRPA 1VFMA 4LDLB 3NTCL 3VXTB 2BSSB 3BH9B 4GAJH 5CEZH 4OGXL 3ZDYF 4U3XA 1A7PH 2LNLA 3SKMA 2EUWA 1YEFL 2H0FA 3ES6A 5EOCH 3PWPD 1DBKL 5CBEA 1DVXA 4BRJA 2YRPA 1BECA 4N86A 1A25A 4BJLA 2B59A 2XPYA 4PD4J 1NEUA 1N8ZB 1CL7H 1T20B 1FNFA 2ORBH 2EICA 3BWUF 5B3JF 1E5CA 5DJCB 4TSBL 2FX9H 5F7MC 5C08D 1SUJA 3ABMB 3E2HC 3RZWA 3A47A 1GZPB 2PCPA 1FO0B 4N1CA 1OSZA 5F1OB 2CR3A 2DEYX 2FBJL 3KPMA 4M7JL 2FGWL 3LS4L 4DJMA 4RAUA 1SYVA 3SDXB 3SYOA 3B9VA 4TTDD 2FWSA 4PY8J 1PFOA 3VB9A 1FFNB 2GJ6B 1W0VA 3O6FB 1NPNA 3TNNB 3F2LA 2VDOB 3WOVA 1RZFL 3AFLA 5CJ5A 3VXMB 3IJ8A 5T1DL 1PPIA 4PJ5A 2YRLA 3U46A 1LE9A 3QAPA 1W8NA 1UH2A 4P46C 3IJSB 4KZ0A 3KPRA 4MCMA 3VSVA 3MN8A 3ULVC 2NY7L 5BQ7B 1A7BA 1YNKL 2XV6B 2CK0L 5JJNA 1EHKB 4A7GF 3O41B 3BRDA 3C12A 3VTMA 5DVMA 3UEQA 2XQYK 4JAMA 2BNQB 5I19L 3QUHA 3MV8A 2YEVB 1RZKC 3UTQB 2HP4A 1YY9C 4P07A 5FECB 3DUSB 3K8KA 1WBZB 4LSPL 4MCYA 4A38A 2NCEA 3DX4A 3CHPA 1RIVL 4ZZKA 2JV6A 4HJJL 1EUUA 1IAKA 1Q38A 4XP4H 5I75C 5FHAL 3MLVH 3PWJB 4BQ8A 3WENA 1MY7A 4OKVA 3QFGA 5FGCB 2LR4A 2ZOKB 3ZGHA 4HSCX 5I1LA 1XH2A 3FCBA 3HFFA 1S5HA 5B39G 4ELMB 3H53A 3Q0HA 1G1KA 1DDHB 4F33B 5DEJA 1A3RH 4QXWA 1X5FA 5K9QG 2J6WA 4LRNH 4PR5A 5D7LD 1DUZB 3DHPA 1OOAA 1JXGA 3MOBH 4A4MA 4H8WH 4UQBA 3A6CL 3WN5C 1OEZW 1F41A 3KGUA 1KEMH 3V0VB 1YEJL 3ULVF 3BKYL 3WTWA 2W9LA 4J8RA 3WUWA 3I6GA 4R7DB 2FK9A 3ZIMA 1G4MA 2CLVB 3ZLQC 4OCWH 2Q9OA 4QCIB 3GJEB 3KGRA 2FJUB 1EAQA 3W57A 4LVNB 3QUKA 5E8OB 3D39B 3QYMA 2VLKE 3C5XA 1TYJA 4HCRA 2ATKB 2Y7SA 1TO4A 5AYUH 4DKTA 2Z8RA 5JHMA 4FCHA 3MV7A 2WJ5A 2WBXA 5F9JB 1CLYH 3CUPB 4HIJB 4J3WA 4AEIL 3PREA 4KXBA 4XX1G 3QQNA 3FUEA 1UT1A 3H3BC 1DZEA 2ZZLA 1IARB 1KFAH 1TCRA 2R69L 3CXHK 3UAJA 2W60A 3OX8A 3BN9C 1S7XB 5KTEL 1EHXA 1KC5L 1FIGH 3DSFL 4MYPA 3IVKB 3CXDH 2PW1B 3NPSC 4AVIA 1XWVA 2PLTA 1VGKB 3TCXA 4C56A 4RFNB 4ODXB 4UUJA 3QULA 3PWLA 4FNLL 4W68A 3TZVB 2EDTA 1U0QA 3BWSA 4CGTA 3RY4A 4DAGL 4ZAKD 3RY6A 1UGNA 2O6EA 3T6WA 3D3VA 3ZHKA 4DVRH 2CHZA 1PKQE 4PV9A 4HK0B 3FO0L 1V55B 3F7VA 1QFWI 1ZHNB 4XPBH 1QSEE 3NQKA 1NWPA 3UP1A 3EBIA 2ARWA 4H40A 5GISL 4DNLA 5FOBA 2GFBA 2YUXA 5BXFB 4WV1B 1NGWB 1M1XB 3RJDA 3LN4B 3C9MA 3BP5A 5DUBB 5BZDA 5IJVA 4P5TA 5HGAA 1R75A 2Y7QA 1F8TH 2TSAA 2I5YL 3KNBA 4JM2D 4JVUA 4GW5A 1C1EH 1EO8L 3EJQA 5BRZD 3FC8A 1G1YA 5GRUH 5CSZA 3MU3A 4Z3JA 1GS8A 4CADA 4RMTA 3E6FB 2VXTH 1CGSL 3HTLX 3C6EA 3CLFL 5H2MA 1U3NA 1T2QL 3RB5A 3CX5J 4NYLB 3S4SA 4XPHL 3BMVA 3Q1SL 1E9PA 2H3KA 4ISVB 1WTGT 2OMVA 2JKLA 4LCYA 1K8DB 3TFBA 1DQLL 1KBBA 5I17B 2K8MA 2AJUH 3GSXB 4TUOA 1MNNA 3GHBH 3LH2H 3PXJA 2A6IA 4AKQA 2NW2B 3CZLA 4TS6A 3OAUL 4YZFF 5C70A 2FAUA 2Z8SA 1KLGB 3L3OC 4X9HA 1IC7L 4XVJL 5KJ7E 1RU9H 1NL0H 4OFVA 4MDJB 2CRZA 1U8LA 2ZIDA 3NY9A 4DKFL 4P23C 4XOAA 3DYPA 3MLZH 5IB2B 2EVFA 3QR2A 2QGEA 4G43B 4JB9H 2Q8AH 1GYAA 3DV4B 3RGVA 5HDBE 4HK3J 1IKFH 1DVUA 1U93B 1PQZA 3D18A 4NPYA 4S0SD 3ZE0F 1AQKL 3QXTA 3R8BB 3HAEH 3CAFA 4M6NH 5HPMA 3R1GH 1S52A 1ADQA 4QKXB 1NEZB 2VN7A 3T8MA 3L6FB 2XNAB 2Z0UA 1OAXH 3A22A 3QEHB 4L3ED 4XNMB 1TTBA 1IQDA 2CGRH 4PLOB 3REWA 4XHJC 5E9AA 4O5LL 3ECWA 3T8XA 1ZPLA 1D5BA 3SE3C 4MJIB 1YN7A 2LAAA 1DE4A 4H8VA 1AP2B 4K3HA 1V3LA 5JXAL 4EA3A 1IL1B 3DPBA 4MRCA 1U8JB 5FV2A 4PGCB 4YDLB 2YCYA 5D93B 1G84A 5CM1A 2BS9A 3PJLA 2G9HB 1HE7A 1HCVA 1EEZB 3DDFA 3L3GB 1TJGH 1HI6B 5KANI 3OLIA 1LQSR 5KSUB 5JUEH 1F4WL 4XNBA 4FULA 5AVYB 2X42A 2HG5B 3ARVA 4HUWB 3TPUA 1R3LB 1HOCB 4WDIB 2H0JA 1UOWA 2IDUA 4R0LA 4JKNA 1N6QL 4UV7H 1EFXB 3C5SA 3N42F 4JG1H 1ZGLM 3PABA 2KZKA 4L4TE 1MDTA 2XA3A 1S7QB 1XIWA 4EBQH 3MKKA 4AEHL 1LL1A 4X6DB 4NENA 1ESOA 2NXZB 5TK4A 1UAZA 2EDNA 4OFYD 2WQRA 5KN5A 3NZUA 3U2SB 4CUCA 3VG0H 2FQGA 2GI7A 4GRLA 1VHPA 4O02B 3N3EA 4C54A 1QKZL 3KM1A 3BD3A 3PGFH 1L5GB 3QH3A 2FWLB 3FCSB 3NSFA 5I1AA 1A1MB 3LPPA 4RRPM 3A5VA 2DQJL 4G6JL 4HAGA 1DYZA 5CFHA 4LQFL 1QM8A 1U19A 4CW1A 1SN2A 2ICEC 4KO5A 1QYGL 3SE8H 2YCXA 4NN5C 4FBZA 4LLYA 4NS0A 1FYTE 2E86A 9PCYA 4DGIH 4UDUB 3H7BA 3O81A 1B4LA 1MLCA 5KVEL 5IW3A 4I3RH 1ETB1 4JY6A 1U8CA 2EUXA 1O7DC 4JRYE 2CBOA 4L4JA 5D5ME 3N06B 1QASA 1G9HA 4AWJC 1N6VA 5IMOB 5CJOH 3I9GH 4OCRL 2Y5TA 4FYTA 4NO2B 5LGYA 5ITEA 4DPAX 5JR1L 3H2WA 3M1BB 3DX9B 3W39B 3ISYA 1XV8A 1B2WL 5KEZA 2DMKA 3QYNA 3NY8A 3S36H 3MNZA 5DCCA 4G42B 1UACH 3T3ME 1PJWA 1OQOA 2XXMB 1WAEA 1BZ8A 2XT1B 4EEEA 3ATEA 5HYQA 2DRUA 4BDVB 3VD0A 3K2KA 4O00A 6FABH 3EO1A 1WRFA 2VM9A 4OFDA 1KWKA 1HEJC 1ZIAA 1BIHA 1AG6A 3KLHC 1CGUA 1RUPL 2ZCZA 4PRPA 5ETUA 2VR3A 4KRPC 3RDTA 5CCKL 2A73B 1QRNE 1ZVSB 1OP3H 2P8MA 4L8SC 1AR1B 4GAYB 5HGDB 1CLOH 4X5XA 2JJVA 2PETA 1WFMA 3QORC 1KEGL 4K8RD 4UT6L 4YSSA 4MZIA 1PY6A 2FEJA 2VJ8A 4DP5X 4GSDL 3DA0A 1CU4H 4K71C 1OARH 1S9XB 3B3IA 1M2VB 3LN9A 4HT1H 4XNUL 3WE6A 1HZLA 1OM3H 4MJ5B 2VLKD 3S2CA 5CMAA 5EOTA 5DUMH 3OMNB 4NKMA 3HCVA 3CVBA 3P4NB 1LEKB 4GKSA 1A7OH 2EILB 2XWEA 1JHKL 3R7QA 5J9PB 1N67A 5HDQL 3THMH 1UOLA 5IEHB 3IETB 4D9LL 2F93A 3UCQA 2BVQB 2YD3A 4CKVX 4JFPA 3ZO0A 2WYIA 3HRZC 1ZGLB 5I6XB 2XX0A 1RJYA 4XTOA 3PXLA 3VRJA 1HZHH 4P2AA 1KTCA 4ZMYA 2CO3A 1D9KA 5DRZB 5EU7E 5GJSL 2V5TA 1GC1H 2B20A 3CXHJ 3RIFK 3CLEH 4HIQA 2GCYB 4TVUA 2DPKA 1NGQL 4NN6B 4NJAH 4WUKL 1CFSB 3H4FA 4KJPC 5T5FA 5JNYA 3HMXL 1CD9B 2HJLB 3DGCR 5F7LB 5H2PA 5CLWA 4IDLA 3AQZA 1MIML 4TNEA 3EYVA 2P80D 3MCLL 4IGBB 4R3SA 2WUBL 5FX3A 5IMLB 5KVDE 4ZUVB 5K9OB 1IQWL 4IW4C 1NAKL 3IDJA 4HLZH 1TEGA 4O58L 2VO5A 1AVAA 1NCWH 1WWAX 2R23A 5DWUL 5LBSL 5FS5A 2JJWA 5LCVL 3ESUF 2VDLH 4F9LC 1AHKA 4GAJL 5CEZL 3EJZD 4AQAA 1NUDA 4EIBA 4MA1C 3HW7A 4L1HA 4YNYA 5JHAA 1ZT1A 5F3HA 5AFAA 1AACA 1G7PB 2OMNA 2ITDA 4XNDA 2XN9A 3GRBA 1IIKA 4LDLA 4FNSA 4WHYH 3VXTA 3GMOB 1FNSL 1E8YA 1UJTA 2BSSA 3BH9A 3CSPA 3BAYA 5FGBC 3UTZB 2ORBL 4M7ZB 5E51A 2J4YA 4E9VA 4E9QA 2NXYD 1RI8A 1I9JL 1TITA 3EDJA 1B6DA 2WXOA 1L3WA 3AGWA 3QFJB 2DV6A 4NUJB 4TRPL 1HNGA 3HLKA 4YSQA 4B7IA 5CZVH 5H4ZA 5C07B 2F5BH 1N8ZA 1C8SA 5B35A 1T20A 1I3VA 3I9AA 3K2UH 3NYAA 2JAGA 3KLQA 5DJCA 3S88L 2LABA 4NT6B 3WLBB 2G4EA 4JUSA 3MGTB 2KSBA 4R5VA 5LWYL 3MRJB 1GZPA 1QZ1A 1FO0A 4DP7X 4D8PB 3VXSE 5AKVA 2BCKB 3FONB 3SDXA 2P5EB 3V0HA 3T0EB 3G6JB 3WJJC 1FFNA 1W15A 2GJ6A 3TNNA 1CTNA 1FH5L 4XMWA 3VXMA 4O9HL 4GFXA 4M00A 2J4WH 4TQPA 1U8MB 1GZMA 3POHA 4Y5VB 3QRFM 4TULH 3DC0A 4J6RH 4F7PA 4E0RB 3BUPA 3IJHB 4Y4HB 1A2YA 3IJSA 4F8LA 1S78D 2O72A 5BQ7A 5I28A 4PTTB 4AK1A 2IAAC 2FO4B 3DJZA 2EI4A 3NYKA 4W4OA 5FKPB 2XU9A 3VSUA 3ULVH 1S9VA 3D33A 5B0WA 2VDMB 2WXRA 1A9VA 3VI3F 2BXYA 3O41A 2D7QA 2VOTA 2IC2A 1ZLVK 1OSEA 2F08A 2BNQA 3INUH 4MAUL 1TQVA 5HYEA 1UA7A 3EYUH 2JI1A 3DUSA 3RPBA 2ZUSA 4GT0A 1WBZA 2EH8H 1RZKH 4U1SB 1AHWB 1IIIA 4Z7OE 4LEXL 4TTGA 4OZIB 4HEPA 4RA3A 1J5CA 3EJZC 1FSKC 3UTSE 4GRWB 3PWJA 4XAWL 3L4ZA 3CU7A 1QFHA 2P8LB 3F04A 3F7QA 3M1CA 4KHXH 4LRNL 5ANME 5MP6H 4YEEA 2MRYA 3OPZH 1DJXA 4H8WL 4ZW3A 2ZOKA 3GHEL 5E2VL 4M48L 4L4TD 4XO5A 2VITB 1KEML 4ELMA 1MJ7H 4JM4L 1DDHA 4JE0A 4F33A 2EAEA 1Z32X 1C12B 4PCKA 4PY8I 2FL5A 3DVFA 5LAXA 5ACZB 3WAJA 1DUZA 3BFWA 4OZFB 1CE1H 4A37A 3HG5A 5HVHB 1ZS8A 4WKZB 5EORL 4XTRD 5CEXB 1T5WB 4LCIL 4AZ8B 4HCFA 4X4XB 3V0VA 3OBAA 1CLYL 4I0PD 2CLVA 4BIKA 4G7RB 2V0AA 3GJEA 1FYTD 1YNTB 2E7CA 1AS6A 1KFAL 5DVPA 1I3RB 2WWMD 5E8OA 3D39A 2X87A 4S1SH 2GTZB 1FIGL 5IQ7L 2ATKA 2ENJA 3LH8A 1BZOA 1PBYA 3CXDL 2D2CC 5F9JA 5J7AA 1ZTMA 3CUPA 4KTYA 4HIJA 4JRYD 3WIHA 3DROB 1IEAA 2K7PA 4FS0A 3P3UA 1T89C 1YLBB 5C0BE 3NQIA 3IN0A 3QUYB 2B0SH 2DQEH 3G5ZB 1BDYA 2FZ3B 4G7YL 4N8VG 1S7XA 4AVHA 4DSYA 1F1AA 1HDMB 1HHIB 5JMOC 3IVKA 2PW1A 4FXLA 4DVRL 1WS8A 2Z91B 1IAIH 2B77A 3GRGA 3RZCB 2Y4SA 3QUXB 2DQIH 1NKOA 1VGKA 3ARQA 1B0RB 4OCXH 4S11A 4W9LC 5ANHA 3ULSB 1I7ZB 3CVHH 4ODXA 1VB9A 4GQZA 5EA0H 3TH2T 3TZVA 1FBIH 4ACPA 4JJ5B 4FNPA 3SQBB 3B1TA 4BK5A 4HK0A 2VRQA 4FADA 3Q8BA 1HE8A 3Q06A 5FYLH 2QVKA 3QXUA 3W9DB 4ZNEE 1WUNT 4FQXB 4J3SA 1QRND 4NKIH 1INDH 3TWCL 1X3DA 3MOAL 2YKLL 2BRRH 4AENB 5BXFA 1YVLA 4WV1A 1N19A 1NGWA 1EERB 2J73A 2R9HC 3NDYE 1M1XA 3LN4A 4LU5L 5DUBA 1YYMH 1KG9A 2JCCE 2ZKXA 5DYFA 2JKXA 5BQDA 4R90H 4GY4A 3LKPB 5J12B 1GHFH 4C83B 1S5IH 5LWEA 1CE6B 2UXFA 4J6IA 1ZA6B 4FZ8L 4PBWD 3KWUA 3LH2L 1TLMA 3BGMA 2FECI 3L1GA 4XMVA 3VG9C 1H9DA 2UZXB 1MJJB 4POUB 3Q3GB 4NYLA 5E9DD 1NL0L 4AIXA 3WCYA 4ISVA 3L54A 1K8DA 5I17A 5FJGA 3QNFA 3GSXA 4DKEH 8FABB 1PU0A 2VLRE 3FFOA 2NW2A 5SWZB 3ULUF 1KLGA 1X5IA 4G8FB 4JB9L 1UD6A 3FTVA 1IKFL 1LEGB 1U8HB 3IAQA 3LZOA 4CA4A 1T0OA 2OSXA 3GINA 4LSRL 5BZWB 4KQ4H 4M6NL 4MDJA 3TEXA 1MFVA 1HX0A 2NT0A 3L9YA 1XH1A 1U3ZA 2IO5A 3QS3A 4G43A 3HI6H 4YXKH 1UT2A 3DV4A 3KS0J 1L6PA 3AVEA 1U93A 3BIKB 1VFAB 4JKLA 3WBDA 4PREB 3E9TA 4NBYB 3ZHDA 1TPXC 1NEZA 3WFZA 1B3JA 1M9SA 1RIUL 4PFEA 4PJFE 2FX7H 2XNAA 3L6FA 5HHPB 1YJDL 4XNMA 1U6AH 4OV5B 4ZMQA 2BH0A 1R5WB 1KCSL 3MJ7B 4MJIA 1GCYA 1TJGL 3MJ9H 1AP2A 4GLRH 5DUJA 4QKTA 3NMEA 1IL1A 5EZOL 3GM8A 1U8JA 2NYYD 1EEUA 4PGCA 5E94B 5JXEA 4UHRA 3I2CL 2HKAA 1UD5A 1H0DB 2ENYA 1D3CA 1YMMB 2AZAA 5LN4A 5LQBL 2G9HA 1EEZA 4UV7L 3L3GA 3P3TA 3JTTB 1HI6A 3UXFA 1F4AA 5KSUA 2CCLA 1EA9C 3P4LA 4A2GA 3FTSA 1YPZE 4OR1A 4B5ZA 4EBQL 1AC0A 2GTQA 2BFVH 3NP4A 4ONGH 2HG5A 4HUWA 5E7FA 1R3LA 3GPSA 4TSCH 4HMDA 1HOCA 3T3PF 2DQHL 4K2UL 4WDIA 3GSRB 4AC4A 3QI9D 3B9EA 3VMPA 3KJ4C 3VG0L 2DI8A 2F53D 5DJ2B 1NIEA 3KW8A 2NY0D 3WQJA 1S7QA 2ZNWA 4HFWB 4X6DA 1UUSA 3L9BA 1MI5E 1BZDA 4V11A 3U2SA 3QJZA 2B4CH 3QUZB 1N64H 1OLLA 2X1QA 1VEMA 4O02A 3SE8L 3VYOA 3ZSTA 4CBPA 1U8IB 2PCXA 5EEWA 1VESA 2K4WA 3VXSD 4DGIL 1H6TA 1L5GA 1OCOB 3PQYA 1U3YA 2EINB 5I23A 5JPMB 3FCSA 5F8UA 4E9WA 1A1MA 5E7BA 2A5UA 2BJMH 3DETD 1UCQA 4YHML 3BAIA 1YYCA 1CFQB 5JW4R 4OV0A 3ECQA 3BPCB 5CLXA 5I6NA 3Q44A 4IRZA 1F58H 3BLPX 4P2QB 3I9GL 4KJYB 4BWUA 1HHKB 5SWQB 2E7MA 4UDUA 4HCRL 4P8QA 1A6UH 2BVPB 2JQMA 1CF8H 4KKBD 2P9RA 1IGJB 4LGRB 1ZS2A 2NY5C 3HN3A 3ISWA 3KWTA 2OCCB 4ODUB 4NQED 5IMOA 1UACL 1WH0A 3FCGA 3CMGA 1BEXA 1QUNB 4WK2B 5F9WC 3X1NA 4EN3C 4FA6A 3BH8B 4MB5A 1R0AH 2UZPA 3W82A 1NC4D 4NOFA 3MV9B 3D51A 3M1BA 3DX9A 1AFVH 2B2XL 3QDME 3WFEL 2WANA 3W39A 2NYYC 1IVTA 4W93A 1NFKA 3V0FA 4JHAH 3UTSD 3QPKA 2VLLB 3EYOB 4G42A 3O6LH 3IFOB 3EJUA 3JWDC 4WO4C 5L6YL 3CC5B 3HE6D 4OLZH 3B5TA 1FL3B 1CLOL 1FI8C 2CXKA 3U0PB 2MTAA 1FHNA 2NNAB 1RUMH 1QFWM 2X89D 1UXWB 3HS0C 4PJDE 1SPDA 1AH1A 2FWOB 4R26L 1R4XA 2FJHB 1TCMA 2IDCA 1OARL 1WFOA 5B38B 2A73A 2KLRA 3O6KH 1ZVSA 4GI6A 1GOFA 4XE5B 2QPSA 4GAYA 5F71A 1OM3L 1MCEA 2C4FT 5HGDA 5HBBA 5E24E 3GSNH 1EHLH 2OCJA 2EECA 2NY0C 2ZQKA 1PF3A 5DUML 2A9ML 3T2NH 5AENA 3K7UA 5BV7B 4GQRA 4MLSA 3T6ZA 1A7OL 2Y06H 4YHIB 1YNTF 2UWEB 3FAXA 4OBRA 4DHLA 3AY2A 4GRMB 1OLZA 1G7LB 1S9XA 1M2VA 2HB0A 1MDAA 3FQTB 3KEDA 5CJXC 3THML 4IJ3B 4GKZB 4MJ5A 2L0DA 2H45A 1H3VA 1QEXA 3RBGA 4LSSL 5EEYA 4YVUA 4IOSA 4XP6L 4I88A 4HJ0C 3QQXA 3ASNB 4YE0A 1CGVA 3P4NA 1LEKA 2KQMA 1RP9A 2IPUG 3QGVA 5TE6H 5J9PA 4PJBB 4DN4H 5C0BD 1GKEA 4PWGA 1SMOA 1S7WB 2AQ2A 1J88A 4QHLB 4AYBA 4ZO6A 2EDYA 5IEHA 2IPKB 3IETA 4ZUWA 1IUZA 2BVQA 3CLEL 5F1SA 4KFMA 3WYRA 4L2LA 2QADD 3ZR5A 1ZGLA 2QZQA 3Q1EA 4M62H 4ESKA 2XQBH 5F9DC 1NEPA 1OTSC 5DRZA 3FTZA 3ULAB 2MOGA 1CD8A 1WEJL 2DBJA 2MNWA 4JRXE 2GCYA 4HSAC 2EDOA 1CFSA 2IANB 4LSQL 1ADQL 3RX5A 1MF2H 3OWEA 4RRPA 2HJLA 4ZQKB 5IVXF 4M5ZL 3ZL1A 5B4MC 3IAGC 5KZCB 2CBMA 1TUPA 4HLJA 4PRAB 1PX3A 1INEL 4UTAA 1QW8A 1T0NB 1WAAA 4IGBA 3I3DA 3AUWB 3G5VB 2R59A 3Q5TA 4NP4H 4ZUVA 4U7MA 1Z0MA 4F57L 4JR8A 5K9OA 5JPNC 3HC4L 1NMCB 5I8KL 4AC2A 4M4RB 4Z7UB 4N5EC 3VXPB 5KSBB 1FPTL 5KW9H 3K72B 5D2LB 5EIQA 1L0QA 2JB6B 3KAAA 2P42B 3Q6GH 4XBPB 4GMSH 4BZ1H 1Z5YD 4YHLH 4IHOB 1G7PA 1WISA 4BA8A 1LWRA 3L1EA 2YJQA 1UM5L 3QG6B 4FXKC 3CDYA 1KPVB 4HEME 2WLIB 4MWFB 1NGPH 1IZKA 5CHNB 1J8KA 3BZ4B 3S34L 1KMEA 1P6WA 4H88L 3GMOA 4EAEA 3P4OB 2AK1H 3UTZA 4I13B 5L9DL 4QJ4B 1ICTA 3WUZA 3DECA 4EOWH 3QFJA 1AXTH 4NUJA 1T2JA 5T3XH 3TX4A 1DBJH 1UVQB 1JPEA 4FG2A 1FC1A 3IYLW 4M9PA 1E40A 1FH2A 1KPUB 2P3YA 1G1OA 4JQ6A 3ML9A 2ADJB 3RX7A 4NT6A 3WLBA 3MRNB 5DHEA 3MGTA 5H2LA 3DI3B 1P5UB 2A38A 3MRJA 4TULL 1ES0B 3FOLB 3MXWL 5E56A 4D8PA 2RALA 5C09E 2BCKA 5KVFH 3FONA 4XB7A 2DI9A 2P5EA 2YGQA 3F65A 3V52H 1UADC 3G6JA 3T0EA 3VI0A 3SDCC 4IRJB 1CICB 3BDYH 4J2QA 4WFHE 1HIMH 3MA7B 3ZKNC 1V7NH 4BK4A 1U8MA 3FBKA 4Y5VA 4NEHB 4EI5B 3INUL 3TO2B 4B96A 4E0RA 2R1YB 3IJHA 4Y4HA 3UZCA 3EYUL 2X6BA 1NBVH 4A04A 2EH8L 3V6ZB 3FB8B 5L2JB 2FO4A 4AMJA 5FKPA 5AZUA 1O7VA 1G6RH 3RKDC 4OF7A 1N4XH 4MNGE 4XNQA 1DQML 2MCPL 5L8KB 1CGYA 4BV0A 2WTRB 1J9RA 3HNVH 4MDRA 4JY4B 5CLTA 4JFDE 5T1MB 3G6AB 3ZMNA 4CMMB 1UZ6E 1DUYB 4RIRB 3C09B 1CUOA 4POZC 5DVLA 5IHZB 4U1SA 4Y5XC 4NQSB 1YMHB 4MMXB 1MWAH 4NO0B 4TQ8A 3W0WE 1HU8A 1I7RB 2R2EB 5FIEA 4TPRL 1RZ7H 4OZIA 5EBMB 3VWKD 5ABDE 1THCA 7CGTA 2IFGA 5C1MB 4KLYA 2P8LA 1T3FB 2W0LA 2ZSVB 4HWZB 1CE1L 5B6XA 2J72A 2VLJE 1IBHA 4UB0H 5MHSE 5AOJA 2VITA 2HX7A 4Y19D 2VKXA 5E6YA 1MI5D 3REYA 2CIKA 4PMEA 1C12A 2GABA 3QJUB 3ARGD 1Z66A 5ACZA 3CSGA 4OZFA 4AIZB 5CEXA 1SOQA 1NCGA 1QAWA 3NRFA 4WKZA 1T5WA 1YC8A 2V5SA 4JG0H 4S1SL 2BM3A 3OE6A 1J9TA 4HBCH 4AZ8A 3QYCA 4X4XA 5T8IA 2OV0A 4HUUB 4KZDL 3JTBA 4M7LH 4Y9HA 1HS6A 4WI7A 4POYA 3ZRCC 4M6OH 1NIDA 1B88A 3QW9A 2M3GA 3GF8A 2B0SL 2DQEL 1I3RA 1LK3L 3J7HA 2DBLL 2GTZA 3EGSB 5BPPA 4DGYH 5FYKH 3ZTNH 1LHZA 1IAIL 5BUGA 3NJNA 3DROA 3RILA 1UT9A 5D71H 4OCXL 3FQ4A 3AAZB 3EOTH 4B7LA 1JG9A 5EA0L 4JLRB 1X0I1 3QUYA 3DQBA 4H5SB 3G5ZA 1KMGA 3L45A 2FZ3A 1VLXA 4JR9H 4WLCA 3HG1B 4P46B 5L0QC 2DTMH 2AC0A 1FGVH 3LZNA 1HDMA 1HHIA 4JKWA 1GXEA 2X4NB 3S9DB 3QDMD 4LE8A 1VCAA 2J3SA 3GRWH 1DJWA 3RZCA 2YQGA 3QUXA 1BYNA 1OTTC 3FO2B 1T7XA 5FYLL 5IROA 3ULSA 1B0RA 4OGAC 4P2OD 3GNML 1TLKA 1TF4A 3ZKMD 1INDL 2CO4A 2VUYA 4B9IA 4J4QA 3I50L 1DVFD 3ULUH 4WTQA 4EUPG 2XTJE 3SQBA 4PN6A 4R90L 2VQUA 3KM2A 3VWKC 5I75B 3HE7B 4FQXA 3ZE1E 2O6CA 4OKDA 3AYNA 3BD5A 2GY7B 1GY1A 3UADA 3OAWA 3U25A 1OW0C 4AENA 2JMRA 3IGAB 4O4YH 4KKCD 2BY3A 4GQQA 4AGNA 1OAUH 1LQBC 1YQVH 1II4E 2V9RA 3GBNH 3LKPA 2XWRA 2QMKA 1YRKA 3AG1B 1CE6A 3EFOB 1ZA6A 2BNRE 4MQSB 4PRNB 3VXQA 2H0EA 4W9JC 3PWPB 4S0TD 1MRFH 5D7SH 1TTUA 4JY5L 5I8EB 4CSTA 4G8EB 1MJJA 3Q3GA 5AOZA 3OMIB 2EYTB 5CUSH 3T2LA 4XP1H 4KQ4L 3HUJE 1PD0A 1IGCH 3EBHA 8FABA 4AQ1C 1KJ3L 1U2HA 5C08B 2ZAHA 2J21A 5SWZA 1Z3GH 4G8FA 4F27A 5FOJA 1USZA 3F62A 1LEGA 1U8HA 5KUMA 5BO1H 3OF6D 2E4TA 3RVTD 2OP4L 2E27H 3COCA 1MRDL 2VC2H 4TSAH 5JIKA 1QTPA 3FQXB 4EKJA 3DX6B 3DXAE 4JPWH 5CGMA 1ZDQA 3JV5A 1CK0H 3DO3A 2GW5A 1FO0L 2Y1VA 3IN2A 4JRXD 4LKCB 1U6AL 2X9XA 3QWOB 3ZMEA 5KBMA 2G3ZA 2NYKA 2ZX7A 3BIKA 1VFAA 1WF5A 2N0MA 4J7RA 4LAQL 1R24B 3ASOB 3MJ9L 4PREA 3NPSB 4FYSA 3S98A 2VDOL 4LCWD 1EO7A 4ZUUB 1T21B 5HHPA 4RDQG 1D5RA 1A5FH 3ILPB 4OV5A 1R5WA 4PWJA 3MJ7A 2KKQA 1C8PA 2L6XA 1RAMA 1EGJA 2F61A 4JDEA 3FL7A 3VI4F 4PJEE 4LOFA 4PSPA 1XZ0B 2BFVL 3CN2A 3D2UD 2AV1B 3GBML 4KRNA 4ONGL 3ARBD 4ZO8A 5E94A 3GXMA 1JF1B 2C3WA 2OXGB 3EJSA 3QIWD 2WV3A 3V4VH 1H0DA 1YC7A 2AJXL 1S8DB 1YMMA 4M1GH 5AOMA 4MD1A 1O5DT 2CQVA 3JTTA 3K4ZA 2QMJA 4Y9CA 1IAOB 1MH5B 3VFSB 1I3GL 2APWA 4MXVE 3TPKA 5J4MA 4X1HA 3OAYK 4KXZH 4WQOA 2G30A 2FBRA 2P46B 4KZEL 5GRJH 3WKQA 4YBHA 2B4CL 3GSRA 3NK4A 3VXOB 5D7LB 5L88L 2YSSB 5ADOH 2IAMC 3VXUB 3HJ0A 4FFTA 1PGRB 1SXZA 1FCCA 4PCTA 5DJ2A 4A7VA 4AITA 5DJ0A 1VAHA 3SPJA 2JB5H 3G9AB 2HT3D 4AYDC 1MCHA 4FLQA 2VLMD 2NSXA 2ENQA 5TPWH 3NABH 4HYJA 1JK8B 1HESA 2HRGA 3NIGE 3BCFA 5EG6C 3QUZA 4OIBA 1TG8A 2XWBB 4DOHB 1DJHA 1U8IA 4XX1E 3OB8A 1ZLWH 2CCVA 4ZMPA 5C09D 4PRHB 1A6UL 1RZJC 1EXGA 5ALBH 3DLQR 5J1AB 2P5PA 4I89A 3DHMA 2ZWYA 1CFQA 2XWXA 4NO5B 4OZHE 4MCNA 4E5XG 5HDOA 3BPCA 5HHOB 4G6ML 4P23B 4PJ9C 4KJYA 4M6AA 4LBEA 2XKSA 5SWQA 2BVPA 1R0AL 2C1OB 2G9KA 2MPAH 3QIUD 1JZGA 4XHQA 1IGJA 1ZLUK 3BW9B 4PMFA 3OKMB 3WIHL 3EO0B 5AZDA 1G9MC 2I32A 4LCVA 4HCGA 4KKAC 2W9EL 3KWWB 4ODUA 3U30C 1HH9A 1PZ3A 2HT2D 5JA9A 4N0FB 2K9FB 4M8UA 1OSYA 3O6LL 4PV1C 3WIAA 1QUNA 4PJAF 3S3PA 3BH8A 5T3ZE 4L5FE 4XMLH 4ZAKB 5I82A 5JORB 1RY7B 3UYRH 5J06A 3MV9A 3GJFB 1S9KC 3W0WD 3PG2A 3CODA 4N2NA 1FRGL 2GHWB 1PTZA 2HLEB 2VLLA 3EYOA 1NCBH 3LNEA 2QQKL 1P6FA 3IFOA 4OJYA 4U4IA 3CC5A 1AIFB 1FL3A 2QLVB 3UG3A 3U6XA 3U0PA 2NNAA 3NFSL 2WBKA 3T2NL 2L04A 3E8UL 1M4KA 4OM1L 1J5HA 2RQ8A 3ARFD 2FWOA 4BQ9A 1RH8A 2FJHA 5BRZB 2Y06L 3SBWA 5B38A 2IWFA 3LYRA 3ETSA 4UZSA 5GZOA 4LP5A 4Y1AE 1IKNC 3MLSH 3J07A 1CXIA 2PR4L 5F88B 2IG2H 4TV3A 3P30L 4YHIA 2UWEA 5TE6L 4DN4L 4GRMA 1G7LA 1S3KH 2EEAA 3FQTA 1E42A 4DAJA 1LMIA 5GIRB 1ODAA 4J4PC 3PP4H 3S5YA 1XSKA 3UG4A 3C08L 3GXIA 2XVGA 4PJ5E 5KVGL 1AGCB 4PJBA 4PLJC 1MFDL 1S7WA 4QHLA 2Q1EA 5B8CC 1BM7A 4FZEH 3D25B 2CM6A 2ZWKA 2IPKA 3D12B 4NN5B 1EVTC 5E0FA 2IMNA 4J27A 2ERJC 4FQ1L 4PWKA 4ZS7H 5LXGH 5IBUB 1ZT7A 4IEFB 4NWUL 2D03H 2PW2B 3Q8EA 4RLDA 1N59B 1J0YA 1GR7A 3EHBC 3QDHA 2H8PB 2VXVL 3AREC 4LDEB 3H42H 2AJVL 1J5DA 2JJTA 3HPJB 2J43A 3PDOB 4KRLB 4DEPC 3CIAA 3QZNA 4L3EB 4M02A 5EB9A 1CFNB 1GS7A 1WFNA 4K7PH 4X6CE 3BUTA 3BEWB 5C9JB 3EFDH 5JIHA 4X80L 4H0IA 2IANA 1JXFA 1D2OA 3E0GA 4EZMA 1VKXB 4ZQKA 1NAMH 1HCYA 1WG3A 4PRAA 1T0NA 1N0XL 1N7MH 2BVEA 3G5VA 4BZ1L 4CN4A 1XF3B 4Y2DD 4YHLL 4FTVE 1BJ8A 3AY4A 5I9QC 3SODB 2KZ1B 4NQDE 4W9CC 3FFCE 2QPDB 3ARFC 2IFFH 3CK0L 4LKXB 4M4RA 4Z7UA 1JGDB 2O26U 3SHSA 5I5IA 3VXPA 4G82A 5KSBA 3A0OA 3VGEA 2BNRD 1AJ7H 2Y3AA 2AK1L 3K72A 4KRPB 4RBPK 5D2LA 2MTPA 2JB6A 3NCMA 4XBPA 1ZLEA 4N5UA 5G4MA 4IHOA 1B6UA 1P7BA 5KVMC 3MA9H 5T3XL 3V79C 3SQRA 4GAGL 3QG6A 3QORB 2WLIA 4MWFA 5CHNA 1Z9SB 3BZ4A 3W37A 3WD5H 2XV0A 3UPAA 4RZKA 3VX1A 5IESH 3WHE0 2J8UE 1E12A 2VZ1A 5A2KH 1A6AA 2K0RA 1JYWA 4PJIE 1UM4L 3GSOB 1MFAL 1NINA 4HC1H 1NKRA 1DJZA 1UVQA 4QHKJ 5KVFL 5KBDA 2OCFD 4FYQA 2XZQL 3N5AA 3V52L 4ALAC 1KPUA 5J8OA 3DXAD 3LY6A 3QCTH 2ADJA 5ACMA 3UJJH 3MRNA 2DIEA 1V7NL 1P5UA 2ICCA 2DY2A 1ES0A 3FOLA 3EJPA 3CFDB 4KKLD 1H3PL 1IGML 2ZOOA 4MDIA 3FUDA 3MUZ1 4M6MH 1NBVL 2F19H 3HAEG 3HRZB 4ODVL 3VH8G 4PH8A 1ED3B 4IRJA 1WZLA 1CICA 3S5LA 4IRZL 3B2DC 4ZS6D 2XWJB 3UBXI 3F7KA 3DUHA 3MA7A 5E5MB 3GKWH 4EI5A 2XTJC 3TO2A 5HGBB 2PYFA 2R1YA 5DFVC 5JHDE 2I85A 3MBWB 3V6ZA 3WAKA 5L2JA 1TQSA 2HMID 2CWRA 5CZKA 2W91A 3QHFL 3FT9A 5C7XH 3DARA 2APFA 2WXHA 1RZ7L 4UWQB 1E2ZA 1AP9A 5D7IF 2H41A 5I2IB 3FUHA 1B9ZA 3ABKB 1THAA 2WTRA 4JY4A 5T1MA 4CMMA 3G6AA 5I16B 4RIRA 1DUYA