3EH3B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
166
Chain Sequence
b'DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
source organism Thermus thermophilus
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
total genus 36
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh3B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh3B02
1ILSA 3FSZA 5G54A 3WKPA 2VW4A 1A4CA 2BZCA 2WJLA 1VJMA 1OCZB 2J5WA 3UTVA 3PPSA 3VW7A 3NSFA 3QJQB 1M9WA 5ITEA 3UG9A 1MG3C 3S8FB 4E9YA 1N70A 1ZV2A 2B3IA 4F2FA 1NIDA 1OV8A 2GC4C 4BXVA 2MRYA 2VW6A 2HLEB 2PPEA 1SNRA 3D12B 5C1MA 2Y1AA 2JFCA 4HCFA 1AS7A 2VM4A 3WNJA 4A68A 2IWFA 1HZXA 1KG9A 3UTYA 4N6HA 2WO3B 4XXJA 3PAZA 5H2MA 2I85A 4A66A 5AKRA 2EILB 2FNWA 1N68A 3VHZA 2MTAA 3GDCA 4PXFA 2I7OA 3NSDA 4BWWA 4HALA 3CG8A 4E9RA 2ZZLA 2HX7A 1X0K1 4XT3A 1MG2C 3CDZB 2ZFEA 3UGEA 2IWKA 2A3TA 2IH8A 2XLLA 3OMAB 2J4YA 1AOZA 1SF3A 1IW6A 2VSKB 1W6LA 2H47C 5I5MA 2IAAC 3C9MA 3UZAA 5F7AA 3WNIA 2IDQA 3IEAA 3NJJA 4MD2A 3V2YA 4DP6X 3NP3A 3QBLA 1S51A 1SFDA 2L6XA 5I6OA 1DYZA 1JZEA 5D4JA 4N4YB 1X9UA 2JXMA 4KOCA 4YSAA 1FBKA 4L6RA 1PY0A 1KV7A 5H2IA 3FQ2A 1V10A 1OF0A 3FT0A 3X1BA 3ERXA 4MQTA 1X9RA 1J9RA 3AY2A 4AZUA 4X31A 3IE9A 1KCWA 1E30A 1W6WA 4YVUA 4G7RB 5H2OA 2FTAA 1TN0A 4KNSA 1QKOA 1LN6A 3QJUB 4A4MA 3FU9A 1KYAA 1IBYA 1BYPA 5B34A 3T45A 3ASNB 1FA4A 1M0MA 2DWTA 2QDWA 3HAQA 3JT2A 4AI7A 2N0MA 2HXAA 3L45A 3QDCA 3ABMB 3EH3B 1L9SA 1NIFA 4YSCA 1UCQA 2EINB 4Q8BA 1T5KA 1NIEA 2EI4A 2GIMA 2WO2B 4HHWA 4A2EA 5F7BA 1PLAA 2BP0A 3KJ6A 1CUOA 4CSZA 1ASQA 1E5ZA 4QLWA 5G28A 1RZQA 2CCWA 4JKNA 4YSUA 1L0MA 3ABGA 2OJ1A 1J5DA 4YSOA 4AX3A 1DZEA 1S52A 1S8LA 3OAXA 4FA7B 1AP9A 1AS8A 2PP7A 3FPXA 4N8UA 5B1AB 2UX6A 2W88A 5H2NA 5B7EA 4HHGA 4HWLA 1NWOA 3CODA 3QJTB 2DWSA 3ZPRA 3D4SA 2PPAA 3T71A 3TU6A 3FU7A 3H56A 1JXGA 3QBIA 2YCYA 4QIDA 3TA4D 5ETZA 3OE6A 4DAJA 4KNFA 5ITCA 1BXVA 1V54B 3FU8A 1KDIA 3NJNA 4MFHA 4DP0X 5A8EA 1ET7A 1BRXA 1PXSA 1WS8A 2FJSA 3S8GB 2GHZA 3OD3A 5TK4A 4E9VA 5I28A 3X2QB 1BEXA 1BQRA 1KMEA 5G36A 2XV2A 6PCYA 3X1EA 1QKPA 2WJKA 2FQDA 3CAPA 4XTOA 2IWEA 5B1JC 3WG7B 4UF7C 1NTDA 1CURA 4N4WA 3U25A 4K9JA 1JERA 3NJFA 1AT9A 3ABWA 3BQVA 1KGBA 5I6LA 1J9SA 2J55A 1P8HA 1ET5A 4EJ4A 1JOIA 2BP8B 2ZONA 4GXFA 4P5RA 1KCBA 4BXSV 5B6VA 1AANA 1ZIAA 1OCRB 4BWBA 2VN3A 3VI0A 1TKWA 4HCIA 3T9WA 1ASPA 2Z55A 3T6VA 4DP8X 1IC0A 3QQXA 2GBAA 4DPAX 2QPDB 4DPCX 1RZPA 4Y9HA 1F88A 5B6XA 1NZRA 2XWZA 2YQBA 5B35A 1AZNA 1CC3A 1E5YA 2H5UA 1YLBB 2JKWA 1PZBA 3A7KA 1OCCB 2PPFA 1TN5A 2IDUA 2XVBA 3CZUB 4FPDA 4A2GA 2YCWA 3SN6R 2I7SA 3EH4B 1GS7A 1WS7A 1AACA 2XXGA 1E0PA 3T6ZA 2YXVA 1HAWA 2YAFA 3OQRA 3HAOA 3P0GA 4FBZA 4YSSA 4JHVA 3FU7B 4IB4A 4UHRA 2R4SA 5EHFA 3ABLB 1W8EA 3X1GA 5JJEA 2GSMB 2AT9A 2PLTA 3NY9A 4X1HA 1NICA 2X87A 4AKPA 2Y01A 1KBVA 3AG3B 2BO0A 4XTNA 4J4QA 5E9NA 2QT6A 3DKHA 3FPYA 3FS9A 4KNTA 1SJMA 3NJGA 3ZIYA 4HIPA 5J7AA 2YAHA 1H2SA 5B7MA 2BWDA 5B6YA 3UACA 3PLYA 1UAZA 2Y03A 2BHFA 1X0I1 3UZCA 4LDEA 5H2LA 2PP9A 5B7FA 2YAEA 2B08A 5AHYA 3OE8A 3RZEA 1OE3A 1WA1X 2BP0B 3HARA 4QKTA 1JXFA 4GYBA 2E86A 1AG0A 2JAFA 4GY4A 2YAPA 4A2DA 4CSPA 4W9ZA 3NY8A 2TSBA 1NDTA 3QPKA 4M3HA 4BEYA 1F56A 4UAHA 3MX0B 1TEFA 2HRHA 4YL4A 4E9XA 3NSCA 2JAGA 1GS6X 1ILUA 1PY6A 3OM3B 1C3WA 1BQKA 1C8SA 4GP4B 2YDVA 5I26A 5I5JA 5EN0A 3VGAA 5PCYA 7PAZA 2CUAA 5AX0A 2F93A 1ZDSA 2QDVA 4E9TA 4UG2A 5B3SB 3FSWA 5FC9A 3QJSB 2P80A 3QJRB 1HFUA 4G7SB 3NYKA 3PCYA 5IY5B 4P5SA 2ZWNA 1AQ8A 3MBVA 1GY1A 1GYCA 1AS6A 2FT8A 5B6ZA 5AX1A 3NJKA 1ADWA 2XYBA 1M57B 1NPJA 4HYXA 4NAJA 1BM1A 3TBBA 1SDDB 2HX9A 2PPCA 4AMJA 1SDDA 4AKQA 2I20A 4LDOA 3NYAA 4G71B 2I21A 4QRYA 5AZUA 1M56B 1WA0X 2BRDA 2VSMB 1P8UA 3QAKA 2CJ3A 2IDFA 2CALA 5AWZA 3AZUA 6PAZA 1CYWA 5I6PA 4ZK8A 4BUOA 1PLBA 1JVLA 2BWIA 5ANHA 2YAQA 2RH1A 2H3XC 1NIBA 1M0KA 3DTUB 2Y04A 1GS8A 1A4BA 4WAVA 2ZXWB 2XV0A 2XV3A 1E12A 1GSKA 2AANA 3V9EA 1F4ZA 1XB3A 2BZ7A 4MBSA 5B1KA 4IAQA 5B2NA 1PZAA 2J57A 1AG6A 1BYOA 3HB3B 2G87A 4DKLA 2Q5BA 1ZIBA 3ABKB 3UAAA 1P8IA 2I35A 1BXUA 1L9PA 2BW5A 1R2NA 2NTWA 2EIKB 3CVBA 1XB8A 5KKHA 1B3IA 1BAWA 2YDOA 3IBOA 5BR2A 1JZIA 1PCSA 2FQFA 2IH9A 3AYNA 3PBLA 3FSVA 5JJNA 4TL3A 1PNCA 1TU2A 2R4RA 5G53A 4E9QA 1AR1B 3FYIB 2OV0A 4IARA 3SBRA 3VVKA 4YSDA 1JZGA 4JR8A 2J56A 1OE1A 1DZ0A 2WSDA 3NS0A 2XX1A 3FYEB 5B1JA 3SQRA 3ODUA 2I1XA 3AYMA 3V2WA 4DP5X 4YSRA 1A8ZA 5LDUA 2R7EA 3WKQA 1XB6A 5I6KA 3EH5B 5G2AA 4BEZA 4G72B 2PEDA 1PAZA 1I53A 4JQ6A 3EMLA 3N2JA 1BRRA 2BW4A 3EF4A 4X32A 1GUEA 1AAJA 2Y69B 2KSBA 2TSAA 1URIA 3CVDA 2HZHA 3EHBB 3IN2A 3NP4A 4WTQA 3AG2B 2FQGA 4BDVA 1A65A 2EIJB 3AW5A 5TGZA 3X3CA 1PXRA 3V9CA 1EZLA 1JFPA 2KSYA 2YCZA 3AG4B 5DYSA 3OMIB 1MZZA 1VGOA 1SHWA 2GB2A 1H68A 3ZPQA 2PCFA 4KO7A 2PP8A 1KG8A 5AFAA 2FWLB 2UXVA 4KO9A 1GR7A 3QBKA 5D4HA 3RYMA 4NC3A 1PZCA 5A44A 1ETJA 3PQRA 4DP4X 1NWPA 5A45A 4E9WA 3VG9A 4EF3A 4MQSA 4AMIA 5A7EA 4BWUA 4KO6A 3NJHA 1A3ZA 3NJMA 1JV7A 3PAVA 5H2PA 4BVNA 3RFMA 1BQ5A 8PAZA 2KS9A 1UATA 2EIMB 3COCA 3DIVA 3KW8A 2BP8A 2RACA 4L35A 2AZUA 1U19A 4DP7X 4YSPA 4X4KA 1L9HA 5AZDA 2P80D 5B1BB 3T6XA 2YCXA 1OE2A 2UX7A 2XU9A 1L9TA 1KDJA 4DP2X 1JVOA 5AHZA 4DJHA 1KGYE 1NPNA 1HAUA 1XJIA 3X1NA 4WKXA 4YSQA 1WA2X 1ET8A 1IKOP 5TK2A 1M0LA 1JGJA 2DV6A 1ZDQA 3UTXA 3WIAA 2F95A 2UXFA 1RCYA 5JJJA 3UAEA 3UONA 1S54A 2DYRB 3CVCA 3X1FA 3C75A 2CBPA 2NTUA 4GYCA 4RH4A 4FAAB 3C9LA 1QHQA 2VT4A 1FBBA 3NJLA 4YSTA 3PWHA 4ENZA 2AFNA 2DY2A 4DP1X 3JTBA 2GC7C 4HCGA 2YARA 4KLYA 4KNUA 1O0AA 1J9QA 1V55B 3G5WA 3SBQA 3OMNB 5PAZA 3NSYA 2XX0A 1AZCA 3IN0A 1R1CA 5I5IA 4GP5B 2Y00A 3ZEVA 3ZBMA 1MGYA 1R84A 4GRVA 3WI9A 4K5YA 1F50A 1AZUA 3UABA 5B6WA 1GY2A 1WAEA 2NRDA 2X72A 1XIOA 5B0WA 2GI0A 4MD1A 1IW9A 2YAMA 5FJGA 2W8CA 3QBGA 2LNLA 1QM8A 2VM3A 1C8RA 1L9QA 9PCYA 4HYJA 3S3CB 3ASOB 1EHKB 3GXUB 2X88A 1Q5IA 3FSAA 2VW7A 4PCYA 1FWXA 1X0SA 1GU8A 2R7EB 1S53A 4M4RB 1FFTB 3H4FA 4TXVB 4PAZA 3TBCA 4A67A 1SHXA 4AKOA 1SF5A 4BWTA 1SFHA 3UTWA 3BVDB 3REYA 3N55A 2KSAA 4GBRA 4LDLA 1AIZA 3QJVB 1KBWA 1QNIA 2FQEA 1GZMA 3HEIB 4E9SA 1GW0A 4DPBX 1JZFA 2YAOA 1L9RA 2FT7A 2OCCB 4BV0A 1PNDA 1ASOA 2YXWA 3TASA 4UANA 3NSBA 1VLXA 3SBPA 7PCYA 5H2JA 3DQBA 3GYRA 4G7QB 5I6NA 2AZAA 4G70B 4NERA 3PDSA 4OV0A 3S3DB 2Z73A 1QHJA 1ID2A 4EA3A 5I6MA 1OCOB 4A2FA 1BXAA 2PCYA 4XT1A 1CYXA 1PF3A 5DHGA 3CDZA 2HRGA 3AG1B 4DP9X 3HASA 4NB7A 4XTLA 2UXTA 2M3GA 4KO5A 3UADA 4WW3A 2CAKA 3WQJA 1L9OA 3PXOA 1MZYA 3FQYA 3OE0A 1J9TA 1NINA 4QI1A 2FT6A 4YVNA 4W1TA 4PXKA 4EIYA 1JV6A 3PAUA 3KW7A 4Q89A 1Q5JA 5H2HA 2XUWA 2PPDA 1AZBA 4F7KA 2ZIYA 4GPOA 4JKVA 5LWEA 2AVFA 3HANA 3DDLA 2VMJA 3NJIA 2QPEB 1MDAA 3PXLA 1JZHA 1TEGA 3HAPA 1QLEB 1IUZA 1PMYA 2DYSB 2IDSA 4JHUA 3X3BA 3MBWB 4HZ1A 3ZX1A 1JZJA 3OE9A 4GP8B 2Q9OA 3FQ1A 3NT0A 5G2CA 1PLCA 3T6WA 3S3BB 2ZOOA 4L0PB 4BK5C 5G2DA 5D4IA 5F8UA 1E65A 1AZRA 1XMEB 1JXDA 1OOWA 1ZPUA 2IDTA 3AM6A 2XXFA 1S8JA 3QAPA 1NIAA 2Y02A 4A2HA 5BR5A 1IBZA 4BDVB 5H2KA 2HX8A 1CWQA 2UXGA 3ZDWA 1J5CA 1RKRA 3H4HA 4HAKA 5DHHA 1IXFA 4F2EA 2HPYA 1A4AA 1BRDA 4YSEA 2LLNA 1E67A 4KOBA
chains in the Genus database with same CATH superfamily
2D03H 5AAWC 1ZLUK 3WKPA 1A4CA 3RIAK 3VO0A 2APSA 4FE9A 3V6OC 4KUZH 4F91B 5GSRB 4NFDA 4WWKA 4KKBD 2NQDA 1H3WM 1KTJA 1J0YA 4EE2A 3N42F 3LKPB 3B37A 2VM4A 1U92A 4FQXA 4FKEA 3ATDA 4L8SC 1HWWA 1ORSA 2IFFL 3EGSB 2FNWA 4QJ3B 5T3ZL 3ZL2A 3OPZH 2OZNA 1K72A 3VHZA 3CC1A 3MV8B 3FT1A 1M6UA 4ZI8A 1A7OH 1NBZA 3QORD 4N0RA 3RFZC 4AITA 4OFVA 1RHHA 3LMJL 4PHXA 2A3TA 1GAFH 1JF1B 5IW1B 4YNYA 1DL7H 4ZUVA 1U8IA 1EAQA 3DHPA 5F7AA 5EOCH 5JQ6L 3B7UX 3VTAA 5F1KC 2Q86A 3NP3A 1R3HA 1Z5HA 3TOPA 3VFOA 2FLBT 4AW7A 3BKJH 1LWHA 1TYRA 3D2TA 3FOLB 1HSAB 4I3RL 1JNJA 3DMMD 2FDBP 1RZKH 1G0YR 1USQA 2AJVH 3CPUA 4S1RH 3FO2B 3BJ91 3DUUB 3IDUA 4A6YB 1FGVH 4AWJC 1E30A 1OP3K 4FFZH 3ULVD 2OSXA 3LPFA 5IJKC 1CQYA 4CUCA 2Z8VC 4OVUA 4YDJB 5HGBB 2ZOLA 4JK0D 3LKNA 4PJ8D 4XAKE 5CZXC 3S37H 1IBYA 2CGRH 2EJ1A 2NYYC 3WEXB 2ICWJ 5IMLB 1MCWW 5D1ZB 1NC2D 3H9ZA 4ZNEA 2ICEA 4XNYH 1HL8A 1XVSA 3VSUA 1HEZA 3T3PB 4CU6A 2XN9A 3KYMA 5D1QB 3RU8L 2FR4B 2FRGP 5JHBA 2DRUA 4RZCA 2NY5C 2Y23A 3D9AL 4I4WA 1P5UC 2DTSA 3QFDA 5AW9B 4Y4FB 3TTYA 1XH3A 3QDJD 5DFTA 3KXFE 3A6BL 2E9IA 2XN9E 3ZDXB 1AP9A 3IU4H 3ZHNA 2B5IC 5B7EA 3IJHB 4EIBA 5HGDB 3DVIA 1PGRB 2BSSB 3QDGD 3K8KA 4QYOB 3CSYA 1DVZA 3Q2LA 2OMXA 4HKXB 4GAAA 3P4OB 4PTUB 2W07B 3C5SA 4MFHA 3U48A 2CZNA 3U4BL 5MP6H 5F7HA 3PL6B 4MHHI 4QTIH 3UDWC 3ZW3A 4EI6B 2RMNA 1PLGH 2R51A 2TRYA 1MRDH 4F57L 3GJFK 2OW7A 1BG1A 1CLYH 1NUDA 4DQOH 2FQDA 4LMQI 3X3GH 5MI0C 5FOBB 4WI4A 4LCIL 3I3BA 3LN5B 3DI2B 3S35L 2Y7QA 4U6HA 4YAQB 1E9QB 4XOEA 3NCWA 5C8JB 3NCCB 4GAJL 5AKVA 2A9AA 3GMLB 2J55A 4LLMA 1ND0A 2NY2C 4QOKA 5ICYB 2BP8B 2WSPA 2BRRL 2H45A 2MQCA 1OCRB 2IXQA 4PRHB 1TKWA 4KVCL 2YRBA 2QQLH 1FGVL 1BD2B 4XN2A 1IAIL 3BAEH 3TYGH 5E5UB 3JTSB 4FQ2H 3UAJA 4HLZH 3RB7A 4G7YL 2KH2B 1QSFE 1HTYA 1F6LL 4OSUH 2JKIS 3OAYK 4JG0L 1J0KA 1VHPA 3DVGA 4FZ8L 4HSCX 4XP6L 2M1KA 2XVBA 4PJGA 3HCVB 5A2AA 1CFMA 2V5MA 3L3KA 1YAIA 3F7KA 1ZLSL 1BQLL 2LLGA 3IFNH 4JFPB 3DRTA 4JM2C 1DEEA 1WF5A 3QUYC 1DUYA 2YD1A 3MRFA 5FYLE 2OMWB 3SDDD 4XCCH 1QLRB 1F02I 1T5WB 3OKEA 3TXAA 2XWBB 5KW9L 3LPWA 4F9PC 1UQSB 2KDYA 4Y16A 2DQCL 4CL7A 4DKEL 1BJ1H 2IPKB 1EVUA 3VU2A 4LBAA 4NXKA 1YN6B 1QACA 5IFHH 4JGJA 3HNVL 2XWTA 4H4NA 1UD8A 1WZLA 5DURB 1ZVHA 2F58L 4GYBA 3BZ4B 4NJAL 4ZO9A 3VB8A 1JPTL 5JIHA 4CSPA 4G82A 5K93A 5EF3A 2D4FA 4HAFA 4ZZFA 5EH1A 3UZVB 3SQBB 1QSEE 1YCSA 3MX0B 3NDZE 1C1EL 5HI3D 3WS3B 4DAGH 4ERSL 4NKMB 4IJ3B 2JAGA 3FQNB 2R2EA 5F88A 2KZWA 4OQ1A 5EN0A 2AKRB 7PAZA 5ISZA 1A3QA 4JR9L 2ITEA 4NQCB 1PSKH 2YEVB 4MNHB 4ZDHA 5KVDL 4G9FA 4N0YH 4MB5A 4F3FB 3SYPA 4P5SA 1SXZA 2BFVL 1AQ8A 4OJCA 4XO8A 3QDMD 4UTBL 3KBHE 1P4LA 3VNZA 1CLYL 5CIPA 5HDOA 2ENSA 4AENA 5CEZD 3MROB 4G5ZH 4Z95L 5FO9A 5FA3A 1A7BA 1G9MC 3O2DA 2IV8A 1C16B 3HNSL 3WIHH 4NNYB 1EEQA 1M6OA 2BRDA 5HYJA 4YHML 4X6BA 4N87A 1JD7A 2Y4SA 2ISDA 3ECWA 1F4YH 3IDGB 4PJHA 3DGDA 5BJTB 1C08A 4NN5B 3MLTB 2WINA 4GIOA 3K71B 4KY1L 4P46C 5C3LD 5I1HL 1EXGA 4MLIA 4L8DB 1I3GL 4IAQA 2QR0A 3HNTH 1UJTA 3LS5H 4YHYB 2QMKA 4P2RD 5JIKA 1XH0A 3HI1A 4HJGA 3GMPB 1MCOL 1LO0L 4GIPD 3UAAA 1BZ9B 4P05A 2ED6A 3AADB 1BAWA 4MJJA 3CHQA 3U36A 1PCSA 2IH9A 4CDGC 3GTVA 4YMPA 3PBLA 5FM8A 2B39A 1FNEA 2CO1A 2NY4B 5JW4M 1E40A 3ARRA 2R0KH 2GK0B 2ZOTA 4M61B 2VH5H 3D69B 1OW0C 2YMXH 4GW4B 3NS0A 4H20H 5AEAA 2I1XA 5JXAH 4XP9L 3LNHA 4JPVH 2ICES 3MLPA 1MWAH 4KRPB 2YD5A 1NGQH 3BSGA 1CT8A 1TCRA 2J8UA 5IZ7A 4NQXB 1A3RH 1ZT4A 1AGBA 4QWWD 4FFWC 3D87B 5BOZG 4WTQA 3D39B 2H8PA 4P9ML 5E6ZA 3KNBB 4F7MA 4UT6H 1PYWB 3VGBA 3EBGA 3TT1H 3ZDXE 2A7BA 5TGZA 2VQTA 4IIQC 4Y2LA 3VXRD 3OMIB 1G5AA 1CIDA 1UD6A 4FQJH 2E7DA 3QNZB 2PCFA 2BVTA 1LMIA 1HJCA 2UXVA 4KFZC 3WXVH 1D7DA 3HMWL 3VQ1C 2AJYL 4G8GA 3U2SB 3K6DA 5EO1B 3SDYH 4C58B 5EN2B 3S88H 1KCVL 3VFUB 2AXGB 3AREC 1PKQA 3H3KA 1K8DB 1ZE3H 2CLVA 2FCBA 2ZSVB 4JRXB 1A3ZA 4QRPB 1F2QA 5E5RB 3TTSA 4KI5F 4PJ8C 3KW8A 3KBEA 4WNJA 2NNCA 4XCEB 5CZXD 1H6EA 2PXYC 4UTBH 1JV2B 3GBEA 4LOUC 3C87A 2WIIB 3B9VA 1RURH 4QXUL 3WENA 4BSWA 2ADFL 4WKXA 1NFKA 3BIKB 1QUNB 5L9DL 5LNEA 5I9QC 3ZTJH 4L2YA 2BSCA 2DV6A 1FBIH 2AEPH 1JGLL 1H8NA 1LQBC 4ZS6D 5CN2A 2PTTA 2IGFH 1OSZA 1UJ3A 3RX5A 4A38A 3C75A 1WBYA 3G6JA 3LRHA 3PPEA 1PAMA 3G6DL 3HIZA 2XVLA 1NGYA 3GLDA 1BF2A 3W3BA 4KLYA 4KNUA 3STLB 1O0AA 3VH8A 3QFGA 1CYGA 1XIWB 1I7TA 3RJDA 3T0AA 3OMNB 4PLJD 2A9BA 3NSYA 4N2KA 1PL3A 5E6RB 4EN2A 1ROWA 3K80A 4GP5B 2VE6B 3N5AA 4LLQB 2QQNH 3OR7B 2LAAA 4TUOA 3HMXH 1VEOA 5JPMA 1X4ZA 5TQ0L 3MV9B 5TE7L 4PJ9C 5IQNA 3WSQH 2X72A 1XSIA 4GT7A 3WDIA 1XIOA 3RJOA 1JS4A 1N0LB 3HS0C 1IBGL 1Z1WA 5DZNA 1MF2H 4HOMA 2ZZUT 3FTGB 2X89A 5B3NA 1FL3B 1L9QA 3E1F1 1KOAA 2X6UA 4XMLH 5FW6A 5D1XD 3SJVD 3PDOA 2YA0A 4MMYA 3DBXA 3E6FA 4JFDA 4IRZL 4LSSH 1S53A 4Z6AT 4IS6B 4F15C 1T04B 5ESVA 4G6KL 3TBCA 3ZKSD 4JDEA 1J48A 4FXTA 3DJRA 1JL8A 3UTWA 2BNUA 4HEME 5EO0A 3A0OA 2CO2A 3PP4L 2Y6TE 3DETD 1EFXB 2ZKXA 4YHPA 1GZMA 3HEIB 1QZNA 2W9DH 4KHXH 4MYWB 1XGZA 2DD8H 1JTPA 3FONB 1J0ZA 4PBXA 4BV0A 2H6PB 1J1PH 1S8DA 2KPWA 1FVDA 3ZKND 2AZAA 2WLLB 3POCA 4G80A 3RILA 2DS4A 2DQHH 3OL2A 3VFVB 1NEUA 2YPVL 1RUPH 2B8OT 4NO3B 1GC1C 4EZKA 2H6OA 4F7CA 2EXWC 3VD1A 3VI4E 4WF7A 1EIBA 5F3FA 3L9RB 3MA7B 3B7TA 4HWBA 4XO4A 2VLRB 3ME0A 4G6AD 2WZ5A 4UI2A 2MCPH 3VGFA 5LGHL 4PTTB 4ZMNA 2EH8H 2OI9C 3HI6L 1MF2L 5BQ7B 1MZYA 4QRUA 1MQKL 4K5LA 3ASWA 1U3ZA 3REVB 2B1HH 1ORQB 1AD9B 3EFDL 3PAUA 3O11A 5T3ZD 4IOFD 1Q5JA 2G3XA 1I9JL 3QNYA 3QQ4A 3U0TA 4K7PL 2OJEA 1QLEB 3ORJA 2IGTA 1PMYA 2XTJB 3CVHL 3DX4A 4HZ1A 4N2OA 3S9DB 3P69A 2WLJA 3C9NA 3T6WA 4BK5C 5LAPA 2OMUA 1N6UA 2ZICA 3BVNB 3WMSA 5LUMA 4PRAB 5F8UA 1JXDA 1OOWA 3OJVC 3EYOA 3F3HA 1DBBH 5C09E 1M53A 2A9DA 4KUZL 3EJYC 3PGCA 4TVPH 2OTUB 3QEQD 4N5EC 4NHUB 4X7SH 1QATA 5DZPA 5JUEH 3RWJB 4HV8B 3UMTA 3UYPA 4F2EA 2BOBB 1TENA 4UNVA 2WVUA 4PJIB 2N7SA 3DLQR 3IDMA 3MR9B 1U3HC 1S9VA 4ANWA 1QSED 2DEXX 3RDJA 2J5WA 3US9A 4XO5A 1YEIL 1U8HA 1AGFA 2JCCA 5BV7C 3WNKA 2Y5EA 1UWGH 2R0ZH 3EDKA 4WI0A 1KTDA 5E2UH 3BW9B 5IB1A 3I9PA 2AF2A 4G6KH 1KB9J 4PJXF 4PB9H 4OCYL 5CZVL 1BZ7A 4PS3A 1B2WL 3NQKA 5I30L 3QWOB 1CDHA 1GL4B 3FBQA 3QRBA 4U0RC 4A6YH 3M45A 4QXGL 4I87A 3EAKA 2FE0A 2I07B 4E42B 4LCYA 1PTZA 5BUPA 2YLHA 2Z7WA 2WQXA 3OXSB 4BWWA 4X6CA 2NXYC 1RIVH 2JKTM 4M7ZB 1FZJA 1TPXC 5IQMA 2J4YA 3CFBB 3NIFE 4N26A 4ZS7H 1J8HE 1FP5A 3LQAH 4Q58C 4A63A 5CCKH 5BRZB 1I9JH 4QHMA 3HS0B 4N4YB 4Z95H 4YH6A 5AOLA 4EZLA 3DX9A 1JFQL 3FT2B 3ZVVA 1BQHG 1FL6A 1T89C 4HUWB 4H20L 1KV7A 4AGQA 2F0CA 3BAXA 4YPGB 3A6BH 4MNQB 2NX5D 3DK2A 4RSVA 4S1DD 4LLWA 2H2SD 1BVLA 3BIBX 4L05A 1G7IB 4YVUA 3RTLA 2WBJD 1WO2A 2EP6A 1LN6A 1F6FB 3LIZL 2XY1A 3K72B 4YDKL 3SYAA 1X3DA 4PJGE 3T45A 3GO1L 3NCXA 3O6MH 1JZ5A 1JDCA 4M6OL 5MEOA 5IOPA 3B2UC 4RAVA 1N5AA 3MLSH 1A21A 2HJLA 1XEUA 4P4KA 2G2PA 5T33L 3EGXA 5LCVL 3FN0L 5DVLA 4Q6IC 4FQIL 3AREA 1WIPA 1YN7B 3EGDA 1E42A 3BZEB 2N59A 1MCNA 3HZMA 1WWWX 3MOAH 3OAXA 3UG4A 4OKVB 1DSFL 3S2AA 4U1LB 4ZFOA 2AJSL 1UXSB 3WJLC 3FCTB 2A73B 1T1ZB 3GSUA 4U05A 2ZCLL 2ZJSH 1MHEB 3TU6A 3TFKC 4C57C 5BS0A 3H56A 1JXGA 1HZHH 5EU4B 4LCIH 5ETZA 2EVJA 4OGQC 2X6VA 5IR1B 2VZOA 4Y4KD 4L3EA 4D94A 5GZOD 3JWDH 3E2HB 3BT2H 4R0LC 1X5XA 4XP6H 5GRWA 1TLMA 5D1QE 5J12B 2AI0L 1AMXA 4LEXH 3VJ6B 4FXGB 4HH8A 4JO2L 1X5IA 4JZJA 1JZ4A 4U3CA 4XOBA 5DJ6A 5DUJA 4C56E 2ZXCA 1T6BX 4R7VA 4DK3A 1F4XH 2WVSA 2ZAHA 1QPXA 2ZX9A 4EJ4A 3O4LB 5EO9A 3HN5A 4FTVB 3WFCH 4U7MA 4CBPA 1IV8A 1BVKB 1FDLL 2DQJL 2VAJA 1MWAA 4AM0A 4QRAA 3ZGIA 1WG3A 3Q9PA 2D0HA 1S7VA 4C47A 1ZVSA 5J13C 2I9LB 1WZMA 3G5ZA 3V4UH 2GBVA 3LZFL 4XNZC 2AK4A 2N1KA 2X9XA 3T0WA 4JHWH 2OMVA 2NY4C 3D39D 3VI4A 4R7NA 2UY6B 2E7BA 4Y88A 1LEGB 4P2QB 2J2ZB 4JM2D 4FFTA 3RLSA 3VDCA 3BSZL 3JV6B 2YAFA 1A7PL 4QRRD 1KIQB 1G7HB 4AJYV 4XP4H 3FFDB 3ABLB 4HUMB 4J4PC 4XMPH 2PLTA 4IOIB 3EYSH 2XN0A 3VD2A 3FQXB 4EAEA 4I1RA 2BO0A 3RAJL 4J4QA 5JOPD 2X9YA 1TZHA 2VDOL 4LDEB 1MQ8A 4P46B 2EAEA 3TVMD 3UOAB 5J0BA 3LN4A 3BLBA 5A6LA 1KG0B 5ICUA 4PWFA 3J27A 1S4IA 3QUMB 3X14B 4TSCL 2BHFA 4Y1TA 4ALAH 4QUOA 3SDAA 4KMTH 4GB9A 3IGLA 3B9KB 2VUYA 1E4JA 4U6XA 3RTQD 2QFRA 1AG0A 5KN5A 5AD0A 2DH2A 1LP9E 4PJXA 2WUCL 3FRPA 5B8CB 3QPKA 2K78A 4DW2L 1TEFA 4G6AC 3O4LE 5FB8B 1GS6X 1XCQB 5IFJB 1C3WA 5E8DH 4M6NH 4HUKB 3OGOE 4XE5B 4NKIH 3WKML 4K3JL 2Q3AA 3HE7C 1OSYA 1D2OA 2XN2A 5DWPA 3BDBA 2ZYIA 1U8JB 4PIRF 1N4XH 3T3PE 2BVYA 2WBKA 4NUPA 1VB9A 3DROB 4JM2F 3APCA 2MKLC 2FT8A 2EE2A 3KPOB 5D96C 5IVXF 1JZ8A 2YPLA 4PCTA 1YSOA 4F7PB 3RPIB 4HYXA 2WXPA 1N26A 3CPLB 3TBBA 4ANKA 1CR9H 1BYNA 3L2LA 1JN6A 3QO1B 4CMMA 4EI5B 1HH6A 2Z35A 3BKCL 1JXKA 1QEWA 5DJ2B 1JDAA 4HS3A 4FA6A 3I74A 1A6UL 1XQ4A 1QWUA 2FWOA 3MRJB 3VXNB 3SPIA 2GBUA 3P9MA 4GQ9H 2IBZX 2V5TA 2VDML 5FGCE 5IJVB 3KEHA 2N01B 3BPOB 3HC2A 3PIQB 2MCPL 3VAEA 2XIBA 4W4NA 4OGXH 3BQUC 3MNVA 3QUYB 4POZD 4UIKL 4LKXA 4R26H 4BFGA 4NNXB 3CFJB 5MEPA 1Q8MA 3A6CH 3ULUE 1DCLA 3L6FA 1QABA 2GJZA 1TQWA 3WKMH 5DJ0A 3FYIB 4JG1H 4RMBA 4PRHD 1Q9LB 3S88L 1SY6A 4QJ4B 2CBMA 3NFSL 3HN8A 4M1DH 1N8OE 3QIBB 1EK3A 4MVBC 3L5JA 4Y4HB 4Z7UF 1ZEAH 2LAGB 4P8QA 4JQ6A 2A6KA 3EO1A 3HE7B 5TPWH 1IAIM 3JZYA 5A2BA 1AAJA 2Y69B 1DN0B 1KJ2L 4RQQA 2R9HD 1YPZA 3E3QC 1OM3H 1HINL 3UZQA 1KGCD 3S5LG 5I1AB 4MTMA 1B4LA 2YMOA 1VESA 4JRYB 5KYXA 1BFSA 2K9FB 1N67A 4J3TA 1GA2A 2BNQD 3SDXE 1J8SA 2OCJA 5IUSA 2N3JA 4FQLH 4RMQA 4OD2A 1L4IA 1E4KC 5E94A 5I6XC 1XXDC 3QXWA 1G1KA 4DZBA 5DQJB 5SWZB 3V0HA 1D5ZA 1LGVA 4Q97A 3MRQA 4R26L 2ZXQA 3AU1A 3PREA 3MTXA 1I3RA 4Q7DA 1S7TA 2V7NB 4HJEA 3C2SA 4GSUA 5DWUL 5DFVD 3QC5X 2F74A 1J8HD 2YUZA 3GSOA 4U1MB 5CEXA 5ACZB 3EO9H 4TQ8A 2OQJA 4C56B 1LO5B 2K4AA 5DZVA 1QFWM 4GH7B 3QZOA 3OF6A 4P23D 4Y4FC 1ZDQA 2RTTA 3CFQA 1T22A 3ABZA 1JWMA 5MERA 1JK8B 3R7RA 4LU5H 4ZS7L 1FAKT 4MZRA 3WFDL 2VDNL 3BMVA 1UACH 4KHTH 4PY7B 1FC2D 2GTZA 3PHAA 1T89A 4DP1X 2DWEA 2HLAA 2UZIH 3CTTA 4IDJH 1AP2A 3HAEH 2BVOA 5AAMA 5ALBL 3LKRA 3HE6B 5F21B 4MQSB 3HUJA 5CU5A 1KWKA 3C5ZB 2DI7A 2V37A 1WHOA 3HBQA 3KLHD 3H9HB 3GWJA 1H15B 1CDYA 4FQLL 5DEZA 2Z31A 2FNBA 3K81A 3L3HB 4ZQTA 4L1LA 1Y07A 2F1AA 2WM0A 4YS4A 1KYDA 5DMIL 1JWUB 3LEVL 2DD8L 1GY2A 5IB2A 3FAXA 5AW8B 1UA6H 2K6YA 3HB3C 4MXVF 4TMPA 2X7LA 3MUY1 2HUEA 5EOTB 3V10A 1L7TL 5EOTA 3SY6A 1C8RA 4DUWA 3II3A 1CE1H 2I5YL 1YEWA 2X7LB 4BKTC 1J5OL 4WEMB 2ORBL 2NY3D 5IB2B 1I8IA 4EBQH 1GU8A 1IBHA 2DH3A 1EHAA 1SXBA 4LLVA 4TXVB 3REWB 4DO4A 3L3HA 4GUOA 1UM4L 5CJ8A 4JZNA 2R2BB 3G04B 2O5ZH 2VIRB 3KWVA 3FB7A 1IARB 2VDPL 3LKRB 5HHXL 2IMMA 2V8MA 3FN3A 4KDTA 3DYOA 3CQQA 4L3FA 3DSNA 2H1XA 2UZIL 3MSPA 3KAAA 4IDJL 1S78C 1WZKA 3D9AH 2GTZB 4N2EA 4OLZH 4RGOL 4PY7A 1CXEA 4G83A 4JAMB 3PDSA 4NPKA 1Z6JT 3GMQA 3GXNA 1T22B 2RB8A 1DANU 4EA3A 4FFWD 2EDNA 3S3PA 4N1EA 4RDBA 1CYXA 3F5WB 1ZT7B 4LL1A 1PF3A 1REIA 5EF2A 4BFFA 2YXFA 5KOMC 4XVJH 2VWEC 1QSFA 1LO5A 2Z91A 2AABL 3ZU8A 2E59A 3WIHA 4KKCC 3SOBL 5L2JA 3WQJA 1GGYA 3V0AC 2F74B 3C6LA 3UEQA 2UVFA 2ARWA 3CZFA 4PD4K 4KPHH 3ZL4L 3S48A 2FT6A 1HVXA 2COVD 5FFLA 2W0FB 3CXHK 4X6DA 4YDNA 4YEEA 3RIKA 1H0DA 4F8PA 4NRYA 3IDYC 2WB7A 4X4XB 5DEJA 1MHHB 3PXLA 2ZXDA 5DQJA 5SWZA 3S6CA 4DZBB 4O5LL 2EXSA 3MFGB 1WTLA 1BJ8A 1QLEH 3IMTA 4OGYH 4Y4KC 2DM7A 4XO3A 2J12B 3ES6B 3MODL 1NL0H 4PJ9D 1YNTB 3QT2A 3Q9QA 5F8RC 1NKGA 4TV3A 1EJOL 5CCJA 1A1MB 3HZKB 3BP6B 5LBGA 3IMSA 2K3TA 3ZE2E 2IDTA 3PLYA 4HWZA 1NCGA 2I5YH 4Z3JA 3NEXA 4MXVE 1RK0B 2R0ZL 1AR1C 1U3NA 1UWGL 1ACYH 2A9NL 2JQAA 2KZ1B 3IF1B 4K8RD 4IGBD 4LPWA 4X7CC 4HAKA 4G11A 3K6IA 4NCDA 2F08A 6CGTA 2GTQA 4EUPB 2XNAB 5JORB 2OZ4A 3VXTA 2AQ3A 1BRDA 4YSEA 3WD5L 5CP7B 2QADB 2A6JA 3ARPA 4KOBA 2DQFA 1VJMA 2AHIA 4PGCA 5D7KD 2VZTA 1P2CB 2WXIA 1Q9LA 4JGMA 4XH2B 3SQOH 1RZJL 4BXVA 1MUJA 4JKPL 1OGSA 4MASA 5D72L 4OCXL 2PCPB 2GJZB 1AS7A 4Z3GA 4E0RB 2NY2D 1N2RA 4QY8B 1XEDA 4H1LB 5A2FA 5H2MA 2BX5A 1QRND 3QDJA 2OSLA 3GPEA 3QUYA 4A7VA 3NBNA 4O2EA 4TQIA 1XR8A 5EU6E 1NOFA 3ARDC 2B0SL 2EYSA 3TF7C 4WI9A 3LH2H 2X2YA 3BAKA 5B39B 3P9MB 2YD9A 2YKKA 4XP1H 2ZZLA 4OD1H 3VXNA 5KW9H 3RZCA 2IWKA 5KS9A 4HS3B 3OC5A 3T4AA 5KSBE 3ZR5A 5CD5D 1QEWB 2X2UA 1IAKB 3A4FA 4P2OD 5F96H 1RHFA 5FO2A 2IGFL 3BGMB 2FX8L 3BDYH 1FAIH 4S2SA 1F45A 1LK2B 1TSRA 5CEZL 3ZUNC 1WLHA 3QCTH 2D7OA 3SY0B 4NQDB 4KOCA 1FBKA 1P53A 1U8LB 1MREH 1PZ5A 5FUCE 1RERA 3KHQA 4RDQF 4WHYH 4MQTA 1X9RA 4LEXL 5J12C 5F9AC 3V5KA 1RLBA 3LZRA 2G5RA 3D06A 5CU9A 2MHAB 4QHKI 3BO8A 3SHSA 5HPMB 5GGRA 2LU5A 2ED8A 4L1SA 4ABVA 2VUKA 5JNYB 3MBEB 2XXCB 2EIEA 1JIBA 3KM1A 1ONQB 1M0MA 4RGND 3APMA 4KTEH 3ABMB 4JGUA 3FRPB 4JFTA 4OIBA 5B8CA 1U41A 4HUVB 5AD0B 5AB0A 1PX8A 2WV3A 1A7NH 3W82A 5AOMA 2VLKB 3RVUC 3SDAB 4Y7MA 5BRZE 2NQCA 4RGMC 5I8CA 3OKOB 5IF0A 5E1AB 1P5VB 3VYPA 3WOVA 4N2MA 5DLML 5JIQA 4G7VH 2VDOB 3LN4B 3PNRB 2FECL 4C54A 1ZD6A 1A64A 3CK0H 2JI1A 5BO1L 1G7LA 3QJTB 2F15A 3JVGA 43C9A 1O7SA 2EDLA 4LHUB 3LDBC 4L4TE 3QBIA 5DEGB 1MCPL 3FMGL 4MCMA 4KNFA 4FHBD 2J2ZA 4P2QA 4CRPA 4Z23A 2IOOA 4RIRA 4YBLC 4E68A 1L6PA 3FH7A 4KQ4H 2VDQB 1BLIA 1Q0XL 2H32A 2HFGL 1NSNH 3VI4B 4DUVA 2OMVB 2H0JA 1WUZA 3EFFB 4HWEH 3IWUA 2WJKA 1K85A 2I9LA 5ESQB 3SPCA 1OW0A 1ZVSB 1DSYA 2YD2A 3UERA 2CBQA 1CURA 4FOMA 4YUEL 4WO0A 2K8MA 4CN1A 5CR1A 2WUCH 4AM0B 5BZDB 3L9YA 5E9DE 1MJ7H 4KJQD 4BXSV 3U4EB 4BQBA 5MEND 1DLHB 4URTB 5EO9B 3TN0D 4HULB 3O4LA 1U6AH 1FNFA 3U79A 2QTEA 2Q3ZA 2BIHA 3EOBB 4LCWA 1A02N 1VGEH 4GBXD 5DZJA 4DPCX 1DBKL 4PWHA 1URLA 1E4HA 1JNHB 2OTWA 3KCPA 1NC4B 3EYSL 5BO1H 3VYOA 3I6LE 4ESKA 5GGTH 1W72A 4X5XB 3HG3A 4ZT1A 4B9IA 3HZVB 3TS8A 5E2UL 5AAMC 2HT2D 2IH1B 3VM5A 2BSEA 3FUNA 1TT6A 4FKKA 3ECBB 5DD1L 3WXVL 3CGTA 3AG3B 1UXSA 2PXYB 3BUDA 3GSQA 4NLAA 4PG2A 4ZFQA 4D7PA 5LBSA 4HHAB 4Q9QH 4ALAL 3NDYE 3TT1L 1KXTB 2YOCA 4F58H 3E1ZA 3EGDB 3N43F 1MCHA 4M93B 3AREB 2GUOB 3L3OB 1KN2H 4ODSH 2B08A 3A22A 1OE3A 1IBGH 3ZYZA 2YWYA 4YHLH 4A2DA 3GFUA 4LQFL 3VD5A 1U58A 4FG6D 1KYUA 2VN5A 1XCWA 5H35A 1BA9A 3VYNA 4OZHE 4MJ6B 3QHZH 4Z7WB 5IHZA 4PGBB 1GRWA 4IDLA 2P8MB 1KFAL 3HMXL 4LZKA 4ISVA 1KIUB 1SMAA 2R1XA 4WDIA 4ZBJA 3MBWA 3LS4L 4LLWB 2FJHA 2Z8SA 5FHBH 1AS6A 2F61A 2EDYA 3VFMA 4HUWA 3N85L 4X5WA 4ZMQA 1BM1A 3HS0A 4L9LA 1BEYL 2BSDA 5ENWB 2DAVA 3MNZB 5CCKL 2YC1B 1QR4A 1WQVT 1AR2A 5FDWA 2KHAA 1P8UA 4GKZB 3AZUA 5C0BE 1ID5I 4QLRA 2A0LC 4I1NB 5D93C 2VXQH 4EJ1C 2Y04A 3NIGF 1FZJB 2B59A 1I31A 4WAVA 2O61A 1KB3A 2MCMA 5DJCA 1PKQE 2IF7A 4O02A 4IMLA 1NUGA 3OXSA 4KKBC 4X6CB 4OF3A 5G5DB 1JMZA 2I07A 1FVEA 5DO2C 1DVYA 4XB3A 2A4EA 4XVOA 1P8IA 2EIKB 2QADC 1DQDH 1B3IA 1FZOB 1QASA 3HFFA 4HUUA 5C0IB 4DKAA 2MCG1 1A25A 4PRHE 3A4AA 5I6XB 5F7EL 3QARA 1KTDB 1H5BC 1Y18A 4JY5L 1AR1B 4UTCA 1U8HB 2JCCB 2X1XR 2YSSA 3QRLA 3RBSA 3T2PA 3IETA 1KBGL 4JG5A 4DVBB 2F54D 5BRQA 1SM3L 5IM7A 3MJGX 2DQTH 4IRZH 4LSSL 4RISL 3VFTA 4R9HA 3RWJA 4DQAA 4LKCB 4JHAH 1DQMH 3LRSB 3PGCB 4EEEA 3NP4A 2TSAA 3EOAA 3LKOA 1R5WA 3QRGL 1PZ2A 4Y5YB 5C09B 3ZUCA 3DMMC 3NZ8B 3ARUA 5KVFE 3V9CA 2KSYA 4IRSB 2XZZA 4KJYB 2MQ3A 2AXFA 5TF0A 5CO1A 4TULH 4XBPB 1KELL 2ATKB 4OZHF 1XZWA 2DQGH 4LBEB 1CCZA 4N8VA 1GR7A 3BDYL 3DX7A 4MJHA 2PR4H 4GSDL 3RKPA 4H0GA 5H8DA 3UYRL 2OJEB 3PXHA 4DP4X 4R97C 4K7PH 4PJFE 4JHWL 1IKFL 2ZXBA 3RUGF 5HTSA 4YDVA 2WQSA 5BW7A 4PU2A 3GSVA 1U33A 1BQ5A 4OUUA 4DP7X 2DPKA 5BQ7A 3LHPH 5AB1A 2KLRA 4DP2X 3N44B 2RQ8A 2VLRA 3ME0B 1NEZG 5D2LB 2D31A 4OH2A 3L3IB 4F7CB 1L7IL 2DYPA 5KZCD 4W9JC 3O6LL 4PJ5E 1OP5K 4G1EA 2Y24A 1U8OB 1OARL 3VFVA 3H6AA 2G4GA 2WXHA 4MA3B 1BREA 3QIWD 1XSOA 4G9FE 1X5AA 2Q8AL 2HAZA 2VT4A 1R3KA 1T7VA 4W9LC 4FLRA 3X3GL 2AFNA 4Y5VB 4CVUA 3DXAE 2DW5A 3WUWA 1YQVL 2GC7C 1F1DA 4K94C 2VZ3A 3VG9B 1OLLA 4WCYH 1LO4H 4P59H 4C4KT 1L7TH 5IVOA 1AZCA 1DHKA 4OUOA 2NY2B 4UQ2A 3IMBA 3N1MC 2FYYA 3O6FD 4GEJA 4JDEB 3ZEVA 4OLYL 1MGYA 3WI9A 1T04A 4HU8A 4ZAKC 5JPNC 1AZUA 3CU1A 4TLKA 4MHHG 4JFDB 3WV0A 3DBXB 2HVJB 1ZVNA 4WSJA 3GUTB 1WCBB 3SE6A 2P7TA 3CD4A 5D7JD 3GMMB 3QEHB 1I8LC 2OW6A 2VC2B 2ICCA 4HYJA 3B9KC 3PL6C 1MCIA 5BZXA 2AQSA 5D2NB 3AY4A 4URKA 1U2CA 3WCYA 5I1LB 2R7EB 2XIDA 2DBLL 1B0RA 3VD9A 1XGQB 1RUQH 2OAAA 4PS8A 5ADPH 3IU3A 4ZPVB 1KEGH 3TN0A 1JPGA 4KI1A 4LEEA 2HVBA 4QHLB 5B22A 2BMKA 5BVJB 4L3CA 5I0DA 4B9FA 1BQSA 1CE6A 4KH2A 2Z92A 4GQ9L 1GJWA 1R5IA 1LQSR 1ACZA 3D33A 4Y8AA 2FT7A 5L0QB 4IBVA 3CBRA 1CJYA 1BAFL 1BQLH 3EHBC 1SYVB 1VCAA 2X2HA 1DBAL 1MAJA 3IJ8A 2Z73A 5JHDD 1QHJA 1UXMA 2YEZB 2C1PB 1V7MH 3SKOB 2PKDA 4BGLA 2BHZA 2HRGA 2K45A 4OJFL 3UCQA 3AT9A 4J3OH 5D2NC 3R8QA 5CP3H 3H0TB 5BV7L 2FHBA 1UURA 4UT7L 3FFOA 3FAWA 3DX8A 4GNKB 1NINA 1PX4A 3KPQB 2XIIA 4ZS6C 4XCEA 3PY9A 3C60D 4G8EA 2VRQA 4X8JB 2C3GA 1AQMA 4NBZB 2OK0H 2HTKD 1CGXA 2P8LA 1SDAB 3MA9L 5D7EA 1PKQB 4F7KA 1YEGL 3PWJA 1NC2B 3VFUA 1GSMA 5IFAL 2BFVH 1BX2A 5ICZA 3OPZL 1T6WA 2X10A 3P02A 1IUZA 5K33A 3U2SA 4IYKA 3X3BA 3O3DA 4ZFFB 4FL4B 2PCFB 3NT0A 4FQIH 5B4MC 3KLLA 3OJ2C 1YRKA 3P40A 4IJ3C 3DHJA 1J10A 1ZPUA 4U0QB 3MRGB 4PLJC 4Q2ZA 1AGBB 1X44A 3RAJH 4NQXA 5DHHA 4DTGH 2C8NA 2YK1L 1CT8B 1TCRB 2J8UB 3GNML 5DT1H 5AVXB 1E67A 3DHUA 3QR0A 3RZWA 3TWCL 5E56A 3B2VL 1B88A 3DK0A 3L7EA 3Q6FA 4CILA 3HN3A 5DS8B 1CGSL 4ONHA 4M61A 5HHVH 4IOSA 4UQDA 1R3IL 4X7DC 4HUXA 4I3SL 3DX3A 3WO4C 3O2DL 1QPPA 1FNEB 1TO5A 1MFDL 1RI8A 2JFCA 2NLJA 2JF1A 1HZXA 1I4FA 3UTYA 3Q8EA 2WO3B 4LNVA 3RUGA 1F3RB 3IBEA 4JFEE 3ARED 1GVIA 2ZUXA 4AJ0A 4XNUH 2ITFA 4K3DL 4TSAL 1OD7A 5F1IB 4Y4HD 5DTFB 1RVFH 1TZIA 4G6FD 3OJDB 3VG0L 2QR0B 5IQ7H 4L8DA 5L6YL 3GDCA 4UCFA 3VXPA 3U9UA 4NRXA 1S5IH 1NCJA 2PO6C 3QUXD 2KC0A 1RFDL 4D9QE 4QTFA 2GUYA 2QVMA 4HXAH 1C08B 4LE8A 2HTLD 3JSSA 1IX2A 4UOJA 3L16A 1A2YB 3RHWK 5DR5L 4X6BB 4N9GA 3EJCA 5C0BD 1BMZA 3NRFA 1T03L 1KB9K 2V2TB 1IC4H 4NO2A 1BOGB 4NNYA 3N41F 4JS7A 1C16A 4RRPA 2VKWA 3QBLA 4ENEC 2R2HB 2C1OB 1NC4D 2GJ6E 1ZWIA 3RWEB 5FO9B 1NGQL 4YBLB 2YO3A 4M6NL 1A9BB 3QG6B 4X9IA 4GG8B 3MGOA 5C0DA 3QEQE 1UCBL 3GSNL 4WWID 3TVMC 2X5PA 1RMFH 4K3HA 1KCWA 3NCBB 2D9QB 1DQKA 3MXVH 2AJ3A 4OF0A 5F89B 4ABUA 4A4MA 2AQPA 1KYAA 3E3QE 4ZXBB 3TA3C 2AKRA 2GKIA 5IVZA 3TH4T 2ERJB 3II2A 4JEGB 1CGTA 3RVTD 4DSYA 1FORH 1CWVA 1HCZA 4RGNC 1SJEB 3V5DB 5KSVA 2KL6A 1MH5B 1NCNA 3L45A 3MX0A 3FO1A 1IEAA 5EEXA 4N0FB 3COOA 2PN5A 1TZ8A 3EW3B 3ARFA 1YYLH 15C8L 2FEDD 4NQED 4CSZA 5TTRA 4UUJB 3IGKA 8FABA 2XWTB 1BFTA 4QRTB 4HYTB 1AQHA 4FMKA 4N3UA 4OF7A 3IDXL 1GTNA 3MYJA 1YN6A 3DO4A 2ZF9A 4HMEA 4N8UA 1LMKA 3UBXG 1AZVA 1P5UB 2OMYB 2W88A 3A23A 1C5BL 3MN8A 4P5TB 3VRJB 3OPUA 5I1EH 1XGTA 1UASA 4KZDH 2VJXA 5L8JB 2O6FA 3RWIA 2VR8A 5IEKA 3BZFA 3WL9A 3LEXA 2XWBA 2PWGA 2LVCA 2ZP0T 4CMHB 1RPUA 1DUYB 2G75B 3MRFB 1DEEB 3DRTB 3QRGH 4ZMZA 3RTQB 4XVUD 3VXMA 3M1OA 4WUUB 1WS8A 4L37A 2NZ9D 2VSDA 3O8XD 4YGVB 43CAA 2X4NA 3S8GB 2Z8RA 3IKKA 2CCLA 1A5FL 2VR4A 4X6CE 5DJYA 4OLVL 1XBDA 1H3XA 4BE5A 4NIKB 1NTDA 4K9JA 1BD2A 1MOEA 4QWWC 3KPPA 1U0QA 4U1SA 1BLNA 3DPDA 1TKWB 1JOIA 3I75B 3KE0A 4Y1SA 1OAQL 1ZIAA 1GAFL 4IEFB 5IQOA 4GG6E 2VN3A 3VI0A 4N28A 4ZUSA 5TGBB 2WLYA 4JW3A 1X7SA 3VWKA 1J11A 3BWAA 3UAJD 4Q56A 1T21B 5C86A 1IGYB 1VADA 2VISA 3BQUA 3LN5A 4CC0A 5FW8A 4ZJ9A 1NMBH 4B9CA 4MCZB 1BIIB 1UT2A 1QI5A 2Q7NA 3LS4H 4BM7A 4Y9HA 1EDQA 2YQBA 4U1GB 2W9DL 4KHXL 3P73B 2J20A 1YLBB 2CO7A 2WUBL 5I74B 3DETC 5CLYA 3IVKA 4UQCA 1F4WL 1NEZA 5DMJB 3EH4B 1X5JA 2E3VA 4W4OA 4AE1A 4PJDE 4BH7A 3LV3B 1A6PA 2OMXB 3CLFL 3CSYB 5E99H 5JW4N 3HHSA 1W8EA 2AT9A 1MI5E 1YUHA 1W15A 3VXSA 4AKPA 5EORL 5HGDA 1JHKH 5TFSL 3IU4L 1F11A 4CA4A 3CN1A 3PWNB 1FNSL 1HOEA 2WXFA 1WIUA 5D8JL 3E6HB 3JV4B 3LH9A 4DUXA 4Y4FA 5D1QD 2R23A 3HS9A 4OBSA 1GIGH 3F6JA 4OM0L 1HHKB 1JXFA 4Y4KB 3HARA 3ZDYF 3ZZSA 4IK7A 4JREB 3Q06A 2FR4A 2XN9B 2PYEA 1MVFA 3MBXH 4W9DC 1HEZB 3BX7C 3F7VA 5J06A 2QSTA 4D2NA 4JFFA 4JN2A 3TIEA 5D1ZA 3OM3B 4F37F 1BQKA 3NIDB 5FGCB 5PCYA 4NM4L 1IAMA 3S37L 1T0MB 4UTAA 4AH2A 4MJIA 2ZOLB 3UFIA 3QJSB 4P2AA 1DFBL 4F33A 4MXWH 3TNNA 5AZ2L 3G08A 4PJAE 3RY4A 1A9VA 1D5RA 3MREA 3PNWA 3M86A 1GYCA 4AV0A 3RY6A 4FQ1H 4OJFH 5DJZB 4FLSA 3VH8G 5ICXB 2WVVA 4L48A 3V5HB 1UEMA 1MDTA 1KLUA 1MCWM 3V4VH 5DSCB 4LSQH 2PPCA 1SDDA 3ULUL 1FH5L 2JELL 5JW4R 2Q86B 5KVMC 3S96A 3TBSB 1M05A 4HSAC 4RWYL 4LF3B 4ODTL 5CXPA 3BXNA 4MSWB 1CS6A 4FFVC 1DQVA 2IDFA 3LZPA 4WRLA 5F9OH 4JQIL 3S4SB 3VTMA 4GG6F 3VGDA 1QMUA 2YAQA 1H8SA 1CICD 2WWKO 3HZ3A 1GS8A 2E7LA 5AYTA 3G6AA 4X50A 4HPYH 4QRRB 4OCYH 5DUBB 2O5XH 1F4ZA 3EDEA 2EH7H 1TITA 4PRIA 2J57A 2V2XB 4EKXA 2X4RA 1ZIBA 2DM2A 1ORSB 3B7YA 3SPVB 4TVPE 2BCKB 4A7UA 2C3VB 2HG5A 1XB8A 2BNRA 2BXZA 3DBSA 4FQXB 5CBEA 2P5WE 3OWRA 3KWXA 1E6JL 3FSVA 4NC0B 4KJQC 2R4RA 4HDIA 4XNDA 5EC1B 4HU2A 3OMZA 3HNVH 4P2OC 5D5MB 5HI5C 4YSDA 4JR8A 3BH8A 2XX1A 1XH1A 4LVHB 4LHJB 2WP3T 3K4DA 5IBTH 3V2WA 5GSVB 3SQRA 3CXHJ 4LLYA 3IFPB 4TRPH 4L18A 1R3LB 4PUBH 3EH5B 5FF6B 4NX0A 3OC8A 1EEZA 4HJUA 1I53A 5E8PB 5DCCA 3O2DH 2A9NH 3ZE2B 4HJSA 4HJ0C 3IN2A 1Z9SB 3D3VD 1YEEH 4UOW1 3EYFB 3UTSD 2E46A 5EUOA 5AB2A 4AT6B 2EIJB 1MCPH 1X6LA 3FMGH 4I18C 4N0UA 3T0BA 2FATL 2ROYA 1DTUA 2NNRA 1DLFL 3HC3H 4HGKC 4QHNA 4WHTA 1EZUA 3J2PA 5J6HA 1NL0L 4HMCA 2PP8A 2FWLB 4D9QD 1P4UA 3IFNL 5ID1A 3NH7L 1E3ZA 3QI9D 3K6FA 4MJ5B 3PHQB 5A43C 3RWCA 2XACC 4Y2NA 2PXYD 4LVNC 4MA8H 2XZAL 2HJFA 1RZ8A 2HRPL 2V9TA 3MLWL 4G8FB 1IC5H 2A9CA 4OGZA 3CDCA 4P46D 1HCVA 4XCNB 2L7JA 4NQVA 4P0DA 2XZQL 3GHEH 8PAZA 1DQTA 4PJAB 2EEAA 2EIMB 4ZOBA 1OTUC 4YHMH 3S8WA 5C9JA 5JYMA 3MGTA 4DOHB 4ZZKA 4TSAH 5DVOA 3SKNB 1W8NA 4QF1B 2P47B 2EDOA 4WNQB 1UZ8B 4B27A 1U3HD 4EVNA 5L7XH 4G5ZL 5LB1A 3KYOA 3MTRA 1W91A 3HPJA 1YYCA 1I3UA 4HIJA 4ZXBC 3TA3B 3G5VA 3UTXA 1QOKA 2KZKA 4GG6B 4JR9H 4OZFG 4H7VA 3KYNA 2VQ1A 4A39A 3CSFA 4Y2OA 2NTUA 4FFYH 4P9HH 5I82A 3CQPA 2R0LL 1QHQA 1ZEAL 2WXRA 3MRCB 4K94H 5HGGS 2F7OA 3QZWA 2FZ3B 1OAJA 4NC1C 2YSTA 4ZAKB 2L3BA 4ZYKB 3RI5F 5JPNB 1MAML 5KSAC 4PJFB 1IGCL 1XXFC 5D72H 3TVMA 1O9ZA 1XSJA 3DX0A 4NQEE 1CDGA 3GKWL 3ELAT 1NCWH 4FI6A 1RK1B 3M17A 1GPOL 4HJJL 4PN6A 4UM8A 1FYHB 4XXCA 3IGUA 4LDLB 4QXTA 5EU5B 3SGKA 4UQBA 2WC7A 1QWHA 4Y4HC 1R84A 1BFOB 2DQMA 2G4EA 1O6SB 5DUMH 4WWOA 2JIXB 2V5YA 3H55A 4OZ4B 3U6XA 3WYRA 1N10A 4P9HC 4GAGL 1IIIA 4ZG1A 1QM8A 2K70A 5AENA 4TNWF 1U91A 5DK0A 4L4TA 1AMYA 1Q9OA 3CFDA 1E28A 2ZPKH 1IFRA 4QRQA 2CR3A 3BPCB 1KXQE 5EBLB 4NRZB 3QIBD 1WAAA 4J8QA 5I73C 1JZ3A 1I8KA 2SEBA 1A7RL 3T2OA 1TCMA 3QEGL 1F42A 2YUXA 3ARDA 4MRBA 4KMQA 1XF2A 3CBJB 2GT9B 5KVGE 1MCOH 3FZUC 3BRFA 3D09A 4PH8A 3TGXA 4Z0BH 4CN4A 4X9BA 1MRFL 4HS8H 3ARGC 4DPBX 4MDJA 1NA8A 4PS4H 3TLRA 4ELDA 5JR1H 3T1FB 3DJ9A 4G42B 1BF8A 2OZ4L 3C8KB 3O4OB 3ATEA 4FA8A 1XGPA 2YGQA 2TRHA 3UTZA 4L0YA 3DV6B 2NYZA 4JRXE 5GS0C 2XSKA 5EIQA 1WICA 1ID2A 3D08A 2NY6D 2WLIA 4LVEA 4WW1A 5BNXD 5L2KB 3ZKXB 2Z4QB 1U8CA 5HGAB 1A6WL 1WH0A 2V4LA 3U1SH 5DD5L 3MRRB 1QSZA 2IOMA 5MENE 2Y06L 3CZJA 3ZDZE 3HR5B 1A6ZA 3PGDB 4KO5A 1L5GB 1YMMD 1P4IH 4WU5A 1H9VA 5EZOL 4ZNCD 5ECGA 4GAGH 1IGTA 2AJYH 4E41A 2C7UB 4IMKC 5HVGB 4HD5A 4KV5F 4N8CL 3TZVB 1FSKB 1MHCB 4CVXB 1OWWA 3U0WH 5CLWA 4HCRH 5ETUA 3RDTA 2XUWA 4MKTA 1JZ6A 2QZQA 1DBJH 1S5IL 2HYMA 5CBAA 3OKNB 3M1BB 4GLRH 5FWQA 1GHFL 1K5NB 5TQ2H 1NGZA 1I9EA 2CKBH 3SE4A 4HUNB 5G2CA 1NAKL 2G3ZA 4A37A 1SM3H 4WO4B 3P2TA 4RNRA 2FO4B 4AQAB 5GS1A 2R2CA 3DURA 3KYAA 5JXED 1OGAD 4OB5H 1ADQA 3NK3A 3GS7A 4RVBA 5A3IC 1CWQA 3DGCR 2NT0A 3QO0A 2XG5A 1CFBA 2HPYA 4TF4A 1Z9PA 2BY3A 2JI2A 1M1XA 1F18A 3JWNG 4Y9BA 5IBLD 3VQLA 2OL3H 4Y2DA 4Y1AB 4HC1A 5IW6A 4WI5A 4HLEA 1OB1B 3UTVA 2X09A 3T4AC 5FECB 1TJIL 4PJIF 3GI8H 5AVQB 1LDPL 2VXTH 4E5XA 1NIDA 3R06B 1E4XL 1SNRA 1KBBA 3D12B 1IT9H 3W0WE 4AYID 4FP8H 2DKMA 4RBPH 1A1NA 2WKLA 1T20B 1KG9A 1KY7A 1QBMH 1M7IA 5EOQH 3TA3D 4WEUD 3D0VA 1VGEL 2X4SA 1UD2A 1N9PA 4HEMA 4L1TA 4UINL 3MU3A 5CJOL 4JFYB 4KQ0A 2JB6A 5EOCL 1UB6B 3LHPL 3QDGB 3ARBA 1CFNB 2QPUA 2ADGA 2EH7L 3D1MC 5TPWL 3VWJD 2NXZD 4BRVA 2EVHA 3ZLQC 3RVXC 1IGML 4JMXA 4RRPM 3TYFA 3MJ8B 2ZFEA 4Y19A 4R8WH 1NFDB 3B6SB 3MODH 3GPSA 5KYWB 5LHDA 1IQDB 3A4DA 1B9KA 3C2AL 2IAAC 1LNUB 4QRSB 1CFTB 3SBWA 3ZHLA 5J9PA 4PD4J 5EC2B 1I7ZB 3CZGA 3TCLA 2A83A 1D5BB 3GXFA 3V4VL 3L3OC 4PJDB 1K4CA 2K7PA 3GSNB 4YSAA 4HKJA 5HDLA 4PRNA 5CJXC 3D7PA 4ZW8A 3FQ2A 5GRXG 1V10A 3FT0A 4EXPX 3ZKXC 4NIYE 3PU7A 1BGXH 2AGJH 3TV3H 1LLAA 2VN4A 5HD8D 3UZEC 1NLDH 3RIAF 1SYSA 1ZV9A 2F1BA 5DHXB 4HZLA 4KNSA 2Y7SA 1Q9WA 3ULSB 2FJFA 3QC6X 3NA4A 5KS9F 3VACA 3QG7H 5B34A 4HOXA 1O9WA 4FTVE 2DM4A 4L8SB 4TQEL 4AEEA 3D85A 4BZ1H 2V2WB 3MC0A 3ARGB 4PJHE 3QDCA 3FTWA 2BH0A 4L1DA 2H6UA 3KWTA 1NIFA 3BPOC 3ETTA 4FS0A 5EZIL 3QXAA 4Z7QB 3QIUA 1LD9A 4R2GD 2WLKA 1IQWL 1ASQA 4GRMB 4K5NA 1RZQA 2FBRA 4GMTH 4UBDD 4Z1PA 3TP4A 3ZDYE 4JM2B 4B60A 4YHNA 2GHWB 3NRPA 1P7QD 4UM9B 1JPFA 5E8NB 1MFEL 1HESA 3D25B 1E5AA 3PG2A 3BZ5A 3IMVA 4G9DA 3O9WD 4B0MB 3TH3T 2WNGA 3Q2VA 2GJPA 2PPAA 2I60H 3BGAA 4FC3E 3L5WA 2VDRL 4WWNA 3FHQA 3WNOA 5A8EA 2PW2A 1BRXA 1KJ2A 5EZLA 4AEIH 5HYQA 5DC0A 2XQBH 1MFVA 4J12A 1IKNA 1YEGH 1A47A 2OXHB 2OSWA 4JE0A 4GAJH 5HJBA 2C9XA 5IESH 2ICWA 4XTOA 4P49A 4FXKB 5EG6C 4UF7C 3BP4A 4LL4A 1NMBL 4QRBA 5MI0B 3WNMA 3CX5K 3NJFA 5AZEH 2GG1A 5H2BB 1II4E 3VFGL 4R7XA 2CLZB 3P11H 5FOJA 2JQMA 4KKCD 3JWNC 2UZYA 2AXWA 3QWRA 3ILPA 3QQDA 1M2VB 3SE3C 5I2IA 1AKJB 2R1WA 4RGMB 3MMEA 1CFVL 2ZYHA 4OLZL 2K1MA 5EU6A 1CTMA 1Z66A 2A74A 2P3YA 5SWSB 2APXA 4AEHH 5BRZD 1I1FA 3OGCA 3QNFA 2X6MA 3NFNB 4WUUE 1U9KA 1BDYA 1SJHB 1AACA 2DWYA 3D39E 1INQB 1JGVL 2NOYA 4ZUTA 5D93B 2Z6FA 5G4MA 3QFJA 4AYFB 5I1CL 2YPLE 5C0JA 4FNLH 2X87A 1YJDC 5DUPL 5I8OL 4X1HA 1OP9A 2XQBL 3H8NA 2SODB 4K8RC 2M8XA 1SJMA 4JPWH 5LBSL 2XTLA 5BOJA 1JXJA 1S7WB 1HZLA 2BWDA 2JLLA 4Y0GA 4X98B 1EUUA 1BD2E 1IGJA 1THCA 4UT9A 3L1GA 2CK0L 4APQA 3BCFA 4JRYD 3DUHA 4BFIB 5JO5B 4RLDA 3RZEA 3F12A 1DQQA 3FL7A 3FRUA 4BZ2H 5ABZA 3KLAB 2CBOA 3R4DA 3FB8A 2P24B 3NFPB 3F65A 3RIFK 1IJ9A 3QUXB 3A3YB 2XPGB 4ANVA 4E9XA 5CLTA 1I75A 4FN0A 3T8MA 1X5FA 4M5SA 1ILUA 4BE6A 3SJVA 7FABL 4OZGB 4LT7A 2OX5B 3LIZH 3PDDA 2VR9A 2O72A 4GPVA 5FC9A 1OTSD 1LILA 1TZAA 4H44C 4QCIB 4RETB 1NMCC 1NUFA 4NFCA 3F2LA 4P2YA 5AVSB 4P5TC 4ELMB 5IV2A 5J1SC 5DDHA 4WHCA 2H1PH 2YUVA 3CZEA 2ZTBA 2C9SA 4BKLB 1VERA 1ZHBA 3SDXF 3G5XB 1RIHL 4OM1L 3AQXA 3Q2CA 2Y9RT 2HX9A 5GPRA 4AMJA 2ZKHL 3TNMB 3PQYA 2IMNA 3AM8C 3UDWA 1T3FB 5LQBH 4CSSA 4DKDC 4P5MA 3FCSB 3VM7A 2CALA 3RA7H 3RP1A 4RGNB 5HHQB 5EBMA 1PLBA 1D5MA 1NIBA 1OVZA 3L81A 3EDFA 3FQUA 3SKMB 5GJTH 4U6TA 3AABA 3H2WA 3MRLA 1RULL 4B3EA 2XC8A 1TJHL 3P0VL 3HZYB 4JFSA 4MDIB 1R0AL 4P2OA 4BK4A 5EFIA 1BYOA 3VXUE 4U2ZA 2FO8A 1FORL 4ZW5A 2CIIA 1IM9D 4GUPA 3TPKA 1EEYA 5J89A 1JYXA 1MWAL 4F8OA 3GRBA 1U42A 2FAUA 1SVBA 2FQFA 3CFKB 1TEYA 1JNNL 1X5LA 2RAMA 4H88L 1NAMB 5GGVH 3BHBB 3QHZL 1UGNA 1F4XL 2QEJA 4N20A 3SBRA 4MA8L 3IDYB 3L4WA 1G0XA 4I18A 4AK1A 1KJMA 3OHMB 2AXJA 5IWLA 3MFFA 2XWCA 3SODB 3LSOB 1E2ZA 4HUCA 3APFA 3DC0A 3TIDA 4XCFH 2Z1PA 5KOVC 3S34H 3UH8A 4WU7B 3HC3L 2WQUA 3H9SA 4PJ7A 3VFRB 1Z2KA 1PFOA 1NCDL 4PWKA 3GKWH 3KPRA 3VW3H 1IVTA 1QBLL 3LRKA 1I7UB 5DD0H 1OAUH 1PG7L 1TPXB 4PJBA 2A77L 5CEZH 2EO1A 4IRJA 4UDUA 4G1MA 1KG8A 1A7QL 1KGCE 3MRDB 4JBSA 4YDIL 1T5XA 2P8PA 5GRYA 3TO4A 4JFED 4FABL 2YEQA 4S0TD 4IKIA 2UY7A 1FO0B 1RURL 4QXUH 1ETJA 4DK6A 3RX9A 1YEIH 2Q7YB 3VRLE 3BRGC 5IFAH 5JIPA 2O5YL 4NBXB 1IU1A 1JV7A 3WHXA 3AXLB 2FECI 3COCA 1NH6A 1KCVH 4JDVB 3HRZA 1UM6H 3QISA 1L9HA 3MLRH 1HL5A 1WITA 2UX7A 3ZT5A 4MJID 4P2CG 5JLZB 5K9QG 3VVVA 2R1YA 2HH0H 4K55A 4Z5RA 3FSOA 3FTZA 4JRFA 4OZHB 4PY8J 1XR9A 5ELIA 4QT5B 2H2PD 3HBPA 1CVSC 5FO7B 2WN2A 3JBG7 1MLCA 4NKIL 4F9LA 1U93A 1ZA6A 1D6EB 3UONA 3V7AE 1WGVA 2UWEB 3MJ9H 5K5YA 4G7VL 2R4SH 2CBPA 3L4CA 4XNUL 2QVIA 2J25A 3D0LA 5CJXA 1KT2B 3M8OL 1IFHH 3HW7A 4TL4A 4BSVA 4J3OD 3FTUA 3WJJC 1A3LH 3ZTDC 3ZO0A 2XBTA 3G5WA 3RL2A 4X6EB 1KACB 1EO7A 3M7FB 4LEBA 5J57B 1PFCA 1QO3A 3KDPB 3ZBMA 4K5YA 4BCXA 5HYSA 4CMHC 2BXYA 3IFOB 3Q1SH 3GBNH 1DBMH 4ZMTA 4MJ4A 1RV6X 4U6YB 3L8QA 4GKSB 4TSBL 2E9JA 4PJEA 3PWLA 4MD5A 3GXUB 1BFVH 4W6XB 3T3ME 1H9DA 1T0OA 4WW2A 3SYCA 3B2PA 4BELD 5TH2A 1J7VR 4NLHA 3N43B 4ELKA 3PDGA 4MCYA 1SHXA 4AKOA 1SF5A 1TO4A 1HINH 5HY9B 3II1A 4HIHA 5FA4A 4JQVA 5T3XL 1MJ8H 3CVIH 3QJVB 1OB0A 4NUJA 4ZOCA 4XZUA 5DYOA 1T4KA 2CWRA 4XI5D 1IE4A 4Y4FD 3E9UA 3BPLC 2APFA 3I9AA 4MRCA 1NFIB 4N2NA 1L9RA 1UCTA 1I85A 1MWOA 2ESVB 3EO0B 2HFEB 3HG1D 4WO4C 4LIQL 4WWPA 5F6IC 5F9JA 5L88L 1D9KB 1EPFA 1YYLL 5DHYB 5A6IA 2XVKA 2GW5A 3KWUA 2VERN 4P48A 2EH8L 4ADIA 2WMPA 2VKXA 2H9GB 5EWIL 1W8OA 4I48B 4XOAA 3AC0A 4A2FA 4WZ9A 3LPGA 3TEZA 1LK3H 4PG9B 1AKPA 4DP9X 4U31A 1OO2A 2DLEA 2D3JA 2NZ1A 4PRDB 1FHGA 1DO6A 4FQQB 2VDNH 4KHTL 1KN4L 2DOCA 4JO2H 4ZW6A 1TVBA 32C2A 2NXZB 2NY7H 2VM9A 5AZEL 1BQHA 1J9TA 3AAZB 4GJTB 1D9KA 4LPYA 1AHWB 3ROLB 1NFIA 3UBGA 1FYTA 5IIEB 4M7KH 4Q52A 5DI8B 1T4KB 3HANA 5DYOB 2PO6B 4NQEA 4JFHD 2BSTB 3U7WL 3PWVB 3CVIL 2DYSB 4M9PA 1HXMB 4D8PB 3O4OC 3OTTA 1GMIA 2FYVA 4KUCF 3U4KA 2KMWA 1N59B 2EIZA 2ZOOA 4WW2B 1E8XA 2QHLA 2XA3A 1XMEB 1VCBC 4MD0A 1RJZB 3ZXAC 5T3ZE 1EZVX 4P9MH 4QMEA 2CJTA 4GKSA 1VGKB 4H40A 3GSXA 4J3OC 5EORH 3DPBB 1ETA1 1AQKL 4IRJD 3IFOA 5JDJA 3LXUX 1UH4A 4YE4H 1SLXA 4NHCH 3RFRA 3V79C 3RWGB 1QO3B 2BZCA 4GSXA 4MB3A 4PR5A 3D8MA 1QFWL 3JUZA 3NSFA 1M9WA 5AYQA 4X6EA 1FO0H 3DVNA 3MKKA 4A7QA 1CXKA 2DJUA 4PREA 1TU2B 3CVHB 4R4NC 2VW6A 3CFUA 3RGVD 1FZMA 1E3FA 5IBUB 1KMGA 1X4YA 4UZUA 2WGXA 1HCYA 1KCRL 3SDXB 4M5YH 4KTEL 2KKQA 5AKRA 1EGJH 4ZUUA 3ZL1A 2RH0A 4K5PA 1F90H 4NBYB 4PXFA 2I7OA 2CPUA 4E9RA 1L3WA 4PW3A 4CKVX 1WFOA 3I84A 4JFWA 2NY7L 4MS8C 1L3NA 2J5LB 2V33A 4Z5RB 1FI8C 2R1YB 2AJUH 4NZDA 4FQXD 4KPHL 3ELQA 4DKFL 5B8CC 4QXVA 1G7MB 5HHNA 2BFGA 3HRZB 5IEHB 4JDVA 1QI3A 3N40P 3DV4B 2P46B 4OM1H 1EFXD 2JXMA 1FHNA 4H8QA 3SO5A 2HT3C 3QNXA 4FMFA 5IROC 3GJFH 4W9GC 3X13A 2ATPB 2QGDA 4JM4H 3OHXB 1NM9A 3F62A 2UY7B 1IGIL 1OAYH 1TQVA 2QGEA 3LNDA 3TO4B 4TVPD 2AQ2A 2V3DA 4HPHA 1S9XA 1KF9B 4AV5A 3DJTA 3MCLH 3BT0A 4TULL 3V2AR 4AYEC 2R39A 1OQXA 4NQCE 1S5HA 2DWTA 1HXYA 1MRFH 4MBRA 1FRGL 2HXAA 4YHZH 3BRDA 3H9SB 3EH3B 3X3FH 1Z32X 5DHVA 2V7HA 2F58H 1YMMB 1DFBH 2E6QA 3BT2L 4YFDB 4OCSH 1MW2A 4BZYA 3EJTA 2H3NB 3LSOA 3MFFB 3ILQD 1IZKA 1QA9A 4R4BB 3RG1C 3BN9D 4I3GA 3BN3B 2CDEA 2NUPA 1BSIA 4I18B 4M6OH 3VVWA 1CBJA 5E23A 3W38A 1U8MB 4LOVA 1HH9B 5KYUA 3VGGA 3KJ6H 5B1AB 2QL1A 5AW1B 3VXRE 3IRPX 1QNZH 4YE0A 2Y5TA 5EUKB 1PSKL 4WI2A 5INDB 3GB7A 4WTWA 4C59B 2RALA 3N0PB 3SDAD 1EJOH 4N5UA 5F1NA 2NDFA 4DN3L 2IADA 1AHMA 4ODVH 1BXVA 5HSFA 4J1UB 3V52H 5EFIB 4KZEL 4P2OB 3AUWB 5T5FH 4MJIE 3NABH 3MJ9A 5DJDB 1EXUB 1CU4H 3HI5L 1IC7L 5TK4A 1JJUA 2QGBA 4LLUA 1T2XA 3IJEA 1KMEA 1NJ9B 4LESA 1WZ1L 1T83A 3EH2A 2CK0H 2P5WB 3FQUB 4D0DA 1XF3B 2IWEA 3CDFA 4KK5C 2DIEA 2FGWH 2VR6A 5EBMB 5FWRA 1G84A 3RQ3A 1A8JH 1XD1A 3VXQB 4BHUI 5KYYB 2XFXA 2O5XL 3JWDL 1G1OA 3BUYB 4I5BB 3W2DH 4XC1L 2BVUA 1DSWA 5K59E 4JFEB 4Z7WE 3V4UL 1KXVA 4I0CC 1T6VN 2PWFA 1R47A 5L7XL 3KH4A 1QTPA 2WNWA 1IE5A 1SVZA 5IMOA 1OXYA 2DQJH 5B6XA 1CXIA 2DWDA 4XBGB 2PW1A 5B35A 4QCIA 1UVQB 5C08B 3WFCL 1ZLVK 4CVZA 2PPFA 1ZTXL 2NNFA 3BKYL 2OX5A 4R4FH 3KVPA 5B38A 4IBLT 3SN6R 1EJ8A 1G43A 1CGVA 4XAKD 2E4TA 4R6UA 5AOJA 2HA1A 5DRNA 1NDMA 5KJRL 2JCCE 2P24A 3NFPA 4M4RA 2Z0BA 2NY0D 3KLAA 3O2VH 5JJEA 4JQVC 4APXA 1KB5A 3BP7B 1JGEA 1Z9NA 3FRUB 3R4RA 5D55A 5IQLA 1HOCB 3DKHA 1CZ8L 4LSUL 4PBVC 4ZMYA 5EIIA 4CGUB 1N3NA 2J1KA 3F00A 3P0YH 3LN9A 4JRYE 4CNIA 3N06B 4OQTA 4NAQA 4HK3N 1TG8A 2FIKB 3I6KB 3DMMB 4QAWA 4F8TA 1DVFA 5LN8A 2XG4A 3CSGA 3LKQB 3QUMH 3W0WB 4M5ZH 4PB9L 5E6SB 4WFEE 3NSJA 4DNLA 4M48L 3GD1C 2D4DA 5C0JB 3FCUB 5SWQB 1M2OA 1F56A 2CIKB 1AIFA 3LXAA 4NZ8A 4YL4A 5F44A 3QDGE 4ZUTB 3B43A 5KSAA 4P5TD 1FGNH 1LWRA 1EFQA 4B6ZA 3ILQC 3NCMA 1CR9L 2JKXA 1VFOA 1U8QA 2NCMA 5E5LA 2O6CA 4HQQH 3NJVA 5LGYA 3UTQA 1NCWL 2UWEE 1R17A 2DICA 1AKJA 4NM8L 2P48B 3QAQA 5DJAB 5F7UA 3CBKB 3V4VB 1MAMH 4GS7C 1OZTG 4PV9A 3SDAC 1NPJA 3OG4B 5LQBL 3MJ6A 5IBLC 1IBBA 1HKLL 3RE0A 2VDMH 4Z7QF 2PABA 1JHTA 3CK0L 4HJIA 3GRWL 5I8KH 4ANXA 5H2BA 3VE0A 1E4WL 2NNXA 4DEUA 4JUSA 4YBQD 4YLCA 5KSBB 1YMHB 3BP4B 2BWIA 3M1CA 1OGTB 5KTEL 3FQ4A 5IK3A 4LVNB 2OXHA 5DEFB 3IDIB 4AMKH 2XV3A 3U6RB 1A1OB 3VXUD 3AXIA 3BVXA 1Q0XH 1N18A 1P7QA 2PW2B 2H1LM 4XNZB 1F4AA 2BSRA 2IFFH 2XZCH 4XWOD 3FUJA 4KTYA 4A2LA 5GHWL 1A4JA 4YBQC 3D2UA 2WLMA 2EVFA 3WJMB 1FLTX 2FLRT 5DRWA 4AYBA 4KDWA 5C1MB 4F8NA 5E8NA 4NC1E 5GZND 4H2AA 3OKLA 1JUFB 4UM9A 4YHKH 2OXGB 1CD1A 4K3DH 3KPRE 3GS0A 4YHNB 5D7IB 2QQKH 4QRPE 1F8TH 3T8VA 3FYEB 3HUJE 4OJAA 4Y9FA 1AXSB 5HDBE 2W59A 3PV6A 4XGZA 1HQ4B 2CR6A 1XB6A 2VXSH 4KKQA 5EPMB 1WJ3A 1EBPA 4G72B 3HE6D 3TBVB 4QHUB 3MRBA 4R0LB 3L1FA 2OMBA 3FXIC 4FNTA 4D0BB 1A6VH 1GUEA 2X2IA 5F9DC 1KGXA 3GKZA 4LAQH 2B1AH 5C0RH 4FQXC 4MAYA 2K4WA 4GMSH 3D85B 1A3LL 4H8WC 1EANA 3H54A 3AG4B 2YCZA 2OM5A 4M1DL 2AW2A 2MEJB 2GFBB 1G87A 1MI5B 3CDGA 5F0JB 3UBXA 2FJFB 1Q9WB 3KXFA 4KO7A 3GBML 5F70A 5TDOB 1CXHA 2FHFA 2FD6H 5I0VA 5J4MA 1I3GH 3HNTL 3KPLB 1Y1DA 1NWPA 1G4RA 2J6EA 1ZGLM 2O6PA 4NKQB 2X4OA 3U0WL 3LKSA 3T0XA 4DO5A 1U2YA 2GAZA 5F7WC 5FCUL 2LVEA 1D5BA 1BAGA 1SXSA 4L35A 5HJ3B 2DKUA 1RPKA 2AXHA 5J9PB 4EKJA 1OE2A 4QRSA 5DMKA 3QUZC 1KGYE 4YXKH 2ZWKA 4IBTA 1NFDA 3GJFB 5D7LA 3F58L 5CGMA 3VUAA 4EN3D 4Z7NB 1AY1H 2NT1A 1BPLB 1WUNT 4AGPA 2ADGB 5JJJA 2CE6A 3QEQB 3ARBB 3QP3A 1UB6A 5K1NA 1WWCA 2DYRB 2RR3A 1U3JA 4GO6B 4F2MA 1K6QH 5I0ZA 4E41E 4J2XA 2GITA 5DVNA 3CH1A 5A2JH 3QYMA 1N5YH 3ZTCC 1C12A 1T20A 2VLLA 1A1NB 4WJ5B 1A5FH 1AO7A 1E4XH 2QZ5A 4L3EE 1IT9L 5DHEA 4D0CA 4JKMA 2QSCL 2QQKL 3SKUD 5E8OB 3DXAD 4XHJC 2V9QA 4Y9CA 4BBWA 2O5ZL 4K9EL 2HKAA 1LO2L 2Y00A 2C3XA 3MO1B 4Y1AA 4LFHG 3S97C 2L04A 4NQDD 4Q6IA 1FL5B 3ZHKA 4F57H 3L95B 4OZIE 4V1DD 5B0WA 2XG5B 1R3JA 1S46A 4H1LG 4MMZA 4PMEA 3RUGE 3QO0B 4NZRH 3ZE2F 5ACLA 5DHVH 5EMYA 5GRJL 4N90D 2W94A 3S36L 4PSRA 5I9QB 1B0IA 1LTXA 4OLXH 3BQUD 1FFTB 3QSKB 3H4FA 5D1XA 2VABA 4Q4EA 4D3CL 1Z3GH 2BVPB 1MCRA 3LVEA 4N5ED 5DRXA 2L7EA 2X9ZA 4HEPA 4Z18A 2P45B 4JHZA 5ECJE 2NY5L 3D4GA 4I88A 2D7PA 4MNQE 1T1XB 4UTAH 4HX1B 4ORZC 3NOIA 1RULH 2BY1A 3CX5J 3RWDA 3ECUA 4CVXA 3THML 1PG7X 2YXWA 3J7HA 5CM1A 2DI9A 1RK7A 2C7UA 1P9MA 3N42B 3AMLA 4G7QB 4OAWA 4HWBL 4NERA 4E41B 2JKNA 2FJGB 3S3DB 5AWNH 1LHZA 1I1AA 3U7WH 5I75B 4FTDA 4KV5E 2E5EA 2CJUH 1MFBL 4XT1A 3APDA 1UA7A 4NZTH 4LASL 1CU4L 3HI5H 3HASA 1GOHA 4KVNH 4U3SA 4B95C 4HH9A 1ZTMA 2UXTA 5L2KA 2WLIB 2Q8AH 2NPLX 3V0FA 2Q76A 5FDYA 4BD4A 1PW3A