3EH3B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 36
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh3B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh3B02
2YCYA 3VI0A 2DV6A 2UX6A 1E5ZA 1M57B 3DQBA 1X9UA 2EINB 4A2FA 3D4SA 2RH1A 5B6ZA 1YLBB 1MZYA 3AY2A 4GPOA 2ZFEA 4G7SB 4YSOA 1O0AA 4E9RA 2PEDA 3HANA 2P80D 3FU8A 4EIYA 1S8JA 2IH9A 5AHYA 1L9SA 2H47C 3TA4D 1U19A 1AZNA 2BWIA 2FJSA 3QJUB 2BP8B 2Q9OA 5I6NA 3CAPA 4DP5X 5FJGA 1IC0A 1TU2A 3RYMA 2GI0A 2PPDA 1AIZA 4WKXA 1WA0X 1QKOA 5AX1A 1DZ0A 4YSTA 5ITCA 1UAZA 2JAGA 2CUAA 1H68A 1ET7A 5AZUA 1JZFA 3EF4A 2VW6A 3C75A 1RZPA 3S8FB 2DY2A 3FU7A 4Q8BA 4YSRA 4X31A 3ASNB 4HYJA 5I5MA 1JZEA 3UTVA 2AFNA 3GXUB 2CALA 4LDLA 2VSKB 4YSQA 3QBKA 4F2EA 4YVNA 3SN6R 5I6PA 4PCYA 4BWTA 4GYCA 3NYAA 1DYZA 4YSDA 1HAUA 4FBZA 4XT3A 3DIVA 1WS8A 2VW7A 5DHGA 3H4HA 5B2NA 3ASOB 4BXVA 5H2LA 1XMEB 2XV3A 4M3HA 1AP9A 2OCCB 4DP0X 1X9RA 3EH5B 4MQSA 3HB3B 3PBLA 2VN3A 3H4FA 2KS9A 5A44A 1NIDA 1NZRA 3FSZA 5JJJA 1NTDA 1WA2X 2WO2B 3AG1B 3AZUA 1ET5A 5LWEA 1PZBA 4YSAA 4L35A 2BRDA 2IDTA 4DKLA 2FTAA 3OMNB 3EMLA 3HAOA 1ZV2A 2TSAA 3AG4B 3AG3B 1PNCA 3ZX1A 4HCFA 1J9QA 1PY6A 4W1TA 2NTWA 3PDSA 5B1BB 2ZIYA 4DPBX 4J4QA 3WI9A 1KBWA 2BP0B 3UAEA 2VW4A 2Y03A 1M9WA 1BXAA 5B1JC 1FBBA 3G5WA 1JV7A 2BW4A 4KNFA 1VGOA 2Y69B 1Q5JA 3ZPQA 1KMEA 3COCA 1ZIAA 5B1KA 5AX0A 1BRDA 1SF3A 3NJJA 2HRHA 3OQRA 2VT4A 3PCYA 3X2QB 3BVDB 1NDTA 3AG2B 2AT9A 1AANA 3NJHA 2Y00A 1KDIA 3QBGA 3MBWB 2FT7A 2HX7A 1AT9A 5DHHA 3UADA 1M0MA 2PP8A 4KO7A 3MBVA 4G72B 3X1GA 3ABWA 3OE9A 4YSCA 1XB3A 3FSWA 1GSKA 4NC3A 3QJQB 2GC4C 2UXGA 4XTLA 1URIA 1L9OA 5TGZA 2EIJB 3FT0A 2PPEA 7PAZA 1E12A 3ABKB 5G2AA 2QT6A 3NJNA 3EHBB 4LDEA 1J9TA 5AKRA 4AKOA 3QAKA 1XB8A 2PCFA 4HCIA 2CJ3A 1ZPUA 2HXAA 3WKPA 3CVBA 2J4YA 1T5KA 1TEFA 2QPDB 2WSDA 3OMIB 3TASA 4WW3A 3ZPRA 3NY9A 1E30A 2HX9A 1NWOA 4JKNA 5EHFA 3FU7B 5AFAA 5B34A 2J55A 5B1JA 1ZDSA 3CVCA 1C8RA 4HCGA 5A8EA 5TK2A 4AX3A 1OCZB 4BUOA 5D4JA 1PLCA 4GBRA 2YARA 3DTUB 1X0SA 1MZZA 4N4WA 4AZUA 2CBPA 2WJKA 2XYBA 1JVLA 2LNLA 5F8UA 3C9LA 3V2WA 1ASQA 1OE1A 1PY0A 5LDUA 5H2JA 5JJEA 1AACA 4KOCA 5H2KA 3NJIA 4KO9A 3NJLA 1PCSA 2KSYA 1E5YA 1B3IA 2IDFA 2VSMB 3CG8A 4W9ZA 5FC9A 1E65A 3SBQA 2R4RA 3VHZA 1PAZA 5TK4A 2HRGA 2HPYA 1JZGA 3ABGA 2TSBA 2G87A 1UATA 3AW5A 5H2MA 4QI1A 4QRYA 3BQVA 2Y02A 2HX8A 1PXSA 3X3BA 1I53A 4PXFA 4E9WA 2I21A 3HAPA 1CUOA 1OV8A 4KNUA 4FA7B 4BDVB 3NP4A 1AZCA 1NICA 2IH8A 2IDSA 4MD2A 4G7QB 1GUEA 1TN0A 4DP2X 5B6WA 2XWZA 2XXFA 5I6MA 3UZCA 4GY4A 1HZXA 1IBYA 1QNIA 3SBRA 1HAWA 3UTYA 3KJ6A 2DWTA 5G28A 2XV0A 4A68A 2YAEA 4HAKA 2EIKB 4K5YA 5B7FA 1BQRA 5PAZA 1C8SA 2YCXA 3NYKA 4ZK8A 3QBIA 4IARA 1AZBA 3PXOA 5I26A 1V54B 3U25A 1PZCA 3IEAA 4BWBA 1IW6A 2NTUA 4AI7A 1P8IA 2GHZA 1A4BA 2Z73A 5B6YA 1J5DA 3S3DB 2FNWA 3ZDWA 1M0KA 4KO6A 1S54A 2F93A 3HASA 4F2FA 3WQJA 1IW9A 4L6RA 2FT8A 1CYWA 3QJVB 1ASOA 3FQ2A 4YVUA 5B7EA 2XX0A 4NB7A 3OE6A 1FWXA 3NJMA 5C1MA 2PP9A 4MFHA 2IDUA 1VLXA 2BZCA 3CVDA 4GP5B 4RH4A 4HYXA 1NINA 1TKWA 2WJLA 1KCWA 3NSFA 4XXJA 1MG3C 2I20A 4XT1A 2ZONA 1AZUA 3UABA 2J5WA 4QKTA 3EH4B 1PNDA 1CURA 2YCZA 1Q5IA 1IKOP 3DKHA 2BZ7A 4HZ1A 4CSZA 3N55A 4AKPA 3NSBA 1FBKA 2DYSB 4DP9X 3NT0A 2JXMA 2VM3A 2OJ1A 4Q89A 4X32A 4QIDA 2FWLB 3A7KA 1S53A 1GYCA 1J5CA 2EI4A 3QDCA 3H56A 5I6LA 1VJMA 4LDOA 3FPXA 3GYRA 3KW7A 4F7KA 1CWQA 1ID2A 4PXKA 2AZUA 2Q5BA 3C9MA 2BHFA 2YAMA 3NS0A 3VW7A 1NPNA 1GS6X 1RKRA 2F95A 3HAQA 2XV2A 4DP4X 2WO3B 1H2SA 2I1XA 2UX7A 1BYPA 4DP6X 1X0K1 1NIBA 1ILUA 4N6HA 1F50A 9PCYA 3FSVA 1SJMA 1OE3A 3PAUA 4HIPA 4DPCX 1BAWA 1SFHA 4EJ4A 4N4YB 2Y04A 3RZEA 1MGYA 3S3BB 3FPYA 5B7MA 4IB4A 2BO0A 3PAVA 4X4KA 2I35A 3QJSB 4K9JA 5I5JA 2VM4A 3ZBMA 4BV0A 1C3WA 2KSAA 3IN0A 1FFTB 1N68A 1WS7A 5A45A 4YSPA 1S51A 1ETJA 3TU6A 3JTBA 2XLLA 2YAOA 3ABLB 4P5SA 4GYBA 1PLAA 3NJKA 5G36A 1ADWA 4KOBA 4MQTA 4EF3A 1RZQA 1X0I1 4AMIA 5G2DA 1GR7A 5E9NA 3FU9A 1HFUA 4BWWA 4BXSV 1IXFA 3TBBA 4EA3A 3CDZA 2X88A 2I7SA 3T6XA 1L9PA 2ZOOA 1WA1X 2YDVA 3WNJA 2L6XA 3PXLA 1AOZA 5ETZA 3RFMA 1AS6A 4E9QA 3QJRB 1BQ5A 1V10A 3WG7B 1KG8A 1R2NA 2PPFA 1EHKB 1OCOB 3JT2A 1XIOA 4M4RB 1OE2A 4N8UA 2IAAC 4G7RB 1KGBA 2JFCA 5H2OA 3VGAA 4DP7X 3FYIB 4YSUA 5B6XA 1CC3A 1PLBA 3SQRA 1A4AA 4MD1A 2I7OA 2P80A 4A66A 1S52A 4KNSA 2H5UA 2AZAA 5AZDA 1DZEA 3FYEB 1KDJA 1MDAA 1SDDA 1AR1B 2N0MA 3QQXA 4XTOA 3T6WA 4UG2A 1TEGA 4KLYA 1KYAA 3QJTB 2B08A 2JAFA 1BM1A 3ERXA 1XJIA 2H3XC 4BVNA 1MG2C 1NIAA 1GY2A 2AVFA 2X87A 1IUZA 1NPJA 1XB6A 2NRDA 2YAPA 3MX0B 3P0GA 1GU8A 1NIFA 2YXWA 3T6VA 5B35A 3UAAA 5BR2A 1R84A 1F56A 2FQDA 1BXUA 4PAZA 2VMJA 1AG6A 1L0MA 3N2JA 3QPKA 2XXGA 1ZDQA 1CYXA 2PP7A 1WAEA 1M0LA 4TL3A 3SBPA 1W6LA 1F4ZA 1SHXA 3GDCA 3HEIB 3T6ZA 3WNIA 3PQRA 3HARA 1OOWA 4DAJA 1F88A 5F7AA 5JJNA 3FQYA 4GRVA 1IBZA 1BRRA 2DYRB 3REYA 1JXGA 4A2HA 5EN0A 1QM8A 1J9SA 4BEYA 1PMYA 3D12B 3OE0A 3NSYA 3OD3A 5IY5B 3PPSA 4KNTA 2GC7C 1A4CA 3DDLA 3ZEVA 1W6WA 5G53A 4AKQA 5I28A 1BEXA 3KW8A 4ENZA 3X1FA 4BK5C 1AS8A 1L9HA 1BQKA 1JERA 1QHJA 1JZIA 4UANA 3V9CA 3VG9A 2I85A 2ZWNA 2YQBA 4DP8X 3WKQA 3V9EA 5F7BA 3FSAA 4G71B 1L9RA 1A3ZA 2PCYA 4JHUA 4NAJA 5KKHA 5ITEA 1ASPA 2B3IA 3FS9A 4HHWA 1SF5A 2GIMA 4YSEA 3CDZB 3VVKA 4FAAB 1AS7A 1GY1A 1GS8A 1OCRB 5I5IA 4TXVB 3V2YA 2R7EA 3AM6A 3UONA 3L45A 1A8ZA 3S8GB 4E9TA 1GS7A 8PAZA 3S3CB 3NSCA 1V55B 1RCYA 4HWLA 1W8EA 1KV7A 5G2CA 2PPAA 1TN5A 1PF3A 5B6VA 1ET8A 1A65A 3T45A 1KGYE 4UF7C 4E9SA 4NERA 4G70B 1SNRA 2DWSA 4P5RA 2ZXWB 4BDVA 2IWKA 2X72A 2RACA 3OM3B 1SFDA 4A4MA 2R4SA 2CCWA 5D4HA 3IE9A 2KSBA 3PAZA 4DJHA 1QKPA 4WAVA 2FQGA 1JV6A 3ZIYA 1QHQA 1ZIBA 2YXVA 1P8HA 1P8UA 2EILB 4E9YA 2GB2A 2HLEB 2IWEA 1S8LA 1R1CA 1L9TA 2FT6A 1AQ8A 2XUWA 5B3SB 1N70A 1NIEA 5DYSA 3X3CA 5G54A 1SDDB 2IWFA 2XVBA 5A7EA 2QDWA 3NJFA 2UXVA 1EZLA 5H2HA 3UTWA 2LLNA 1KCBA 3PLYA 5PCYA 1FA4A 2BP8A 3OMAB 5H2PA 1KG9A 2Y1AA 4GXFA 5B1AB 1ILSA 2QDVA 1BXVA 1BYOA 1AG0A 2UXTA 2FQFA 2GSMB 7PCYA 3NJGA 2E86A 5H2IA 4UAHA 1NWPA 2BWDA 2M3GA 4Y9HA 2YAHA 2FQEA 3EH3B 3AYNA 4YL4A 5I6KA 1JXDA 1GZMA 2PLTA 4GP8B 3NSDA 1OF0A 4XTNA 2ZZLA 2Z55A 1JZJA 4MBSA 4AMJA 2UXFA 2W8CA 4A2DA 4BEZA 2JKWA 4JQ6A 2IDQA 3FQ1A 3CODA 2Y01A 3OAXA 1SHWA 3X1NA 4GP4B 1J9RA 1PZAA 2EIMB 2HZHA 2MTAA 2XU9A 3ABMB 4WTQA 3QBLA 2J56A 2PPCA 3OE8A 3TBCA 4CSPA 4E9XA 4JKVA 4JHVA 3QAPA 3AYMA 2GBAA 2AANA 2XX1A 6PAZA 3UTXA 2A3TA 1E0PA 2J57A 2OV0A 3ODUA 3NY8A 3WIAA 4L0PB 3X1BA 4JR8A 1E67A 2QPEB 4KO5A 1QLEB 2CAKA 4X1HA 4FPDA 1JZHA 1L9QA 1M56B 1JOIA 2YAQA 3IBOA 4BWUA 1LN6A 2R7EB 1GW0A 4UHRA 3NP3A 3X1EA 4E9VA 4A2EA 4DPAX 5D4IA 4DP1X 1AAJA 2YAFA 3T71A 4A67A 4HALA 5B0WA 1BRXA 5AWZA 1JVOA 1JGJA 2BP0A 5ANHA 1JXFA 4QLWA 5H2NA 2MRYA 3T9WA 1PXRA 4YSSA 1KBVA 3UACA 4A2GA 4OV0A 4IAQA 2YDOA 2BW5A 3PWHA 1JFPA 2YCWA 5J7AA 5BR5A 4HHGA 6PCYA 5I6OA 3UG9A 3IN2A 1AZRA 1UCQA 3UGEA 5AHZA 2W88A 1OCCB 3CZUB 3UZAA
chains in the Genus database with same CATH superfamily
2E7HA 4FD0A 2DV6A 2Y7NA 2UX6A 3Q8CA 2BXZA 2VXQL 3ECWA 5IROA 3NFPA 3HANA 1VCAA 2EDFA 3FUMA 2IH9A 3CC5A 4C56E 5H94B 1QOKA 2FJSA 3TIEB 3ZDXB 5HPMB 5IBLD 5EU6D 3VRIB 1GYAA 3R7RA 2FLRT 2L0DA 1NMAH 2VL5A 1ZTXL 4HPOL 4S1SH 2VN5A 3QEGH 4GQ9L 4GRLA 1AO7E 3DX9B 4A2LA 1QKOA 1KMGA 4K2UH 3BP5B 1HHGB 4RGMC 5AZUA 4EAEA 1WAAA 1PD6A 4M5SA 4BINA 4UZSA 3N43F 3PY9A 3U6XS 4ZMOA 4ZAKC 2VGLM 5LCVA 4WUKH 5FHBL 4NENB 1I85C 2IAMC 3BT0A 4RFOH 1FJ1A 3DV6A 3RGHA 3CFKA 4NKMB 3LCYA 3SKNA 3HS0A 1MLBA 1WS8A 2GFBB 1BWWA 2VW7A 4FE9A 2FWUA 3HE6D 4HZAA 4N87A 1DANU 3D9AL 3RQ3A 1JK9B 1T83A 3H4FA 3MV9E 5E8EB 2R2EA 3WENA 2VKXA 3B37A 3F7QA 3EIFA 4WEEA 4M1GL 1ZHNB 1OP5K 2HLAB 5EN2A 4ZD3L 5KYUA 1KLUA 2C9PA 2IOOA 4HUKB 4PJ9B 2DYPA 3E6FA 2DS4A 5ABAA 5FA3A 2F7OA 1PBYA 1Q9OA 4XTRD 4UT9L 5SX5K 4B97A 5ID0A 1PNCA 3LZFH 3TO4A 2HP4A 1UXLA 3PXHA 5E51A 2Q76B 1VGKB 3OGOE 4HIJA 4J4QA 3JWDC 5B3NA 4AYFA 3KL5A 4NGHH 4IIQA 5GHWH 2VW4A 3H0TB 4P5MB 4U7KA 3RKDC 1BXAA 2CRZA 3L7FB 4DS7E 3CHOA 3EDFA 3Q2LA 4OJYA 4Q58C 5F21B 2MCMA 5HP5A 1KJ2A 3COCA 3BDYH 2QQQA 2WIMA 3HC0B 1X7SA 2GSGA 4A6YL 2B2XH 4PCKA 3NCJL 5JPNB 1QTPA 1WISA 4IYKA 1ZD6A 3QR2A 3VXSE 4CA4A 2G0LA 3KVPA 4PR5B 1TUPA 3WO3B 1U2YA 1J5HA 2GC4C 1WGOA 1FO0A 2YQ3A 2EYTA 3FT2B 2Y23A 1L9OA 3N0AA 1GGIH 4ZPVB 5TGZA 1KGXA 3CSGA 2FATL 1IAOA 5F7UA 4YHYC 1QW8A 2VR6A 4KK8C 3WEXA 3APNA 4A7UA 2WYTA 3F6LA 1U3HD 2WYHA 3WD5H 1GTNA 4DJMA 2VZ1A 4Z0XB 2J8HA 1P4LB 2ENYA 4LPXA 4M62H 4P5TC 1CU4H 5FM8A 4PJ5A 2ISDA 3DUUA 3ZPRA 5C0CB 3EBGA 1NWOA 3BAXA 1OSPL 3FU7B 3G6JA 4RSVA 4ZOCA 1D9KC 3KG5A 3Q1EA 2VH5L 4C58B 5JIIA 5MHSE 3HVNA 1ZDSA 4N25A 5CJQH 4GBRA 3LNGA 4WLCA 3BPLB 1IV8A 1I4FA 3RZWA 4PJHE 2XYBA 4KI5C 5FDYA 3QUMA 4XMLH 4ZS6D 4IMKC 1NOAA 5CBAB 5L2KE 1ITCA 2WCSA 4U6VH 2D7OA 5E6ZA 1AZZC 3RGVC 1UD5A 5G2NA 1ZTXE 1B0RA 4PGEB 4GKSA 3IJYA 1ETZA 4LBAA 1G7IB 5DLML 2AMUA 4L4VB 1O0VA 1BW8A 3ELQA 3PNWA 2K78A 4GBXC 3K8LA 5ETUB 4AJWA 3DSFL 4X6CA 3GMOA 1B2YA 5C8JB 4DUXA 3BUYA 3G5XB 4FG6D 4LAQL 3UJTL 3RRQA 3P3YA 3WS3A 2YS4A 3VMNA 1BSIA 3QUXC 1JZDC 1E6JH 3DV4A 4WTZA 3OAZK 1M6OA 3GGWB 3TIDB 4KVNH 4NCC2 3JTTA 4LCCC 3BP4B 2HUHA 4HBCL 3UTYA 3UTOA 4LSVL 3KLAA 1G9ML 1G43A 4BFIB 1B2WH 2VR3A 3ZMNA 2HT4C 2I60L 1A3RL 3U6RB 4Z5RB 4RX4A 1T1WA 1WPCA 3NCXA 1T7YA 3RE0A 5DHYB 4KVPA 3FB8A 3MLYH 4GG6A 4AI7A 3NFNA 4BZ1L 2COVD 3L9RB 4L3FA 5FCSH 2NY6C 1UB6A 1NCJA 4TLUA 4F2FA 4HQQL 5FLUA 4JRYA 4X7CC 2Q8BH 3GSQB 2A2QT 3KYKL 5HDQL 1KTLB 4OTXH 3M45A 2QL1A 4QXWA 5FO8A 2PCFB 4HH9A 1AGDB 1QFUH 2NNXA 4L8SA 2HLFD 4X6FB 1J1PL 2VJ8A 3OKKA 2IANE 5DC0A 2YWZA 4LSSL 3VFUA 1KN2H 3ZDZF 3WTSA 2X3CA 1K8IB 3CHSA 3IDGA 4E41E 4YXLH 3PV6A 4XCCH 1XCTB 1X4ZA 4B9KC 1LO5B 4I0PC 2LVCA 2V8LA 3CBKB 1DVXA 4DZ8B 4YEFA 2HN7A 4PRHD 3TYFB 1QSZA 4JO2H 3KLLA 3CLEL 5BZDA 4X0KA 3CZEA 2XHNA 2CGZA 1J48A 1RL1A 2PCXA 3GJFK 5DJYA 2OMTA 3UTSB 5F9JA 3O3UN 2A6DA 5HHQA 4ANKA 5ITBL 5JA8B 3VB8A 2CLRA 3MYZA 1D5BA 3HE7D 3OLIA 1A6TB 1NEZB 1WZ1L 3GTVA 4WKZA 1J7VR 1QSFA 5CLZA 5B8CA 4ZBJA 3FSVA 1EXUA 1WBXB 2UVEA 4OJAA 3O9WB 5KSBB 4EJ4A 1CICA 4KKLC 3PDOB 2B9BA 3KJ4B 1GXEA 1C08B 4P4KA 1NGZA 1KG0A 1I7TB 3ZBMA 4PRIA 3D3VD 1UD2A 5AL0A 5LBGA 2ICEB 1ETJA 1VADB 2JKSA 2XLLA 3ZMEA 4TOYL 1OTSC 3NJKA 1IM3D 2QGDA 3V4LA 1KZQA 3HG3A 2QPSA 4JMXA 1A4JA 1T80A 3VH8B 3LKOB 4F2MA 5DD0L 1KB3A 1GGCL 4KPHH 4JR9H 3BO8B 2IH1A 2ZOOA 5GRXG 4S1RH 5D1XD 1EAJA 4DKFL 2EE3A 2NY5L 4E9QA 1IGIL 2XWJB 1FFPA 1T0OA 3QZWB 1JAEA 4MS8D 4YHPA 1A4AA 2NY0C 4BH8B 4P8QA 1E9PA 1A1NB 2OCJA 4WRLA 1V7NL 1UM4H 2GJZA 2VDKB 3MACL 3QXAA 4JO4L 3T2LA 3L3DB 5AVTB 2AAVA 1LEGA 3CSYB 4HU8A 4ECNA 2A9NL 5FCUH 5FO7B 2FD6L 5DJCA 5C0JA 1SYSA 4N6RB 1KBGH 1CBVL 4OI7A 1UWYA 5ACZB 1D2PA 1XJIA 3CK0H 3MUGB 4F5CA 4CADA 4B9CA 4GAGH 5KS9A 5GGTL 3P9MB 4RESB 3EJYC 4PRPB 1WEJL 1JL8A 3GKWH 5JNYA 3DOSA 1T3FA 3MODH 5HDLA 2I07B 5BR2A 2IIJA 1F56A 1A6PA 5J11B 4LMQE 2QQKL 4LDOB 1L0MA 4PGDB 4MAYB 1OWWA 5F72S 3QWQB 1C1EH 4PVNA 1X4YA 4XP5H 1QI3A 3L3IB 5IJVB 1P7HL 3OPUA 5D9SA 3BGAA 5FAAA 4HMDA 4MX7B 4P2YA 5IB5A 3LKSA 4PJ8A 2MJWA 2NY4C 3CFDA 3GRWA 4J1UB 1ADQH 2XVKA 2CJUL 3JVGC 3TZVC 4JW3A 3PUCA 4OGZA 3DOIA 4DT2A 4GI6A 5GSVB 4LSRH 1HEJC 4P49A 2NY2C 1V7MH 4JVPA 3SJVD 2E27H 1IFHH 3DHJA 5AVWB 3LQZA 4MQTB 1G7MA 3RUGF 4PLKD 4N2EA 1E90A 3RY6A 1J5IA 5CSZB 4JK0D 3F65A 4ZFGL 2GQHA 1J10A 4RMTA 4L0YA 1NLBH 4PBXA 5ALCH 3WFZA 1A8ZA 5C3LD 5E56A 3A67H 3Q1SL 4KH9A 3NA4A 1FN4A 3GS4A 1A0QH 1WGVA 2P5EB 4R4ND 4XMPL 1HHHB 3SKOA 3UTPD 4MJJA 3ZT7A 4D9LH 3MLXH 5FYKE 1NFKA 3DYMA 3ZL1A 1KB5A 5FYKU 1MRDL 5HHMD 1ZS8B 3U2SB 2KSBA 1U4EA 3WCYA 4N2FA 4B7IA 4JFDE 4WI0B 1QHQA 2GITA 2ZCHL 5DZNA 4K3HA 1J0KA 3VA6A 2XUWA 4LEXL 1MHHA 2IWFA 3X3CA 5K9KB 4KQ0A 1A6WL 5GIRA 3X3FH 5JW4Q 4X99A 1CZ8L 4FQHA 1CPUA 1HIML 2PXYB 3PJSB 5JW4N 1RPQA 5L88H 5FGBA 5H2PA 1ONQB 1R34A 4MYWB 3WTVA 4NQEA 1JGUL 4UM8B 2HJFA 4YE4L 1XF1A 5HGHA 3MBEB 2WV3A 1YN6A 2CLZB 3P0GB 3UH8A 4YWGH 2ARJB 5J12C 3W2DH 5JIKA 2R0LH 4OR1A 2ZX7A 2DI8A 1GOFA 2YAHA 3EJUA 2WUBH 3LEYL 4NQXB 1PKQB 4WDIB 5C0BB 4LT7A 1IJ9A 2VLJD 5BOJA 1BVLB 3D33A 3NSDA 5LQBH 3EXJA 1I1AB 1TQCC 3CFJB 4PRNA 5BVJB 2WM0A 4A2DA 4QHUA 4AT6A 5CZXD 5D4QA 2R1YB 4FCHA 2Z7UA 4POZC 1SLUA 3W39A 5EF2A 3T2OA 1OM3H 3UBHA 3BKYL 2LW3A 4OF6A 4G5AA 5AW8B 3TBWA 2GBAA 3BPCB 1WLHA 5HD8D 4QRRA 4ZTPL 4XH2A 4Y5XA 3OKLB 4OT1L 1S7QB 4L0PB 4N2IA 5BPPA 4NO2B 1IFGA 1T6BX 2WJ7A 3A23A 3CN4A 4XAKD 2DWDB 4FPDA 5IW3A 5I1LB 1G6RB 1X7QA 3TLRA 3D50A 3D05A 4IU3A 4JY4A 1A9BA 4IBSA 3CX2A 1AGCB 2C7UA 2O5XH 5DSCB 5E5MB 4DP1X 2V9RA 3KPSB 3ATFA 1MCOL 4OD2B 2VUOA 1BRXA 1LHZA 3DX8A 1Y07A 3KYOB 4XNQB 3WAKA 1HXYA 4IU2A 2MRYA 1BZ9A 4IAQA 2XT1B 2HT2D 1K3IA 4Y9GA 3ILPB 1KPUA 3UGEA 1UCQA 1K4CA 1NC4B 5JOPE 4PG2A 2VLRA 3D08A 4FG2A 4FQPA 3MUZ1 5IB2B 1M7IB 1P4BL 4FFVD 4QXGH 3QYNA 3DQBA 3V4VH 1BWMA 3K2IA 4MJ4A 3SPHA 2DJUA 4HLZH 2VDMH 4K8RC 4L8DB 5JYLA 5IM7B 4CAGA 3PHAA 1GGBH 4U7MA 3BSZA 2A73A 3VG0L 4OCXL 4OZHF 1ZJBA 4MHHG 3SQBA 3W9DB 4P48A 5DR5H 5IMMB 5IR1B 1CGSH 1AIZA 1RJZB 4TNWF 4ZMXA 1UXWA 5JIHA 1RAMA 3GTTA 2DPKA 3MOAH 4FF9A 4QRTA 2CUAA 1HKFA 4AZ8B 3GSVA 3I50L 4TN9A 4ZXBB 5GZOA 2I9LA 1FFQA 2WNXA 3C6SB 1A21A 4JDTH 3ULSA 4AG4L 2YRZA 5L4FA 4LCYB 4RFNC 3H3BC 2PCPA 4XXWC 2KZWA 4N8VA 1N64H 5MEPA 2FGWL 2IQAB 3FB7A 3VXNA 4UMGA 2VDPL 3OZLA 4ODUB 2ESVB 1RZFL 1TZIB 4HYTB 2W92A 3FMGH 2DF3A 1ORSB 2BIOA 1S9VA 3MR9A 5C86A 4BXVA 3I3DA 2VDOL 3NEEA 4M3HA 1V27A 1DSWA 4RAHA 3BP6A 5C3IA 2A9DA 4XAWH 3I2CL 1R5IB 1RIVH 1LQSR 3FSZA 3RPKA 3A4DA 5DGRA 5I1IL 3G5VB 4HVBA 1TZGL 4URKA 1IILE 1BVNT 3U46B 3QDJE 4BKLA 4LU5H 4PJEA 4XVTH 2ZICA 4FTVE 1WQVT 4D0DA 3ZX1A 3NOIA 1HCZA 1KEMH 3J2PA 4YHZL 3ESNA 1FNSL 2WIIB 1KBWA 4MCYA 3T0BA 2OQJB 1SXCA 2HG5B 4JFZH 4ZNEA 5A2FA 1JZ5A 1Z9OA 5KVDE 5JDSB 1OK8A 32C2A 5C9KA 4W9HC 5FWQA 3SGJA 4FXKB 3AG2B 1FPTH 3Q8BA 2CBQA 1EZUA 4HIXH 1QLFB 3KEHA 1AGEA 3BWAA 3KYMB 3JWNC 5DFVC 5DHVB 5IW1B 1CD1A 1T1XB 3MBVA 2VR9A 1CR9H 3RILA 4S1DC 2F15A 4U49A 3X17A 4JANB 1A7RL 3FSWA 4NKMA 4PVBA 3HBZA 4KRMB 3JWOL 4RDBA 4XVOA 4OM0H 3W0WE 1BMWA 2Z35A 1OD9A 7PAZA 1F2QA 2ZJSL 2D7NA 2X12A 5I75C 2ZKYA 1XB8A 1TZAA 2HG0A 5E8EA 1KJMA 4K71C 1E8XA 3VYOA 4WI5A 1ZHNA 5LGHL 1BD2D 2B0SL 1E5AA 3RL2A 2JELH 3NY9A 4JDEB 1Q72L 1M9SA 4PJ9A 1HKLH 3IJHB 1XX9C 4N8CL 1FNLA 3DO4A 1TVDA 4HCGA 4NRYB 1NMAL 2ZSWB 4P9HL 4S1SL 3D07A 5DC9B 4G1EB 4ZYKB 4P3DA 4Z8FL 5FYLH 3IM1A 5FM4A 4ZTOH 2LNLA 4K2UL 2OI9B 3GXFA 1OAQH 3MRBA 4LFHG 1UEMA 4MDRA 1N19A 4UIMB 4F7CA 4KTEH 3DLQR 4POUB 3HI1A 3C6LA 3QRGH 2X4UA 4LCWB 1JFHA 3BLBA 4WUKL 3L5XL 1RVFL 1AIFA 2ITCB 2R83A 1ND0A 3AADB 1Y1UA 3MRIB 1TCRA 4AH2A 4PWEA 1DJXA 3ESVF 4K55A 4YUEL 1AZVA 2C5DC 2YO3A 4G7VH 4CMMB 1NAML 1O9VA 3LB6D 3LAFA 1WZMA 3QEHA 1H3UA 3CX5J 4LB8A 4OLUH 4ZDHA 1UD3A 1OAXH 5HJGA 2IH8A 1HDMB 3UTTB 2FBRA 2FLBT 2NNCA 4HV8A 3PWJB 1LLAA 3OV6A 1I7RA 2YCXA 1GGUA 4KHTH 3LZFL 3VI4B 2ZXQA 3SHSA 4ZK8A 5DMGD 5T1MA 5TF1H 4QRPE 2W65A 2ED7A 4JM2A 1HVXA 1A7PH 2E4FA 4BWBA 3QNYA 4TUJA 5EZPA 4MKTA 4YBLC 3ZDWA 1LO2L 4KO6A 1G9HA 2DLGA 5F9AC 5G5DB 2IALA 4HZLB 5DFAA 3TP4A 1NFIA 3BDYL 1ZLUK 5CMAA 1CTOA 1OD7A 2DIAA 4KK5D 1WAAF 1RLWA 5IEKB 5K9JL 2F58L 2H8PB 4X5PA 2PP9A 2IOIA 3QK0A 4ENED 2LU3A 1XDTT 3ETSA 4L4VA 1INEL 5CILL 4PG9B 1D6VH 3KCPB 1MWAB 2F53B 4CU7A 4XWOC 4Y1TA 2YXFA 5C9JA 3BUBA 3RJOA 3TA3D 1GGIL 2DYSB 3WIFA 3MX0A 5T1KD 4X32A 2JMRA 4P5KB 1SY6L 3WD5L 5IKCB 3UBXB 1IKFL 3BRDA 2PW2A 4FFYL 3S7GA 3ME0B 3LXAA 1JPSH 2ZKMX 3MRPB 1RKRA 2AEQL 4H5SA 3US1A 2G5BA 5DD3L 3TV8A 5FGSA 3RVTD 1A7NL 4ADJA 4I1PA 4HS6B 3JWDL 3QDGE 4HIPA 4XCNB 3SE8H 5HI4D 1FL3B 2JIXA 2FZ3B 5ADOL 2E76C 1MGYA 4XMLL 3FPYA 4YC2C 3JV0A 2FEEL 4MZRA 1NCWH 1ACCA 4CBZA 3GKZA 1XGRB 4YQXL 1K8DA 2XQBL 5I1CH 4O4YL 4BA0A 2C9XA 1BZ7A 1XAKA 1KTLA 2VITB 2F7RA 4N0UA 3SOBL 3V4PB 3MVSA 1USQA 2X6MA 5MEOA 1KN4H 3R06B 3ZHFA 1QKZH 4JE0A 1AOZA 4P23B 1OP3H 3TC9A 4AJYV 4WO4C 3KPMA 1S7UB 3ISWA 3PL6C 4QHLB 2GYSA 1T5WB 2R59A 4OZ4B 3SY0B 2Z6FA 1LE9A 4KVNL 4IBZA 4DZ8A 1I82A 3OHXC 1IQDA 3WIHH 4PJFE 3DDGA 1KGBA 1F4WL 4B9FA 1GYUA 4MWFB 4UQIM 2ZKWA 2E9GA 3AROA 1F1DA 5IROC 1CD0A 3FOMA 1B2WL 3FB6B 1FVDB 2D3LA 4N22A 2ETWA 1M3JA 3FDWA 2AZAA 2QLVB 4NYLB 3HI6L 5EIVA 3N06B 3UC0L 1IBBA 4PW9A 1QBML 2FX8L 4GRLC 1P9MC 1WBXA 1WTGT 2G75A 1AQKH 3DX7A 1P69B 3OAWA 3MRLA 4EO5A 2WP3T 1C08A 2Y25A 3W82A 2QHLA 2X87A 4S1QH 1QATA 2OM5A 5I19H 4MXVE 4LLQB 4HH8A 3FAWA 1UWXH 2Z0UA 5BXFA 4JZJA 3V2AR 1R84A 1QFUL 5SWQB 4H8WH 1P5UC 4CN6A 4ES8A 3MA9L 4X6CF 1CFTA 1OM9A 1AFVL 3HS0C 2KMWA 2OP4L 1TYJA 3FF8A 4G6ML 5L0QC 1W72B 1CN4A 1PEZA 4NP4H 4E0RA 3KL0A 1J9SA 1KCVL 1IC5L 4PJXA 5BV7H 1MJUH 1NCOA 2GC7C 2BIMA 4LVOB 4NEHB 4NZJA 2YHGA 2CLVA 4J8RA 3MTRA 1SJVA 4XO3A 3UYRL 4ZX6A 3S4SG 4XCEB 3CUPA 4ENZA 3KNBA 5D7JD 2W95A 1YAZA 4QHMB 3S4SB 5E8PB 3V9CA 2HMID 5T5FH 2UUDH 3RX7A 3TO4C 3KPLA 2BHYA 3L3DA 2ROXA 4HJ1A 5C0FA 3ZHKA 2B3IA 5M95B 4A7SA 1GC1H 1S7VA 3DURA 5FO7A 3SGDH 4YSEA 4GG6F 3RPIB 5GJSH 4DO5A 2G5UA 3UONA 1J18A 1WC7B 3FQTB 5LBSA 3VDCA 2JKNA 5ENWB 3N1MC 2C4XA 5C0BD 3NSCA 2ED8A 1B4LA 1RCYA 3K5RA 4NQCA 4P4RB 3SCMA 3CFNA 5G2CA 5EU3B 5EFIA 1THCA 4UF7C 5LCVH 4X6DE 2XN2A 4XC1H 3V0IA 1N4XL 1E5UI 2BS9A 4JR9L 5CJOH 1QO3B 1DQDL 3S37H 2MFNA 1BA9A 5CEXB 1S8LA 1R1CA 2G2RB 5CKGA 1DL7H 5DRXB 2FLMA 3LXBA 3IXAB 3L7EB 3WHXB 3NJFA 3OKEA 1XEUA 4XHQA 4HOZA 3B4NA 3E3QC 1KCBA 2ZUSA 3NQIA 3U7YL 1FA4A 4HKBA 2EH7L 1E8ZA 2X4RB 3D25B 2WXKA 5A2LH 2WQAA 1BYOA 2AERT 2FQFA 5FA4B 4G43A 1MJJA 4Y4KB 4WWKB 2A5UA 4M1CD 4UTBA 1KBGL 1AI1L 4EIUA 3KPRB 1X6LA 4KQ4H 4BBWA 3MRRA 1ZK5A 3JVFC 1KJ2H 4JVUA 4NP9A 1D6EB 5F6HJ 2K0RA 3BGFC 1S5IL 4G9FB 3L08A 3MODL 4GPVA 3OAXA 1BZ8A 4KI5E 2GSIA 2EADA 1CGUA 2Y7OA 2QSTA 4EI5A 3NRPA 2BNQB 2ALAA 4J8QA 2IJ0C 3ZU8A 3HTLX 4XP5L 5E03A 3GZOA 4NRZA 4C4KT 2UY6A 1OTUD 4AEEA 1OHQA 4H2AA 1FO0H 2DD8L 4U3SA 3LSOB 1BX2B 1Z9PA 2ZCKH 5JOFA 4X1HA 2D73A 3QIWA 1BZEA 4PV8B 1WFTA 3LZRA 1IIIA 4WJKB 2BIIA 5L4MA 1QEWB 4PCSA 3RP1A 4NI6A 2VN4A 3BFQG 1AAJA 4OZFB 5SWZB 2QBWA 4D3CH 5FFLA 5DD6A 4D0CB 5ANHA 4K15A 3PWHA 4QKXB 5J7AA 3MLRL 5FYLD 5I2IB 1FNEB 1T22A 4GG8B 4E36A 3QUMH 5GGVL 4DHLA 5KJRH 5ALCL 1BVLA 1WBYA 3EOYG 3BYTA 5DWPA 4DWHA 5GGSB 1I1RA 1AKJB 1GZPB 4JB9L 4P07A 3QXWA 4GS7B 1U8HA 4MB1A 2YLKA 4EIYA 1L9SA 5C0RH 2VABB 3RTQC 3BKMH 1AZNA 4UNTA 2VXVL 3QJUB 5IMKA 4DTGL 5F7EH 1C5DB 1YPZE 1L0XA 4XPTH 2BOBA 2Q9OA 1MCDA 4EKJA 1SJHA 1G7JB 4RIRA 2X4NA 3U4AA 5TE7H 2Z7ZA 2X1XR 3RYMA 1KIRB 2HJKB 1QNZH 1BBJA 1OF2B 3PP3H 3RAJH 3NVQA 3VXMD 3X3FL 4GEJA 3HC4H 1U95B 3G5YB 4MAUL 1TJGL 3GT6A 3PYCA 1G6RA 3P11H 5L88L 2X4PA 1OB1A 3ASNB 4G8FA 4BUQA 3TT3H 3MRGA 1YEJH 2EO7A 4G6FB 4X8JA 2HRPL 3PJNA 3WJMB 2JI3A 3L2NA 2Y7MA 4KROB 4YWGL 3IU4H 4RMVA 1BHGA 1CFSA 2R0LL 4H40A 2K3HA 4WEUD 4XNQA 5SX4H 5MEQB 1A4KA 4GNKB 4N0YH 1RU9L 2YD9A 4HJEA 4FQLL 5B2NA 3ASOB 1HJBC 4J4PD 3H9SE 1AP9A 4MQXC 1BIIA 1YHPA 3HCVA 2OAAA 5DC2A 5DMIH 2NSXA 4H8HA 2WO2B 3OHMB 3FFDA 4WUUB 3WSQL 1TETL 3IJ8A 2Z92B 4Z7UB 4P04A 4QO1B 3QH3A 5EMYA 3HAOA 3WXWH 2DQFB 4X6BA 2B8OT 2YN3A 2DDQL 2NTWA 2I27N 5F9DC 1HQRA 1RUPH 4OZFH 2NCMA 4ZSOB 2ITEA 4FQXB 3MGOB 3W9DA 5IR1A 3QI9B 5B1JC 2R2HB 2Z8VC 2NR6A 1CGYA 2BVQB 1TQWA 2UZIH 1NBVL 1Q5JA 2Y69B 3L3HA 1BVKB 3HG1D 4AZ8A 4YDLC 5BZWB 4JFQA 3GB7A 4WFHD 2FO4B 2RA1A 1AANA 1H8NA 2QQLL 4LHUB 3H3PH 2IWGA 5AOZA 4X7DC 4NN5C 2XWBA 4XZ4A 2CXKA 2MCAA 1S5HB 1INQB 2I26N 1U92B 4P9MH 2J3SA 2XZAH 3B8YA 4HKXA 3QISA 4HUWA 3VFRB 3OAYK 1DBBL 2WP3O 2NQ3A 3CE1A 3ABKB 1TZHA 4HX1A 1VENA 4AY0A 3EHBB 3V4VL 4PMFA 4IS6B 4RMBA 4JUTA 4V2BA 3WJLC 2J1KA 3O0LA 1DVYA 1P2CA 4QOKD 1GH7A 3G5VA 1BDYA 3IU3A 4FNSA 3BMVA 2WSDA 3HNSL 3TASA 2F1EA 3ZTEA 3UTTD 3P30H 2LU7A 2IV9A 3BWUC 5E99L 5GJTL 2W0LA 4LDLB 2Q2EB 5D4JA 1SQ2N 4KKRA 1ZSDA 3PP4L 4GW4B 2WMPB 2D7TL 4KGLA 2G0KA 3KYNB 3L5HA 4XODA 2ZP9A 5F93C 3T0AA 4OKVA 1CDIA 2NLJA 4HAGA 4PJ8C 3PWLA 4WCYL 3TF7C 4UINH 3CHQA 3NSJA 2J6EL 5DDHB 4NLHA 3MCKB 2P26A 3C60B 1PCSA 3AITA 2CG9X 4FN0A 3V6ZA 4EZKA 3QFJB 1MW3A 1N64L 2C1PB 5BRZE 3VNYA 4OZIA 1PAZA 5TK4A 4GMSL 3U0PB 1XSOA 1Q9LA 2VERN 3HKZA 2IGLA 2BVOB 5DHVA 4BUGA 4NPKA 2X05A 1PEWA 5D7LE 5CFHA 2HH0L 4NUJA 3MNWA 4YLQT 5L8KB 2DQIH 4WZ9A 2EC9T 4O02B 3EOBB 1AR1C 2VN6A 3O2VH 4W6XB 5FIEA 3W11C 1TNNA 1YZZA 1I3RB 5F1IB 2WOBA 4XAWL 3QRFM 2V9QA 2PYEB 4ATTA 4G7QB 4Z7WE 2AITA 3AY4C 4XMXA 1VF5C 5I1KH 5FGCB 4GY4A 5FECB 1U8QA 5AYTA 4LU5L 5I16A 3GSOB 4KXDA 4K8RL 4HU2A 4Y7MA 1A6ZB 5I8CB 3U9UB 3LKRB 4GO6B 3IJHA 3PXOA 2ZSWA 1CLYL 2A74B 5HYJD 4L1BA 5D1ZB 1FF5A 4KWUA 1DVTA 4Y7OC 1LE5A 5CSBA 1NUDA 4G1EA 1R3HB 2FNWA 3N1FC 4XP4L 2EVGA 4ZMPA 2HYMA 2JCCB 2XETA 2WINA 1S7RA 1WH0A 5FHAL 3GRWH 1NCNA 4U33A 3OGCA 1CYWA 3HRZA 2EVJA 1DVQA 1BJMA 1Y1DA 3GMPB 4LRNL 3ARDC 3FQRB 4YZFE 3VACA 3GPSA 5IHUH 5C6TL 4MMXC 4HIXL 3C2SA 4HWNA 4U1GB 1BPVA 4TVPH 5DEGB 3BEWA 1IL1A 2I20A 2APSA 2ENJA 3AC0A 5EBLB 4DGIH 2PR9A 1X5KA 1NL0H 1CF1A 4P46B 2DQGH 1DQLL 3RIAF 3ZXAC 5DWUH 3ZE1F 4XB3A 3O45B 4PJDB 1GYCA 1F4YL 3FTVA 5IWLA 2VR8A 4P23D 1J86A 3BE1H 3Q48A 1JNLL 1CXIA 2X1QA 2KPNA 4W70A 3EO0A 4R90H 5DRWB 2OMZB 3VXPA 5EV7A 1C12A 2JELL 5D6CB 2MCPL 4RBPK 2Z7YA 5I18H 4PJEF 4C57C 1X0K1 4C4KO 3KWTA 1I9EA 3VI4A 3APDA 4LLUA 3ECBB 4N0FB 4X4XA 1OE3A 2OMBA 4ONFL 3MLWH 4JMNA 5FYLL 4LSPL 5EDSA 3IDJB 3C12A 3L4ZA 3DXAE 4ZTOL 3MV8E 2P8LB 4K9JA 5D96B 1H5BB 5BRQA 5A16A 4PM1A 1U8CB 1ZHBB 2R39A 4XR8C 4Q97A 1DQJA 1WS7A 1IGCH 3QWRA 4O02H 5DS8B 3T4YB 2CO4A 2VDNH 4M8QB 3QZLA 5DUBB 3I75B 2DYPD 1HN1A 3RDTA 5AW3B 1FG9C 2ITFA 4WJ5A 5EZIL 2H2PC 1IGJB 1SDYA 4N5UA 1QFPA 2ODIA 3NAAL 3VSQA 2V37A 3K6NA 5GQBA 4AMWA 3EJZD 3STZB 1MWAA 5DT1H 5C07B 4LPVA 1S3RA 4ODWB 1L3WA 1V10A 4Z7OE 1OAXL 2DMGA 1F42A 5J56B 2YGOA 1EHKB 4PREA 2Q8AH 3QP3A 1IEAA 3PNRB 4M4RB 4NIYE 3T2NH 3VFPB 4P5KA 1LWHA 4XMWA 3MGAA 5J9PB 3IVKA 2Z91B 3CZJA 3FYIB 1P4IH 5T3XH 3SQRA 4F8QA 1MCWM 2F19H 1IC4H 4UT6A 5J6GA 3RY4A 1L9NA 1JHKH 2O6DA 2YPKB 4KHTL 5HYIA 4KZEL 5KSUA 2JB5L 3B5TA 2YC1B 5G4OA 2UV3A 3ARGA 8FABA 1N5AA 1PZ5B 1HWHB 2MWCA 3H54A 4TULH 1QBAA 3QQXA 2XWRA 4XTOA 1HYSC 3ZN6A 4UG2A 3MYJA 4LASL 4F7MB 2NX5B 2V7NB 1UXMA 1KGCE 1ETA1 1DVFA 4RGND 2O5NA 2K3TA 3EJQA 5BS0A 5FFGA 2YAPA 1XGRA 1SEQH 3NTCH 4AJ0A 4ESKA 1HOCA 1GU8A 2Z31B 2DQDH 5DHDA 3VXRA 1DDHB 4HCRH 4PJ5D 4Y1AA 2FQDA 3V4PA 4I77H 1WAEA 3VFGH 3I3BA 5FM5M 3WNIA 2HFGL 3AU1B 3PQRA 3B34A 1PZ3A 4MB4A 4AENB 4NLAA 1HNFA 5AD0A 4Y2LA 1JD9A 3SGEI 2X4QB 5AVUB 1DO5A 4QHLA 3SODB 1P7QB 4OZ4A 4A2HA 1TYRA 1KIPA 1X4XA 1IAII 5T5NG 1JPSL 2GG1A 4OCMC 4X4MA 1YNKL 1L9HA 2FL5B 3ETTA 3FB6A 4PRAB 2H7WA 3O3BA 4LF3B 2OS7A 1TJIH 1L3NA 1U9KA 4PUBH 1MQKL 4RCAA 3BSZH 3MV7B 1N5YH 4NYLA 2PCYA 5DFTA 3SE8L 5KKHA 1SRDA 3DX6B 3MXVL 2GK0A 4JM2F 1HI6A 1C9SA 1DSFH 4FS0A 3DK0A 4JO3H 4Y4KD 3AM6A 1NCWL 5F71A 1HSAB 4UILH 2X40A 4G6AC 4AEHL 5I1CL 1Z5HA 1MI5E 2YFNA 1CK0L 4APXA 3QJFA 3TYGL 2HT3D 4YFLI 2O26U 4H88L 4I48B 4L3EB 3JZ7A 1A65A 5LAPA 3SGJC 3TNNA 3CPLA 1EJOH 4OBRA 3ZO9A 5E1AB 3BXNB 3D6GA 1A1MA 5C0DB 5K9QI 1C16A 4RX4D 2LAGB 1WWWX 1EGJL 3IJEA 4OCLC 5D4HA 5HYEA 1CI3M 3BZ4B 5FDWA 1YN7B 3V4UH 3LNHA 2GJ6E 1RULH 1G1YA 4W4NA 1CBJA 5BW7A 5JA9A 3M1CA 3QEQA 3DX4A 3JWNE 3K1DA 4A7GA 4NSKA 4XHJC 1NBCA 1UHVA 1AHMA 3WIHL 5A7EA 1MFDH 3WV0A 1JGLH 1TVHB 4AL8H 3UTWA 2X10A 1MIEL 3O3AA 5INDB 4NZTL 2BP8A 3CHPA 4MMZA 4U2ZA 1DE4A 1KZYA 5D72H 3DO7B 3CZSA 2P8PA 1XVSA 4XCEA 2B1OA 1GAFH 4B6ZA 4JFFE 3NJGA 4PJ9C 5H2IA 4GSRA 1NWPA 4N8PA 2FB4H 3RWGB 2FQEA 2XVGA 3ZQXA 1JVKA 1QABA 5SWZD 4PYGA 2HB0A 3APMA 4W6WB 2ADIA 4R2GB 3UIYA 4C4BA 1U58B 3I9AA 4F7EB 2ZZLA 2QADB 3NIDF 4NC2B 2WWMD 4AMJA 3KPPA 3TWCL 1JYNA 3BHBA 1I8IB 4L37B 5HI5D 5I19L 4OIIH 2JKWA 4JQ6A 3CODA 2YN5A 4U1LB 3X1NA 1BFOA 4NUMA 4HG4J 4CSPA 1GCFA 2BMKA 3V95A 1QSFD 5JPNC 2UYLB 2LQRA 1XGPB 3I6LD 1G7HA 1UTDA 1TNMA 4HK3J 2GI7A 2X1PA 4Z7QF 1CICD 1VFAA 2ZG2A 4BD4A 3LKNA 3WIAA 1LTXA 3QUYB 3QNXB 4NO5B 4ORZC 4PRID 5ESQB 2VDQL 1RV6X 3TT1H 4D8PA 5BV7L 2YAQA 2H6PB 1B0IA 3P1VA 1MCWW 2R7EB 3QEUB 3S3PA 3QXUA 3PJLA 2Z93B 4DPAX 3T71A 2GTZB 1X5XA 1UKQA 2FWOB 1JXFA 2FYYA 5H2NA 5I1GL 3LMJL 4Y8DC 3S2AA 4OV0A 3UACA 2YDOA 4WWKA 1N0XL 2CJTA 5AG9A 4ZMZA 2OMNA 3EO9H 4JY6A 2EACA 1E3FA 1E5ZA 1X9UA 2Y72A 4X6EA 4UQDA 3MBWA 3PQYA 1D6EA 1Y6KR 5I15L 3OKYA 4RZKA 3VE0B 5IB1B 3DWTA 4D7BA 2AF2A 3AACA 5CGMA 4I5BA 4PD4K 1JGEA 3MRDB 2V5TA 1S7WB 3ZE0E 5FJGA 3U4EB 1WHPA 4JN2B 2RFXA 2GBTA 1HZKA 5A2JH 1BMGA 2PTTA 2B1AL 1TQBB 1IQWL 5FB8A 1ZA6A 2IOMA 5ITCA 3GI9H 1HE7A 3SKMA 4RRPM 2PO6D 2X7LA 1IEBA 5E2VL 3L4XA 3MRHA 3WNPA 1OVZA 2KI6A 3C75A 5A2AA 3RDTB 4PJXF 4YSRA 3QI9D 4KJQD 4YJZL 5BJTA 4PV8A 4Y2DB 3UGUA 1H9VA 1HXKA 1AHWB 4NNXB 4PY8I 4DUVA 4GI9A 4F2EA 4IHOA 4YVNA 1NCHA 5F3FA 3SN6R 2AXGB 3S35X 2YA1A 3M1BB 3VFOB 4F58L 1ACZA 5IQLA 4Y4FA 1BZQK 3DIVA 2DTMH 2BSEA 2ZSVB 1F11B 1UM6H 3IDMA 4N2KA 1FVCB 3D8MA 2OCCB 1HCFX 5D7IE 4HIEB 2WVUA 3RVXD 4Z7VB 3AG1B 3E7JA 4LDCA 3ECUA 2YFOA 5DS1A 2VLKA 5C08A 4TVPD 1F3RB 3AG4B 4FKHA 2JLLA 3H7BB 3J07A 2OL3A 4EOWH 1ZGLB 2BSRB 1C5DA 2XN9B 3EZJB 5TQ2H 4TOYH 4Y8AA 2FJFA 5EIQA 2DM3A 3O4LB 1CE6B 4DPBX 3WI9A 5GS2H 2ZCKL 2BX5A 3H6AA 1R3JB 1HQ4B 4XNBA 1Y0LA 2OPCA 1ZVYA 3EDKA 1ZEAH 5J0BA 2O6FA 1EFXB 1PD1A 3LRHA 1KPVB 4BRJA 4N0CC 5AW2B 4G6KH 5AW9B 3PCYA 3NMEA 1PJ9A 2BVEA 1TOXA 2XFXA 3MXWH 3DPBB 1KDIA 3QQ4A 1G7QA 1X5MA 3WFHB 4D3CL 4F8TA 4GT0A 1IBHA 2AQSA 4ZFOB 2Y1YA 1NCGA 2OXGB 5CEZE 1RZ8B 3X1GA 4OAWB 2EDNA 4PBVC 2R0ZL 3LV3A 5MEQA 1PJWA 4P2QA 3QUML 3I9GH 3O9WC 1QSEB 2QGCA 4KHXH 3KJ4C 3OF6A 2WLMA 4FI6A 4QXTB 4AKOA 5IMOB 4OLYH 4OSUH 3QAKA 4WW1A 4P59H 4KRLB 2WD0A 2ICEC 2J88H 5C0RL 2O6EA 1EVUA 4WW3A 2OW7A 3BKML 2P5WE 4M03A 4NQED 5EHFA 5HHPA 5F7EL 2WJ5A 4AC2A 3S97C 4DKEH 1C8RA 4L29A 1PPIA 2AQNA 1U8JB 3OR7A 1BAGA 3DTUB 1BQUA 1QNZL 3RAJL 2NT0A 1OW0A 1PDKA 3X14B 4YGAB 5C6PB 5IK3B 2JB6A 4DKDC 2MKLC 3V2WA 5IP4A 3KPNB 4KKNA 4KOCA 1YMMA 5JTWA 5H2KA 2GEQA 4L3AA 1BVKA 4YXHL 5T3XD 2C9AA 3GLDA 3OJDA 3TX4A 4FLOA 1B3IA 3ZKXB 1NFDA 1LMIA 4HJSA 4GAJL 3BUQA 1HILB 1XFPA 4M8UA 3WL9B 5FKPA 5GGRY 3NIFF 43CAB 3VXUD 5J06A 4QNPE 1PZDA 5KG9B 2KPWA 3BT2H 4MJ6A 5HHNB 3AREA 1MCRA 1R33A 2EDEA 2V2XB 2WSPA 4JHZA 1UT1A 4HXAH 4PJ7B 5D7SH 4ETYA 3H9HB 5E6IB 4FULA 4Z77A 1EEYB 4NO0A 5EORL 4WIQA 1J0ZA 5B6WA 2J44A 4V1DE 2NNAA 4NZRH 4FMVA 4Z7NF 1YEDB 1VZIA 1EANA 4IS6A 4MJIB 3QFDB 3LIZH 1U8LB 3DUSA 5IQMA 1MHCB 1ES0A 1IARB 2AK1H 4JGJA 5MENA 5EC2B 1C8SA 1T4WA 1JF1A 3NYKA 3WFCL 1E28A 4X7FC 2E75C 1FYHB 1PZSA 5J11C 1RUQL 2AK4A 3SE9L 4MAYC 1JNNH 1X9LA 3NSXA 4X5XB 4HOWA 1RUPL 1PZCA 4H0HB 3ARBB 3UZEC 5F1KC 5BVPL 1YEGH 3BD3A 1CB4A 2UWEF 3GFUA 3WNLA 1RZ7L 4KMTH 5D1QB 4XC3H 4X9IA 3Q43A 2XKNB 3S96B 5I66B 1M2OA 4JFSA 4KJWD 5DDHA 3OE6A 3MCKA 3SIKA 1VLXA 3CVDA 3MKKA 4L5FL 1NINA 1H0DA 2C1PA 5D2LE 4Q74A 3FB5A 3LRLA 4P9ML 5ANMA 5AYUH 1T7XA 2N59A 3BSHA 3HLAA 2D7QA 1XMWA 3N55A 3US9A 3NSBA 1FBKA 2D3VA 4LE8A 4LSUH 3G6JE 4ZFZA 4WK4B 3KWVA 4U4IA 5GZOD 4UOZA 2EI4A 4Q7DA 2NXZD 4F7KA 3RZCA 1SGKA 3FO0H 4PJGB 4U1MA 2E9WA 3NS0A 3CJJA 5H2BB 1U8IA 3RU8H 3OAUH 3P30L 3FUHA 4YIQA 4GOSA 4R0LA 1AXTH 1NBZA 4C56A 1ILUA 4XMUA 1G4MA 1HXMB 4XPBH 3FFCB 2NYYD 1G5AA 3LXUX 1BV8A 3N91A 1B9KA 1KT2A 1AO7A 5C09B 4RA3A 4E9LA 4LPUA 4NOFA 2XZCH 1XH1A 4NCC1 1OQOA 5A45A 2HFEA 4R96B 4A37A 5MP6H 5I8OH 1ZV5A 4CKVX 4PB0H 5CEYA 1PLAA 2PXYC 3GMPA 3CDGA 4G8IA 5FOBB 4Y5YB 4TLKA 3BZEA 1KSRA 2R0WH 4UIKL 2BSTA 2I5YH 2H9GA 5DEGA 3T77A 2I7SA 3MBEC 4IM8A 2YQ2A 1XGTA 3VJ6A 3L3OA 4JHAH 2DQIL 4UTBH 2K7QA 3L3JB 2A9CA 4J3OC 4JNXA 2KHAA 2DKMA 3BUDA 1BQ5A 4OI9A 4JHWL 4PJBE 5DK0A 1YYLH 1PSKH 1K4DB 4HJ0D 4Z3GA 3RX9A 3JT2A 2Y1ZA 4PJDA 4Y2OA 4QI3A 5BMFH 1I1AC 5DQDH 3MV9A 2BVTA 3L4YA 1PLBA 3DX2A 2A6IA 1P7QD 2X4SA 3QIBA 2A9MH 3UJJH 4UV4H 4DEWA 2WNKA 2Y6SC 1BF5A 5D6CA 4XZUB 3GUTA 1XHHA 4FQ1H 3O3DA 1SDDA 2I32A 3VWKD 3AB0B 3FRPA 2R23B 4QT5A 3TVMB 1F2XK 1BQSA 5EDXA 4JFYB 4PJCE 2HAZA 3V6BR 2WKOA 1MFAL 3GRWL 4R7NB 4XMTA 1KTJA 4UTAA 1EMTL 2ZXCA 3CBJB 1EJFA 3VXTB 1P84K 4YHKH 2V33A 1KJVA 3T4YA 3ZHLA 1B0WA 3D2UA 3EG9B 2WKLA 5DZJA 3T6VA 4M8QA 1N8ZB 2VMEA 3O6FA 5AW0B 5TE4L 4MD5B 2VIRB 4JPVH 5EPMA 5KVGE 5CXPA 3D0AA 2X4OB 1GSMA 4OZIF 2YPLB 1J9CT 4MASA 4DGIL 4EZJA 1I3UA 2D03L 2D7PA 2VJXA 1VKXA 4ODBD 5E94A 5HY9B 1FZOA 3STZA 4Z0BH 3TV3H 4NQDE 5DWUL 1RZKC 5DJ2B 2YLHA 3BJLA 3HMWH 4YR6A 4JQXA 1MCQA 2VZSA 3BE1L 2O30A 1SJEA 1A4CA 3V10A 1H3XA 5J9PA 1TITA 3HIZA 3C6LD 4LMQI 5K1JA 15C8H 1WFIA 3B56A 3C08H 1KB5L 1MFCH 4Q9BA 2HVJA 4TL4A 1SN5A 4OFYA 5HHOB 3WKQA 3KLQA 3FTWA 3MLWL 5EEXA 1XIWB 3CDZB 3MJWA 4LZKA 3NGBC 1YG9A 5DJDB 3VD7A 3S35L 3CC1A 4F7MA 2WLJA 1D3CA 3GMMA 3SPVB 1IGCL 3S48A 3MRKB 1MEXL 3KBPA 3W38A 1KV7A 2VDNL 3MZGB 3GHBL 4ZXBC 3QC5X 1ET8A 1FAKT 1MLCA 1KGYE 4E9SA 3WOVA 4G59C 3D18B 5C0GB 4P5RA 1G0YR 3D0LB 3VGAB 3K81A 2YD4A 2VZVA 3MUUA 4B27A 3OLGA 4M8RA 3WEMA 4JM2D 1KXQE 3LS5H 4HJGB 1BZDA 4ISVA 3IXTB 5JIMA 1DO6A 3P4NA 3U1SL 4GRMA 1DUZA 1RJYB 1QTSA 1CLZL 4IHBA 1PQZB 1W9XA 2H1LM 2Z8WC 3QA3A 2Q8AL 4AVIA 1FNHA 1JP5A 3AS3A 1P4IL 5T3XL 1A14L 3NPSB 3MRQB 4GRWB 3GJFA 4TQ8A 3T1FA 1TQSA 1U3NA 7PCYA 2FL5A 2CGRL 3GXPA 3TJPA 4UAHA 3EYSH 2Y2WA 2ZCLL 1TZOA 5TFSH 3MV7A 2AJUL 1UM5L 4HWBA 1S9YA 3AYNA 1UCTA 3TNMB 1GZMA 3VVWA 1XCXA 4JPQA 5E00B 2B59A 1HEZA 1JZJA 3VFVA 1VZHA 3KPOB 4N3UA 7FABH 3FQWA 3L1OL 3L3KA 2ZE0A 3HPJA 3IFLH 4G80A 2P8MA 2DQDL 4ABUA 4YDVA 2GT9A 4ODHL 3VYNA 3GUFA 4TQIA 4JFEB 4FXKC 1ED3B 1X5YA 4MBRA 4AQ8A 4I77L 5A1AA 4BFEA 2C1OA 5KUKA 5E1HB 3ODUA 3D85B 2JIXD 2N7AA 5DD1L 5JMRA 1YN7A 4PHXA 2CXGA 4E41A 1ACYL 1QHPA 2QPEB 4B9YA 4B50A 1VFBA 4AUJA 4KNQA 2CQVA 4XXDA 1M56B 4FL4B 3B9VA 3D39B 4OCWH 4P2RB 3RL1B 3U83A 3C09B 1QHOA 4DCQB 5LNDA 2E7BA 5INDA 4QF1B 4E9VA 5I1JH 5E6UB 1MKFA 1SBSL 5AVVB 4IKKA 2IBZX 3DO7A 1A25A 1CT8A 4MJ5B 3VCLA 4PUBL 4HGWB 5K1VA 3WY4A 2OK0L 3BSZL 1DJWA 3DRQA 4KQ3H 4BE6A 1IVLA 2VWEC 1JIBA 3E8UL 3EDJA 5DD5L 1MAMH 4OJFL 1G5GA 3UG9A 5DRZB 4JO3L 4TSBH 4ZS7L 5AW5B 4M9OA 2YJQA 2QSQA 3VI0A 1FYTB 4PBWD 3VGGA 2EIBA 4BFJA 1T21B 3D4SA 1CLCA 2OI9C 4ONHA 4H0GA 4XPHH 1BREA 3SYAA 1I8IA 2OJZH 1P6FA 4L37A 4E9RA 4OQTA 3ARZA 1A5FL 4XNMB 4CVXA 4YHNB 1EJOL 1L4IA 4KVCH 5DZOA 4IOIB 4U05A 1EA9C 2UVFA 4UV7H 4FADA 3IDIB 2XRAL 3BEVA 4JLRA 3CFIC 4HKZB 3CMGA 2X0VA 5TDOA 3OX8A 4XXCA 1R3LA 2EVHA 4M3JA 3DJTA 1RURL 3N40F 1RULL 4BKLB 4HUXB 4HKJB 2MTPA 4AQAB 4YSTA 5JQ6H 3UPAA 1MFDL 1JGLL 3WEOA 1QRNE 3VXQA 4AQ1B 3O4LD 4AL8L 1IGYB 4LSTH 5IQNA 3SGKA 5D72L 1X5AA 3QEUA 2VSKB 1KYDA 5KVFL 3OKOB 1YECL 3MV11 2E6JA 1U8OA 3CAFA 1BP3B 5AAMC 5IFAH 3V0DA 1XF2A 5JW5B 1QBBA 3ENEA 3PPEA 2ZWKA 2CDGB 2VB5A 1RFDL 5KTEL 3FQUA 2B1HH 1FNAA 1EH9A 5FOJA 4JJ5B 4X5QA 2JJSC 2K1MA 2YPVL 2VDRB 4ZQKB 4OIIL 1NDMA 1Z32X 4IRJB 1QSED 3WFBH 1YYMH 4GO8A 2H32B 2YMXH 4DKLA 2FTAA 2BC4B 3T08A 3VE0A 3RDTC 2V17L 1BF2A 1G4RA 4OCYH 1MHEB 4RWHA 4WO0A 2BDNL 1MQ8A 3CLWA 1S7WA 3E1F1 2IFFH 3K46A 1RZJC 3EDDA 5SWSB 4NQSA 1FAIL 3UAEA 3DMMB 2XOTA 4JO8A 4U1HA 2NY1D 4K23H 4A7GF 2AKRB 4AK1A 1T1ZB 4X50A 3SCMD 3VSUA 1BRDA 5HVHB 1DQTA 4Q6IB 2VT4A 1G7LB 3EOTL 4G7YH 4QPEA 2WXIA 1YNLH 2VLRE 2J2ZB 2FT7A 3DX0A 2BJML 3H55A 3UADA 2XACC 3T4AA 3MZTA 5KSAA 4KGJA 4NFBA 1IE5A 4G42A 2R8SH 2ITDA 4NJ9L 3RWJB 1DBMH 3N0PB 5DFWH 1DN0B 3T3MF 3IMWA 3WKPA 1CXFA 1NEPA 1E4JA 1RZGA 5EH1A 4CNIA 1E30A 1TQVA 5IG7B 4HHAB 4HS3A 1P7BA 1YNTB 2XJKA 1WT5A 3A5VA 4BFOA 2CO7B 3W56A 3CVCA 4QY8B 2EUWA 1T5XA 3F12B 2FE0A 4DGUA 2EXWC 4JFDA 2CBPA 5KN5B 1EJ6A 4FABL 3MNDA 1LP9E 5F8UA 2WNGA 3QHTC 1WIPA 4K94H 3FKUS 5BQDA 3X3GH 1ZT1A 2WN3A 4G8GD 5F8QC 5ECGA 1EFXA 2VLJE 4XN7A 4ZUSB 4IOFC 2ZOLB 4TNVF 1FG2B 3IMSA 1EO7A 2V2TB 4K7FB 2EIZA 3P4MB 4OD1L 4UT6H 1KXVA 4EI5D 2C8NA 3L2MA 3DPBA 1XH2A 3EOAB 1T66D 2F8VA 3ZRSA 4ZFOA 5HGBB 2BFVH 2Y02A 4Z95L 1L7TL 3QGVA 5DJXA 4C59B 3GI8H 4KZDL 3NCEB 3GSNB 3LH2L 1YEWA 2ICWB 2C3HA 3F2LA 2MQGA 3P9WB 3QIWD 4J27A 4WAFA 2F54B 1WO2A 3ZDXE 1GUEA 1TN0A 4QXTA 1AXSA 2W0FB 4R3SA 4DP2X 3SBRA 1M7UA 1HZHH 1LL1A 4H25A 4YK4B 3CSTA 4A68A 4K5YA 5CIPB 4ZNEE 3P0VH 4JCWA 3OKMA 2WTOA 1DFBH 1TVBB 1VDGA 1YAIA 4BA8A 3CFBA 3KPTA 1NAKH 3DX3A 2ATPB 5ADPL 3U1QA 2FRGP 4FQ2H 3N44B 5FXCH 5I0WA 2CO2A 3RWDB 3WFEL 4NWTL 5GGTA 1Z7JA 2CKBH 4K5LA 3UBGA 1MVFA 5JDJA 2Z73A 5KBKA 1AD9B 1ZEAL 4I3GA 1SHSA 5B38G 1FIGL 4IRZA 4E5XB 4MRBA 5C0NC 5DCCA 3U7WH 3X11A 4LBEA 2P5PA 4K9EC 4LVOC 2IDUA 1CGTA 5IIEB 5CCHE 1HH6A 2APBA 1R5WB 2C9QA 1WBZA 3NSFA 4XXJA 3BN9C 1UACH 1INDH 5F96H 2L4OA 1U41A 5AALA 3EBIA 3U4BH 4I0CC 1DEEB 2WK2A 4LOVA 1IT9H 3WO4B 2A9BA 2DIJA 3GMQB 3L4VA 4XPGL 1J5OL 3I9GL 1CQKA 3RFRA 4Z23A 2R69A 1LK2A 1BGXH 2FWLB 3A7KA 1T0PB 4OLYL 4OSUL 4P59L 3E6HA 3H56A 2QFRA 1ECZA 1RHFA 3BD5A 4XI5C 4X4YA 2BNUB 4CKQA 1OGAB 2BHFA 2J88L 4QYAA 3QFDA 1I8KB 1OHZA 1U8LA 2MPVA 1MHCA 2IO5A 2KS0A 3B9KB 2IBZY 4M6AA 4GUPA 1HTYA 4XNDA 5HI3D 2AJYH 4LCIL 4DPCX 1SFHA 3MOBL 4W4OC 3PGFH 4PFEA 2VLME 5IQ9A 1X5HA 3RZEA 1T2XA 5GS1B 1J1XH 1L5GA 1NBQA 1FI8C 3QNFA 2IQ9L 2VM4A 2ZKXA 4XBEH 3IJ7A 3HNVL 1CQYA 1NOLA 1ZE3H 4UDUA 5G4NA 1R6VA 4U6XA 3CMOL 2LLGA 5EIIG 4YXKH 5TTRA 2AGJH 3K4ZA 3E1ZA 3QR1A 4OVVA 3ZYJA 4HWZA 2VTFA 3VSTA 1FIEA 5CO1A 4BELD 4APQB 4N2MA 5F3BB 4RGOL 3DGCR 5A6LA 1IXFA 1MRFH 3VMOA 5FK9A 1HINH 5E5RB 3TBVB 1EZVY 4NT6B 3FN9A 3T0EB 1U91A 2CK0L 3BT2L 5CIPH 3QG6B 3P3UA 4WWKC 4AVJA 1QA9B 3UJIL 4BH7A 1IGMH 4ELKB 1CL7I 4HXAL 4QJ5B 2ADJB 1M6UA 4U1KB 5C0CE 3U9WA 2NR6D 4GIPD 1OAKH 4EIZC 1VRSA 5B3JF 4OV5B 1HHIA 3RI5K 4AYID 5GZNA 5KYXB 3W57A 1HWGB 4OFIA 2XG4B 4PJIB 4FP8H 4KNSA 5JZ7C 4NKOA 3QDJA 4DOHB 4L3CB 3D4YA 1JNNL 1UFGA 3MDJA 2Q1EA 4FTVA 1NGYA 2CDFA 3D69B 4ANXA 2N0MA 1L0YA 3WS6A 2VXSH 2FBJL 3T6WA 1AYRA 1UYWL 4KLYA 4AM0B 5E6YA 4BJLA 1P7KA 1NCCH 5KVEL 4XC3L 4L4VE 1G9NC 1NIAA 1GY2A 3R0NA 5F1SA 4HUCA 2ZUTA 1UWEL 3RVUC 4FI7A 1XIWD 3QUZA 4H8VA 1CDGA 3CTTA 3WFDH 2ZYSA 1A7OH 5ISZB 4BQCA 2JXMB 3FTSA 4DN3L 1UC6A 3LH9A 3C5ZB 3U2JA 3BRFA 3TPUB 3CQFA 3ESOA 2FK9A 2ZZUT 1NFDF 2WXLA 5EUOB 2LTQB 3MLUH 1M0LA 1BEYH 5AYUL 3SBPA 1Q0YL 1DVZA 1CLVA 4LLYA 1KEGH 1BG9A 3DTDA 3ARFA 4PGCA 5EUKB 2OMYB 3DVIA 4PI0A 3O2DA 2P44B 5LBSL 1DQQA 3W0WA 1I8LA 4AIZA 1K4DA 3SQOH 2EDKA 3NSYA 4ZJ9A 4MXQC 5KBNC 4LLVB 4ZO7A 2FX9L 4RZCA 5HPOA 2EC8A 3OZ9H 4IKJA 1U8NB 2B3RA 1AC6A 3RU8L 3OAUL 1BQKA 3PAYA 3UYOD 1JZIA 1AXTL 3VWJA 2WQXA 3MFFA 1L9MA 3BLKA 3PWVB 1PX8A 4O58H 3RWIB 3WKML 1FFNA 3UZVB 1KTBA 1YRKA 4G71B 5T3ZH 4B5EA 1M1XB 3ZSTA 1Z0MA 2GK2A 2B77A 4GH7B 3ARVA 3MRFB 2SEBB 1R0AH 5JIDA 2R23A 3OG6B 4XPAL 3TJEH 4XVSL 2NUTA 3L1GA 2ZUVA 1TTRA 4P57A 1W0WA 3ATDA 4YPGA 4K73A 5I8OL 5MP6L 1EHNA 2V2WA 1YC8A 1W8EA 4ZRGA 3QPQD 1O9ZA 4AV0A 1UCBH 5DQJB 2QKIA 4NKIH 2I25N 5ICYB 1N8ZA 2RACA 2B15A 1MAJA 2VISB 3M7OA 2X4OA 4KROC 1IM9A 3PAZA 3LEXA 4DAGL 5CCGE 3GRBA 2XTJC 4V33A 4WW2F 3FTGB 1IGFH 2J8UB 3KBHE 1YYLL 1PSKL 3HA0A 2HTKC 3LD8B 4K7PX 4OM1L 4PS4H 3UTSE 2EP6A 1TTGA 3US0A 2H2SC 5I8KH 3D85D 3TXAA 3VXOB 4LSQL 1KFGA 4PS7A 2FIKB 3SGEH 4AGQA 5B4MC 4JDZB 4N85A 2AQRA 2FEEI 2A9ML 3UJJL 4UV4L 1T89C 2KKQA 5KSBE 1ILSA 4Y19B 4Z76B 5ECJE 3PUUA 2YD1A 1PCXA 4JCLA 4L8BB 4MB3A 4Q2ZA 3WEAA 5LXVA 1IAIH 3GQFA 2ENPA 4M7LT 1FZMA 4YDKL 5FPIA 5DMJB 1XF4A 2DH3A 3QORB 3TTSA 4QRPA 1BLIA 1JXDA 3QDMD 1IE4A 1OW0C 3AXIA 3KHOA 3GO1L 5CD3A 4FQXC 5KSVA 1FFOB 2LU5A 5KWYC 5HGAA 1JZ8A 2W8CA 1YEHH 2AQ3A 1KELH 4N24A 2OZ4A 3SPVA 3I6KA 3MRKA 4AVHA 5DYFA 3RVWD 2JTDA 2N1TE 4OCNC 1MDTA 1BF8A 1J9RA 2Q10A 1S2EA 3QR0A 1FBIH 3VTMA 3LRMA 2YUZA 4JPVL 5DJ6B 5C0GA 4E9XA 3OE8A 4MA7H 2RCSH 3O8XB 4N2OA 4KK6C 3Q2CA 3UXFA 5KYWB 5DEFA 4KY1L 1T2JA 3MCLH 2WW8A 5AOLA 2X53A 5IVXB 2AJSH 5FYJL 3PWPB 4F9LA 1R3KA 4PYHA 2PTUA 3Q5OA 4NQVB 4Z3FA 2XICA 1RJYA 1IU1A 3HMWL 5GGQL 1QLEB 1PQZA 2WVSA 5F0PB 1JZHA 2A83A 5DA4A 3V0WH 4EUPH 3NIGB 4UM9B 2CCVA 1O7DC 3EHBC 4C4UA 1Z5LB 4QXVA 4PJAB 3RDJA 15C8L 4UQ9A 1LWJA 3C08L 4OGAC 1SZNA 1F13A 2OX5B 4Y16D 1MFCL 2C3VA 2DQUH 3LPFA 4A39A 3FU3A 1R9FA 5CNHA 4LOUD 2WUCH 3T9WA 2Q6WA 3AWEA 3IMRA 3MJ9A 1F02I 2YMTA 1AHKA 2YCWA 4HHGA 4PRPE 4ALAH 1KJ3H 3QDGA 2DQ6A 5I24A 4UZUA 1YEEL 4X4ZA 2YEZB 3UZAA 4P2OA 3C5SA 2YMOA 2WKOF 5E00A 12E8L 1G6RL 1JHLH 2Z4QB 5K69A 4JX0A 2OMUB 3IJ9A 1DVSA 2EDJA 4FNPA 4YSOA 1O0AA 1VGEL 4RAUA 1TTAA 3C60C 4DZBA 5IB4A 4KKCD 4H20L 2EZ0C 3ARGD 5IHZB 4LIQH 1JWMB 1J8HB 2E47A 3EJCA 3B7YA 4ZW5A 5JHDB 1AKPA 2QTVA 2P1YA 2YKLH 3DJ9A 4IJ3B 1RPKA 2WCPA 2ZAGA 3LN4A 3LS4L 4FLRA 4BGDA 4M43L 1DVFD 2J8OA 5E9DB 3I74A 1HL9A 1HK6A 1ET7A 4UYPA 5BS0D 3O0RL 1CD9B 2EKJA 4D9QE 4KDTA 5EO9B 4PJFA 4RISH 4W9CC 3VXRD 2GW5A 2RALA 4YSQA 1NAMA 4Z78B 4H1LB 4QRQB 1UASA 2IPKB 4JN1L 1GL4B 3EYSL 4R0LC 1TTUA 2WGXA 1DDTA 4PIBA 3B2UC 1I7ZB 2ALWA 2DKSA 5TFSL 4FFWC 4YSDA 4G2AA 3EFOB 3ULAB 1M71B 4LLWB 3NBNA 2P5EE 2XPGA 2A74C 2WHVA 4FC3E 5D1ZC 1F41A 4PS3A 3DVNA 2ZG1A 1CIDA 2KS9A 2NZIA 1OB0A 4PJHF 2X6BA 3F84A 1FYTA 1NDGA 3HHSB 3IFLL 1O7SA 5EC1A 1RLBA 1MI5B 1GJWA 1CJYA 4FYQA 3V5KB 4OIAA 2Z8RA 3CH1B 1I8UA 4H4NA 4YHNA 4XNMA 3EMLA 5CAYB 1ZV2A 4R26H 2WXNA 4U1GC 2WBWB 4HCFA 4HP5A 1V3KA 3BZFA 3QULA 1EHAA 2ZKHH 1BM7A 4IBVA 1YEKH 4AW7A 3P3RA 1F4HA 1I8AA 1MOEA 3JWNG 2BP0B 1AXIB 4P46C 4ZAKA 2NXYB 4HF5H 4ZFQA 4MSWB 2YRBA 2HPOA 4Y2NA 5L8JB 2IAMA 2OTUB 4WGVB 2EE6A 3GBML 4B53A 2WLIB 3KS0H 4JDVA 5K93A 4KXCA 3BVDB 2FUQA 1PKQE 5C0BE 1DSYA 1KYOJ 2JI2A 3LZNA 4WGKA 3UYPB 3WLWD 2FJGB 2AP2A 1KCSH 5ACLA 2GCYA 4KQ3L 5T5NF 3OKDA 3TFBA 1DBKH 2WKGA 1JUFA 3AXLB 4DVBB 3NDZE 5LG1A 3QJQB 1HSBA 3GSRA 4JQVC 1T04B 5JW5A 3KZ8A 2JQAA 4FFYA 3QEQD 4L4TB 2LAAA 5IVZB 1F4XH 4LDEA 4FX5A 5D96C 4N0RA 1H5BC 4ZPTB 3ZT5A 4ZQTA 4KJPD 1CWVA 5EWIH 1T5KA 1KYFA 5ESAB 2Z8SA 1WITA 3C8KA 4KVCL 3OQ3B 5INCB 4ETQB 2OBGA 4RRPG 2J55A 4X6DA 4LHQB 2EO1A 1JHTB 3HUJB 2P7TB 2C9SA 4NWUH 2OJEB 1EHXA 3ZKND 4BUOA 3Q6FB 1EJ8A 2IADB 4UTCA 1NH6A 2OXHA 4YZWA 3PGDA 4H1LH 2W0KA 4JHBA 1DUYB 3D51A 4WY7L 5SWSA 2EEBA 3ALXA 2PYFB 4TUKH 3KPSE 4LSTL 3FU6A 4NM8H 1B0GB 5F1OB 3V7AG 1Q9KB 4MQSB 3Q7JA 3U1PA 4BSVA 5A2KH 3SBQA 1QYGH 1YUHA 2N1KA 1KTKE 3KYAA 1UB5B 3EH1A 4R4FL 3CX5K 1Z3GH 4QI1A 2UZYB 4H26A 1N12A 2J20A 4U7SA 1PXSA 3FO2A 4U1NB 5I1DA 2I21A 1OV8A 1GHFH 4CW1A 1MFBH 1H19A 4IEFB 4P5TA 5I1AA 1B4JL 2MCG1 1CCZA 4UTAH 1D9KA 1G7PA 5CJ8A 5DUPH 4EI6A 1MFMA 1U42A 1YYML 3QAQA 2EDHA 5EOTB 3P0YL 2XV6B 2WZAA 2Z31C 4Q14A 5GISL 4YHLH 1R24B 1OPOA 1R4XA 2H4EA 1CDHA 3GIZH 2CO7A 3THML 5IEHB 1BBDL 3BCFA 2IFFL 4CC1A 3EADA 4BZ2A 3RGVA 5JMOC 2GHZA 3SDAA 5F7HA 2H3NB 2CWRA 4F9PC 2OMWB 5CINH 1MH5B 2Y36H 2CZNA 4YHMH 1RK1A 3PQYD 5LGKA 5AZEH 2ESVE 1YY9D 1GRWA 2PF6A 4FFTA 2CO1A 5ERWB 1QFHA 1X44A 1S8DA 4EZMA 2QVTA 4ZUSA 3W5NA 4N5ED 5AVXB 1FG2A 3TBSA 1YNLL 5HGDB 3SDDD 1KY6A 2WJLA 1M2VB 4M3KB 2IPUK 3QUXA 1H3GA 1IAKB 1WFOA 1HH9B 4A6YB 2A0LC 2CMRH 2VUYA 2W07B 4APQD 5T3ZD 3F83A 4LCCA 2L7UA 4JE4B 3PF2A 2P43B 5ID1A 4KXZI 4PHZA 1KBKA 4RETB 2VXQH 4Y4HB 1RMFL 3KS0J 2Y3NA 5DZPA 5TH2A 5BUGA 1A9EB 1SDAB 2ZCZA 1DBML 4KKPA 5CD5C 3T0ED 1S53A 1LD9A 5EBMA 5L9DH 1J5CA 2AEPH 4LO9A 4E2OA 4K7PL 1ZVNA 3CVHA 3EJJX 1PFOA 4CSTA 1ZTXH 3KDPB 4WHYH 3HAQA 4GQ9H 3TO2B 4J28A 3Q2VA 2DQJH 3ZDYB 4PU2A 4N28A 3EH2A 4AQ8C 5HDRA 3DROB 2EEAA 2NZ9C 2O61A 2JK5A 3HR5A 2ZPKL 1F45A 1MWAL 5C97A 1SLXA 1YPZA 3CU1A 2BLFA 4Y9EA 3RWDA 5MERB 2GABA 2CE6A 3SPIA 4JPWL 3LTVA 3OLEA 3S5ZA 2ZX5A 1FLRL 2KSAA 4FEMA 3C9NB 5D5MB 2L7QA 4MNHA 4XCYA 4EF3A 4KOBA 2VLKD 2HKHH 3GJFH 3U0WL 4U6HB 4F27A 5B38A 3RJQB 3U36B 3FU9A 4PLJC 2D7MA 2QVKA 4FHKA 4I0PA 3RNQB 2RR3A 4IRSB 4QRSB 1NC2B 4NZ8A 2PW1B 3D9AH 4XE0A 2H6UA 3B7RL 3GI8L 4HWBH 1MF2H 5EA0L 5IF0B 4K3DL 2ADYA 3PHOA 2ZYRA 3N50A 3VDAA 4M1GH 3O6KL 4WI8A 1KG8A 2F08A 1OCOB 4R2GC 3H9SA 1XIOA 5IHLB 2A1WH 2VWEE 2MPAH 2QADC 3OZKA 1K85A 1HZHL 1ZHLA 2CIKB 4XMKL 3QFGA 4KV5E 3V0VB 1CXLA 1BQHG 2I7OA 3NDYE 3UP1A 3P0VL 3CFCL 1OGAA 3IJSB 3VI3E 3OJMB 3V4PL 1EAPB 1NAKL 2NY7H 1WWAX 4WFHE 2CRIA 1UJ3B 4PGJA 1E8YA 3IETB 4YN3A 1KDJA 4KJYA 1T0MA 1BVZA 3FUFA 1AQDA 1XR8A 3H7LA 1V05A 3ZRFC 3FCTB 4KKBC 1ZLSL 5CJ5A 3QUKA 3AWGA 5GS1A 3M7FB 4LCWE 4OF7A 1ICTA 3OF6D 5DYOB 3FO1B 5C70A 4C55A 3QUYC 3BAEL 3NCJH 4GT7A 4NPYA 5DO2D 4HPHA 1JV5A 1JYWA 3BKCL 1E27B 1U8MA 5IBTL 4LLDB 5KYNA 5EIIA 4Z1PA 4EE2A 4M6OL 5F3BA 1UACL 1INDL 4LEEA 4GKZA 4OGXL 3B43A 3IGLA 4U1JB 1I9JL 4OLXL 3U4BL 1UADC 3HEIB 1K2DB 3UTTE 1IT9L 4DSYA 4JRXB 1H3PH 2BIPA 5ICXB 5GS0C 3Q3GA 2A4ZA 2QR0A 3L17A 1BGXL 3EYOA 4D9RE 2A38A 3VI4E 3OE0A 1YMMD 3OD3A 5IY5B 3K71B 1L6XA 3HLKA 3QIUB 4NFCA 1QWHA 2VH5H 4YBQC 2MSPA 3CLFL 1BEXA 2OMVB 2NNRA 2OMXA 4K5MA 5ELIA 4PJIA 1QHJA 3ZHNA 1W80A 4QWWC 4JRWA 3ZZQA 2J1WA 4N68A 2PTVA 3ZW3A 1EWHA 3LKPA 2AJYL 3LKQB 5C0AB 3FSOA 3D69A 2YWYA 4YL9A 3K4DA 3ARED 4HEMA 4WU5B 2BY2A 4FYTA 2UZXA 1W72L 1TQBC 3QORD 5IFJB 1FH5L 3O3EA 4NO0D 1MUJB 1GS7A 3TJHD 4K9EL 1ORQB 1F3JA 2F53E 1LEKA 43C9A 3HPLA 3SDCB 3HHMA 4LAQH 5MEND 1SNRA 4BDVA 1WFNA 4Y2DC 1MRFL 5BRZA 1AHWC 3LPOA 1B3JA 5HDBB 1VEMA 2AK4D 4IW4C 5J3HC 2CCWA 4BSJA 5KSAC 3VD4A 2EEXA 3RWCA 1KIQB 3ZIYA 1JV6A 3JVGA 4E9YA 1P8UA 5D7LA 3LHAA 2GB2A 1N67A 2L04A 3KE0A 4PS8A 1Y18A 4EXPX 4ABQA 5EU6B 1LGVA 4HBCH 5DYSA 5DO8A 4LSVH 1G9MH 4M61A 3B5HA 1BQLL 2I60H 3KVDD 4EKXA 4HUVA 3K6OA 4HMEA 5HHXL 1OP3K 4K07A 3GMNB 5PCYA 3CBRA 1DQIA 2ODHA 1NMCB 1UWFA 3SDYL 4FXLA 2EYRB