4N6HA

1.8 a structure of the human delta opioid 7tm receptor (psi community target)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
408
structure length
408
Chain Sequence
DLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562, Delta-type opioid receptor chimeric
publication title Molecular control of delta-opioid receptor signalling.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 175
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2013-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n6hA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n6hA02
3KJ6A 1AP9A 1F88A 4GP5B 5H2HA 3ZQYA 4X32A 5C1MA 4CJOA 2KS9A 2KSBA 2F93A 4G7RB 4U9EA 5B34A 3U8PA 4XT3A 4WGZA 4GBRA 4LDLA 3AYMA 4G70B 3FOPA 3TOMA 1Q5IA 3BVDB 1VGOA 3S8FB 2YL1A 3UTVA 4DKLA 4OV0A 2ZZLA 5AX1A 5H2PA 1YZAA 5AHZA 3SN6R 3S3CB 5AHYA 5A45A 1YZCA 3COCA 5KKHA 1E84A 1YYJA 3OE9A 1IW9A 4AMJA 3VG9A 1X0I1 1UCQA 3NMKA 1FBKA 1H68A 1S53A 4X31A 4CDAA 3QJRB 4QRYA 4FAAB 1APCA 3HAPA 4XT1A 5ITCA 3HASA 1KG8A 2J8WA 3UZCA 2YKZA 4WW3A 4JQ6A 1KGBA 3QJUB 4HWLA 5B6WA 3P0GA 1R84A 3QJTB 2RH1A 5EN0A 3OE8A 1AT9A 3QAKA 2WJKA 4UHRA 4BV0A 2I21A 2QPDB 5H2KA 5B6XA 3VGAA 4NC3A 5H2NA 5H2LA 1MGYA 2XM4A 2Y04A 2EI4A 3VI0A 1XIOA 3NSBA 3UG9A 5JVEA 2WJLA 4WAVA 1QPUA 5BR5A 3HNKA 5H2IA 3HAQA 1L9HA 5H2JA 2VT4A 3QBIA 4XTOA 1M0MA 5G28A 2YLDA 4D4NA 4N4YB 3CODA 4EA3A 2CCYA 4U9DA 5TGZA 1A7VA 4L6RA 4X1HA 4JEBA 2AT9A 4LDOA 3HARA 5JRAA 1YYXA 4XTLA 5A8EA 1Q5JA 3QBLA 1L0MA 2XL8A 1MQVA 4PXFA 3QDCA 4BWBA 3X3BA 1C8SA 1S52A 2J4YA 3HNJA 4ULVA 3EH3B 1QHJA 3OAXA 3PWHA 5AWZA 5G54A 2J9BA 5JS5A 1CGNA 1P8IA 1S8JA 4K5YA 5BR2A 5B6VA 3OE0A 3L1MA 5AZDA 1X0K1 3HNIA 2YDVA 1F50A 5G36A 5AGFA 1E0PA 1O0AA 4AMIA 3HAOA 3UONA 4CJGA 2Y02A 3NMIA 3FOOA 1S8LA 1RCPA 4G71B 2Y03A 1PXSA 5G2DA 3QJSB 5ETZA 4IAQA 3QAPA 2BC5A 1P8HA 4LDEA 4TL3A 4ER9A 5JLIA 5G2AA 1LN6A 3UTWA 2YCZA 1JAFA 5DHHA 2BRDA 3T45A 3ZTMA 3VW7A 1JFPA 3A7KA 3VVKA 1CGOA 2YCYA 4HYXA 1CWQA 2R4SA 3C63A 2YL0A 2YCWA 5B35A 2XLVA 4QI1A 4IARA 5JJJA 2YL7A 1EHKB 4MQSA 5H2OA 2LNLA 5J7AA 2QLAA 3TOLA 3S8GB 2KSYA 4MQTA 2JAFA 4BVNA 1QKPA 3C62A 3EH5B 4GRVA 2Z73A 1XJIA 3DE9A 3QJVB 2ZFEA 1U19A 3IQ6A 2YL3A 3M79A 1EKYA 1BRXA 4DAJA 3REYA 1GQAA 2HPYA 3ABWA 1GUEA 2G87A 3RFMA 5DHGA 3QVYA 3IQ5A 3NS0A 1TN5A 1M0KA 3AYNA 2JAGA 2R4RA 3WQJA 5JT4A 5LWEA 256BA 4G7SB 4CDVA 1JV6A 2Z55A 2YCXA 3S3BB 3D4SA 3UTYA 2M3GA 5JUAA 3ZPQA 5AX0A 1BRDA 4EIYA 3EMLA 1IW6A 4KLYA 4EJ4A 4XXJA 3ODUA 3M4CA 4A4MA 2QPEB 4G72B 1E85A 1TN0A 3NMJA 1JGJA 2NTWA 3PQRA 1S51A 5G53A 1QKOA 3HNLA 1XMEB 2XM0A 5B6ZA 1E83A 1BM1A 3ZTZA 1HZXA 1KG9A 4KNFA 3X3CA 4FA7B 3UZAA 5JP7A 3VHZA 2I20A 4DJHA 1LM3B 2XLMA 1S05A 4L35A 5B0WA 4QIDA 1S54A 1BBHA 2I35A 4GYCA 2X72A 4XTNA 3QJQB 5B2NA 3QBGA 3PDSA 2KSAA 1QQ3A 1PXRA 4N4WA 3ZPRA 4MD2A 4G7QB 1P8UA 4JKVA 1VJMA 3QW0A 4FPDA 4GP4B 3UTXA 1BRRA 5FJGA 2F95A 1M6TA 4N6HA 1C8RA 4D4XA 4BUOA 2NTUA 1X0SA 1JV7A 5B6YA 4HYJA 2L6XA 2XLOA 5B3IA 4Y9HA 3V2YA 3QW1A 4GP8B 4BEYA 5H2MA 2YLIA 2Y00A 2ZIYA 3QBKA 3ZEVA 1F4ZA 3OE6A 3PBLA 2YLGA 1E12A 1FBBA 2XLWA 4WGYA 1IXFA 5ITEA 3C9LA 2XL6A 4J4QA 1C3WA 3V2WA 3NY9A 4CIPA 4IB4A 4CX9A 1CPQA 3ZQVA 3DDLA 1UAZA 2PEDA 5A44A 1M0LA 4PXKA 2Y01A 3DQBA 2I1XA 3DE8A 3MBVA 1H2SA 5JSLA 1KMEA 3NY8A 3RZEA 3AM6A 2XLEA 5JJEA 3NYAA 3M15A 3VRCA 3S3DB 3CAPA 4FBZA 3C9MA 1E86A 1R2NA 4CDYA 5G2CA 4JE9A 5JJNA 1NBBA 3ZWIA 4JR8A 5DYSA 3EH4B 4MBSA 3PXOA 1CPRA 5F8UA 4JEAA 1PY6A 4MD1A 1QM8A 1GU8A 2XLDA 3M4BA 2XLHA 2YDOA 3HANA 1DZEA 4UG2A 4GPOA 3QVZA 1GZMA 4BEZA
chains in the Genus database with same CATH superfamily
1AP9A 1F88A 3KH2A 1YA7O 4NTAA 4X32A 1LI5A 1ZW2A 4G7RB 5B34A 4GBRA 3AYMA 4G70B 3TOMA 1HMOA 4N06A 2EIJC 2CW0F 2YL1A 1OCZC 4DRJB 3DD7A 3I5PA 3S3CB 2HMZA 2ICWG 4ZLDA 4YWQA 4CS7A 1MNEA 1VB5A 2CNWD 1H9TA 3EHNA 1FBKA 4OIPF 4P6IC 4X31A 1AVOB 4CDAA 1ST6A 3UZCA 2XSEA 5B6WA 4HWLA 4DS7E 2KGOA 2OU6A 2RH1A 4I1OB 3ASNC 1VLTA 4EBKA 2KQ9A 2WJKA 4JIOA 4JCZA 2W4MA 1LKXA 3SP1A 5H2KA 5B6XA 4JCHA 1XIOA 1D0YA 3JYYA 3SXMA 3HNKA 4I3MA 3HAQA 1K05A 4XEFA 5H2JA 2EPMX 4XTOA 1HW1A 4JTDB 2YWAA 4EA3A 3HLZA 4EHPA 4XPYA 2UUHA 3K66A 2IM8A 2PNOA 3DI5A 3S0XA 3K7DA 4XTLA 1L0MA 3ZIBA 3QDCA 4NTBA 4PFPA 1IW7F 3FXHA 1S52A 2D4UA 4ULVA 4MTGA 3PCVA 5G54A 1S8JA 4K5YA 5BR2A 3OE0A 1SZIA 2RSEB 1J8YF 3S28A 3EGXB 3Q7LA 1JPNA 3JTLO 2R7VA 4A4AA 1E0PA 2Y39A 4O7GA 3U3BA 4CJGA 3PMRA 2Y02A 2IXMA 1ZHTA 2J45A 3FOOA 1RCPA 1PV3A 4LDRA 2Y03A 1MMAA 5COFA 3FHDA 2M4EA 5D91A 2P7VA 1P8HA 3W2WA 2R7OA 3KKBA 1LN6A 2Q4FA 1XWJA 1OCRC 5DHHA 3IQTA 1JFPA 1OXBA 4HYXA 5FCLA 3C63A 3TK0A 3OA1A 2P1AA 3G4XA 3AG3C 1B68A 4QI1A 5JJJA 4JRZA 3MYIA 2QLAA 2QTVA 4MQTA 1SMYF 4IAOA 4BVNA 4HFKB 2YZSA 3C62A 4XEKA 2DB4A 3EZHA 1XZPA 4E18A 3QJVB 1EA8A 3GORA 1A7EA 2YL3A 3M79A 1BRXA 3K33A 3ABWA 4NTFA 2L81A 1ZHWA 3QVYA 1S7ZA 1G4US 2KC3A 2HMQA 2Q7RA 3WHNA 4AL0A 1M0KA 3AYNA 2R4RA 2HZ8A 5FZTA 5LWEA 2LD6A 4DBRA 4CDVA 4M63A 2YEVA 5DQZA 1NG1A 3UTYA 1LE4A 3ZPQA 2IYLD 2VH3A 4XXJA 5EHHA 3M4CA 3S27A 4A4MA 5L0JA 3V5ZA 1E85A 1TN0A 2DGJA 4JTCB 1T01A 2NTWA 4MVUA 1QKOA 1XMEB 1BM1A 4KNWA 3LLIA 3UZAA 1T6UA 4DJHA 4KC9A 3EH2A 1LM3B 1YVIA 4XWJA 5B0WA 1Q0FA 2V3CC 1OKKA 4QIDA 3I5QA 3AQBA 4DOZA 3GEHA 4O6YA 3DM9B 3R2PA 3FMSA 1QQ3A 3ZPRA 3AQCA 3QZCA 1C03A 4JKVA 2WZFA 1OCOC 3EQLF 2ZXWC 5EK0A 1C17M 1NFOA 2XS8A 1VYIA 4IGGA 2J7PD 2NG1A 3QTHA 5B6YA 2L6XA 1Z6AA 2Y69C 4Y9HA 1QLEC 2H8AA 3F46A 2YQYA 2WVOA 1D0XA 3QBKA 4LDKA 3LNMB 2IXNA 3OE6A 3HTKC 1YLMA 3ITFA 2FAPB 1YDIA 1E12A 2XL6A 2NUPA 2VC9A 4J4QA 3NYMA 1FAPB 2P6VA 3S84A 1G8XA 2AVKA 4H4KC 4CIPA 4CX9A 3SYNA 3ZQVA 2AP3A 4FAPB 2MWQA 4BJ1A 3DQBA 4KI2A 3MBVA 3NY8A 1HMDA 3AM6A 2XLEA 4CBEA 3NYAA 3VRCA 4FBZA 1E86A 5G2CA 4JE9A 1NBBA 3ZWIA 5DYSA 1Z63A 3PXOA 4MW3A 5F8UA 3X1OA 1MMNA 2LQGA 5E33A 4MD1A 1JOGA 1WATA 5D92A 1GU8A 4YN0B 1WASA 3HANA 4GPOA 1NSGB 3KJ6A 4ANJA 5KYWA 4RDAA 2UUIA 2R7QA 5L3VA 3HJCA 2KSBA 2ZD9A 4U9EA 4DBQA 4WGZA 4LDLA 2XL4A 3EPVA 3FOPA 3S9OA 4DKLA 2NSFA 2R7XA 1Z23A 5AX1A 1Z3IX 1YZAA 5AHZA 1W2WA 1YZCA 3COCA 3H65A 5KKHA 4MW8A 3WAQA 3R7CA 1X0I1 3ABLC 1H68A 5BUOA 2W45A 2KW3C 3QJRB 2HJ3A 1APCA 3UNGC 1Z5ZA 3HASA 1Y6DA 1KGBA 3QJUB 3P0GA 3QJTB 4MVOA 2Q3TA 1TWHA 3OE8A 1IZMA 1AT9A 1O87A 3UGOA 2Y3DA 1OR2A 4XLNF 4K1OA 5F5HA 3VGAA 5DVWA 5H2LA 3W8HA 1MGYA 2ZXOA 3NSBA 1ORSC 1LI7A 4LACB 3RKOF 3DJNB 5JVEA 2XRHA 5AC5A 1GS9A 5T3WA 1H7IA 1M0MA 1KTMA 4N4YB 4EWCA 1LS4A 4IRUA 3CODA 5TGZA 3A11A 1A7VA 4OD5A 5B3SC 2CDQA 2AT9A 4YL3A 4LDOA 3ZDLA 3V7OA 1QZXA 3L34A 5A8EA 2P61A 1EQ1A 3CZ6A 4CS8A 4BWBA 1L7CA 4OD4A 3EH3B 3JRTA 3K1HA 1K04A 1QHJA 3OAXA 5AWZA 3H2VA 5JS5A 1CGNA 3FAPB 5B6VA 3LS0A 3JSEO 2GWWA 3AGUA 4O6MA 2CGEA 1X0K1 2J0WA 3OEOA 1ZU4A 5G36A 3HAOA 4GEHA 1G4WR 1OW8A 1S8LA 3QJSB 2HSBA 4MNDA 3TJ5A 3PDMP 4TL3A 4A2NB 1NU7D 5JLIA 4G7ZF 3UTWA 2YCZA 1OW6A 2BRDA 1VLSA 3A7KA 5K0IA 1VK5A 1CWQA 1I4ZA 3CSKA 3T9OA 3CAXA 2YCWA 2E87A 5B35A 1ZYRF 2A6EF 3O6XA 4IARA 1QKRA 5L3QA 2OCCC 3U2MA 3EH5B 2X51A 4GRVA 4RBNA 2LCHA 1D0ZA 5L0FA 5AC4A 1XJIA 1BR4A 3DE9A 2EILC 3RQFA 3Q6MA 3IQ6A 4DAJA 3REYA 1GQAA 1D1AA 2HPYA 2NUPB 2QNLA 3V5YA 1GUEA 2G87A 3C18A 2W4BA 1NFNA 1OKKD 3NS0A 1O5HA 5CIVA 2VCAA 3NKEA 3U8VA 3EGDA 4AL1A 3NYLA 5BQGA 4G7SB 1LVKA 2R02A 1MMDA 2M64A 3V5XA 4JJFA 3LESA 2A69F 5JUAA 5AX0A 3TQOA 1BRDA 1VOMA 2L9JA 4EJ4A 2B0JA 4Q7CA 3ATPA 5EGYA 2HFIA 3PQRA 3HNLA 2XXAA 3DM5A 4BJ6A 2XM0A 2QE9A 1G5ZA 1E83A 1KG9A 4KNFA 5KYWB 5JP7A 3VHZA 4BJ6C 4U5CE 2I20A 2IXPA 3TD7A 2ETSA 3SZRA 2TMVP 3MLGA 4BEJA 2RD9A 4PJJA 2OKUA 4MTFA 1FFTC 4JZAA 1U89A 4YJWA 4U5HA 3RH3A 4GYCA 5B2NA 4PJMA 3QBGA 3JYHA 2KSAA 1YAUO 4U5EE 3GEIA 2MYSA 1NLXA 2C03A 2R05A 4G7HF 1ORYA 1TR2A 2PP4A 3GEEA 1WWPA 1M6TA 4N6HA 2H7OA 3DAGA 4GYTA 5CI8A 1V54C 2EPOA 2NTUA 1X0SA 5TJ5E 4DJ9A 1ZU5A 5B3IA 2AU5A 4GP8B 3JRMO 3VYWA 4BEYA 5DLJA 1ZVZA 1JMWA 2ZIYA 1YARO 3F47A 1R5ID 2ZXPA 3C8GA 1GGQA 2HJMA 2JX0A 2B0HA 1JR8A 3U5SA 3NYJA 3C8ZA 1FBBA 3X2QC 4Q4ZF 2VCBA 1C02A 1UFBA 3V2WA 2WVNA 5COGA 3LEOA 3NY9A 2KSFA 3RQGA 2OEXA 2Z15A 3RFYA 4BPMA 3DDLA 3SXKA 3MYFA 5A44A 4XEVA 1OW7A 2Y01A 2J46A 2I1XA 1ZHXA 4Z9IA 1H2SA 5JSLA 5JJEA 2KJGA 4XQ1A 4QI0A 2L6FA 3S3DB 4KNVA 3CAPA 1V74B 4JTAB 4JR8A 3I4UA 1FR0A 4QDLA 4QI2A 4JEAA 3U9JA 2Q9AA 4JURI 4X0RA 1RKEA 3LUTB 1VMAA 4KBLA 2PBEA 4CSAC 2YDOA 3OWTA 3G50A 4DVYP 1DZEA 2WL8A 3AJMA 3QVZA 4CS9C 2AWYA 2LSEA 3O10A 3O39A 2R7UA 5H2HA 3IQCA 3ZQYA 1M57C 3POVA 2KS9A 2F93A 4XT3A 4K0DA 4BEMJ 1RXQA 4MVRA 1Q5IA 2R03A 4MVQA 1ORJA 1VGOA 3FDQA 4LLCA 3UTVA 3T6GB 4OV0A 3G4ZA 2ZZLA 3SN6R 5KYYB 4I44A 5AHYA 4PFOA 5A45A 2EPLX 1U6HA 1A41A 1YYJA 3OE9A 3VG9A 4AK9A 3TULA 3NMKA 1WOLA 3GM2A 1S53A 5T1DB 2A68F 2DI3A 4FAAB 1TWGA 3HAPA 4XT1A 4WABA 2J8WA 4NQFA 4WW3A 1N1CA 1HW2A 4IWBA 4PACA 4ULWA 3LEVA 2GA0A 4AX2A 3LNRA 2OG2A 4K7BA 2H7VC 4UHRA 2L6GA 1BZ4A 3ZC4A 4BV0A 2I21A 1LPEA 3ABMC 2NPUA 3GODA 1M2OA 2Y04A 2EI4A 4XTKA 3UG9A 1A7DA 1ZHZA 4YL0A 4WAVA 1Y4CA 5BR5A 3B9QA 1VTMP 5BQHA 1NZEA 2VT4A 2CCYA 4U9DA 1YJGA 4Z9JA 4OIQF 3KYIA 4L6RA 4XPWA 4X1HA 3Q6NA 3KPHA 4BEZA 1PCXA 2GFHA 3EGDB 1I5NA 1YYXA 5F28E 4N6CA 3UGPA 1TFOB 4PXFA 2G62A 3JT1A 1C8SA 2OJQA 1CGME 1T6QA 2EPNA 3PWHA 2J9BA 1P8IA 3JCUQ 1MNDA 1QVXA 3DZAA 5A6BA 2XXAB 1A0BA 5COMA 4PK4A 1F50A 3U9MA 4J7TA 4YK5A 4AMIA 3EZIA 2IBFA 3L8IA 2I8BA 2LFFA 2Y3BA 4P9TA 2A0UA 2WVQA 3HKKA 1PXSA 5ETZA 5GPGB 4ONSA 2BC5A 4YT8A 4ER9A 5G2AA 2I15A 4BG0A 3ECSA 1JAFA 3ZTMA 3US6A 1D1CA 1FMVA 4FWVA 3IPMO 2R4SA 2VASA 3K1IC 3T6BA 1TQGA 2HS5A 1SF8A 2WB7A 3RVYA 3AGTA 1TWAA 2JD3A 5L0CA 1EHKB 4MQSA 3H2UA 3EJNA 5H2OA 2LNLA 5J7AA 3TOLA 3UMHA 1FFHA 3J06A 4C7OA 1QKPA 5HSWA 3RIPA 1V4AA 3TJ6A 2ZFEA 3C8GB 1U19A 3NG1A 1J8MF 1EKYA 4W8PA 4OIOF 1FNTc 1LS1A 1HE1A 3MBGA 1TN5A 3KL4A 3QMKA 2JAGA 2A1DD 1SYQA 4U5FE 3U2LA 5JT4A 1LE2A 1DOWA 2BE5F 2Z55A 3D4SA 1RJ9A 1OXKA 3DMDA 3SXYA 3W4YA 2M3GA 2Q9BA 4E7ZA 1RKCA 3LJBA 1UG7A 4EIYA 1E2XA 3EMLA 4YL1A 1IW6A 4KLYA 3ODUA 1OR3A 5L0HA 2KYHA 2QPEB 1AEPA 5T3TA 1RKEB 3NMJA 1S51A 5L0IA 2HV6A 3ASOC 4E0HA 4EUKB 4BJ5C 3C8GD 3X3CA 2BL2A 2OQMA 5KYXA 3T6JA 2LP4A 1MMGA 1D1BA 2XLMA 4E17A 3AG4C 2VB6A 3T4RA 1S54A 3GM1A 5DS6A 4C3BA 3CEXA 5KYYA 2Q00A 2X72A 4XTNA 1FTSA 3EFOA 3ZVRA 4N4WA 2EPKX 1P8UA 2ZXRA 2DYRC 3CQZA 5KYUA 4FPDA 4GP4B 3AG1C 2F95A 3DKAA 1C8RA 4JVSA 4HYJA 2XLOA 3EG9A 3GWLA 4G0HA 5H2MA 2LK4A 4Q5SF 1F4ZA 5E3CA 3PBLA 4E0IA 4MS2A 2XLWA 4BJTA 1TFKB 3EHMA 1C3WA 3BEHA 4NY3A 4DXWA 3JSZA 1M2VA 1H9GA 2Q9CA 1CPQA 3VM6A 4LLEA 1UAZA 2PEDA 1M0LA 1K40A 3RW0A 3N0TA 3DE8A 4JC7A 3NRHA 3EH1A 2F22A 3C9MA 5JJNA 3LLKA 4AE4A 4C3DA 1F1MA 3EH4B 3RF3A 4MBSA 3JZ0A 2A0BA 4LERA 2WZGA 1SR2A 5BQIA 1PD0A 2CYDA 3VAYA 5A6JA 4H54A 4DRHB 3AG2C 2XLDA 2XLHA 5CI9A 2FFHA 3DWWA 4F4BA 3BRJA 4Z9HA 4GP5B 3KMIA 5C1MA 2OOCA 4CJOA 1AUEA 4XPXA 3U8PA 3E70C 2QY9A 2HSQA 3BVDB 2D5RB 3S8FB 1WGWA 3IEEA 3B0PA 3S29A 5H2PA 2C04A 4UDVA 2G3KA 3IHUA 3FAJA 4NCQA 2L6HA 2IXOA 3SEOA 1E84A 1IW9A 3WG7C 4AMJA 2PX0A 1UCQA 1OQCA 4HFFB 4QRYA 2W9YA 5ITCA 1KG8A 2YKZA 4JQ6A 5A6AA 1T6IA 2LIGA 1R84A 4C7OB 3NKDA 2A6HF 5EN0A 1PD1A 3QAKA 4EBJA 5A6BD 5B1AC 2QPDB 1H6GA 1BDJB 4NC3A 5H2NA 2XM4A 3VI0A 2JPUA 4J32B 2NUTA 2O9XA 3NDBB 1DOVA 2WJLA 1QPUA 2H7BA 4XLPF 5H2IA 1L9HA 3QBIA 4IJJA 5G28A 1ZZPA 3SXZA 2YLDA 4D4NA 1O3UA 4YT4A 3L0IA 4P9FA 4DVZA 2J9UA 4JEBA 3U0CA 3C7JA 4E7SA 3HARA 1TWCA 5JRAA 3FVYA 2CNWA 4B6IA 1Q5JA 3QBLA 1RJ9B 3LS1A 2XL8A 1MQVA 2J9VA 1I4YA 4J7YA 3X3BA 2J4YA 4CSAA 3KYJA 2Y3HA 3L8JA 3HNJA 3RYLA 4OIRF 4CS9A 4G7OF 3W8IA 2WZLA 2ASRA 3UMKA 4C3EA 1FMWA 4J30B 3L1MA 5AZDA 3M1CB 2NSGA 3HNIA 4U5BE 2YDVA 5B1BC 5AGFA 3VF0A 1O0AA 1ZHYA 2J9WA 4DRIB 3UONA 5KYXB 1KNYA 3NMIA 1LIHA 4MTOA 1KU2A 4HE8D 4G71B 5G2DA 4IAQA 3QAPA 1M56C 4W8KA 5E3AA 4LDEA 3DAFA 3W2VA 2HUJA 3EFOB 4O79A 3T45A 3VW7A 2R9RB 3VVKA 1CGOA 2PX3A 2YCYA 5F5FA 2YL0A 5KYUB 5E2QA 3N2ZB 2XLVA 2YL7A 1T9KA 4ZLCA 1Q0MA 3S8GB 2FGYA 2KSYA 3EG9B 2G3VA 2JAFA 3A9CA 2R7TA 3S90A 2Z73A 2ZPAA 2X0CA 2XS1A 3O55A 1QSPA 3UMIA 3U3FA 2LFDA 1HY5A 2GDCA 3ZSUA 4MVSA 2KNHA 4YT5A 3RFMA 5DHGA 3IQ5A 2P0NA 1M2VB 1T5OA 3GWNA 1Q0DA 2DYSC 3WQJA 4MVMA 2YVKA 1RMVA 256BA 1JV6A 2YCXA 3S3BB 3LAYA 1JPJA 3ABKC 2VCCA 4AE4B 3RQEA 4FX5A 5A6KA 1OCCC 4G72B 4U5DE 1JGJA 3EGXA 5G53A 3DXJF 5B6ZA 3ZTZA 1HZXA 4FESA 4FA7B 4OINF 3MX3A 2PF4E 3K6BA 2KK1A 1BR1A 1S05A 5L0DA 4JJGA 4L35A 1EI7A 3B0VC 3WODF 1BBHA 2I35A 2V26A 4WJ0A 3K1IA 4GQHA 3QJQB 2EINC 4LDQA 1NU9C 3PDSA 1V55C 1PXRA 3AOUA 4EBBA 4MD2A 2GAQA 4G7QB 2QUPA 1VJMA 3QW0A 2HKVA 2OJED 3UTXA 4PJNA 1BRRA 5FJGA 1GM5A 3PHF2 1ZW3A 4D4XA 2HV7A 4BUOA 2EIMC 3B71A 1JV7A 5DQTA 2EIKC 4YT2A 1Q0KA 3V2YA 3QW1A 1VYKA 1WTYA 4PR9A 3UR3C 2YLIA 2L7AA 2Y00A 2YHSA 3DJUB 3ZEVA 4RD9A 5DS4A 3MFNA 1L3PA 2YLGA 2MHRA 5L0GA 4WGYA 1IXFA 5ITEA 3C9LA 4MVZA 1WN0A 2AWCA 2NUTB 4HEAJ 4U5GA 2OEVA 1Z7Qc 2IOQA 2PFDA 3E9VA 4IB4A 2R7WA 4I1MA 2Y3GA 5IY5C 4O6NA 3Q7GA 3GM3A 4JW1A 4PXKA 1R4TA 3B29A 2J0XA 3GANA 1U0BB 1KMEA 3RZEA 2R25A 5DS5A 3M15A 1XZQA 4EKWA 1R2NA 1YA9A 4CDYA 1TKNA 4G78A 3N24A 5A69A 2R7SA 2J7PA 1CPRA 3ZG1A 2R7RA 1PY6A 1BR2A 3RVZA 5HV9A 1QM8A 3SNHA 4BJ5A 1JRAA 5KYNA 4CS8C 3M4BA 4PJLA 2YRFA 4UG2A 4CIHA 4MQ9F 1GZMA 3B0UX 1HE9A 4R32A 1Q0GA
chains in the Genus database with same CATH topology
3KJ6A 1AP9A 1F88A 4GP5B 5H2HA 3ZQYA 4X32A 5C1MA 4CJOA 2KS9A 2KSBA 2F93A 4G7RB 4U9EA 5B34A 3U8PA 4XT3A 4WGZA 4GBRA 4LDLA 3AYMA 4G70B 3FOPA 3TOMA 1Q5IA 3BVDB 1VGOA 3S8FB 2YL1A 3UTVA 4DKLA 4OV0A 2ZZLA 5AX1A 5H2PA 1YZAA 5AHZA 3SN6R 3S3CB 5AHYA 5A45A 1YZCA 3COCA 5KKHA 1E84A 1YYJA 3OE9A 1IW9A 4AMJA 3VG9A 1X0I1 1UCQA 3NMKA 1FBKA 1H68A 1S53A 4X31A 4CDAA 3QJRB 4QRYA 4FAAB 1APCA 3HAPA 4XT1A 5ITCA 3HASA 1KG8A 2J8WA 3UZCA 2YKZA 4WW3A 4JQ6A 1KGBA 3QJUB 4HWLA 4DS7E 5B6WA 3P0GA 1R84A 3QJTB 2RH1A 5EN0A 3OE8A 1AT9A 3QAKA 2WJKA 4UHRA 4BV0A 2I21A 2QPDB 5H2KA 5B6XA 3VGAA 4NC3A 5H2NA 5H2LA 1MGYA 2XM4A 2Y04A 2EI4A 3VI0A 1XIOA 3NSBA 3UG9A 5JVEA 2WJLA 4WAVA 1QPUA 5BR5A 3HNKA 5H2IA 3HAQA 1L9HA 5H2JA 2VT4A 3QBIA 4XTOA 1M0MA 5G28A 2YLDA 4D4NA 4N4YB 3CODA 4EA3A 2CCYA 4U9DA 5TGZA 1A7VA 4L6RA 4X1HA 4JEBA 2AT9A 4LDOA 3HARA 5JRAA 1YYXA 4XTLA 5A8EA 1Q5JA 3QBLA 1L0MA 2XL8A 1MQVA 4PXFA 3QDCA 4BWBA 3X3BA 1C8SA 1S52A 2J4YA 3HNJA 4ULVA 3EH3B 1QHJA 3OAXA 3PWHA 5AWZA 5G54A 2J9BA 5JS5A 1CGNA 1P8IA 1S8JA 4K5YA 5BR2A 5B6VA 3OE0A 3L1MA 5AZDA 1X0K1 3HNIA 2YDVA 1F50A 5G36A 5AGFA 1E0PA 1O0AA 4AMIA 3HAOA 3UONA 4CJGA 2Y02A 3NMIA 3FOOA 1S8LA 1RCPA 4G71B 2Y03A 1PXSA 5G2DA 3QJSB 5ETZA 4IAQA 3QAPA 2BC5A 1P8HA 4LDEA 4TL3A 4ER9A 5JLIA 5G2AA 1LN6A 3UTWA 2YCZA 1JAFA 5DHHA 2BRDA 3T45A 3ZTMA 3VW7A 1JFPA 3A7KA 3VVKA 1CGOA 2YCYA 4HYXA 1CWQA 2R4SA 3C63A 2YL0A 2YCWA 5B35A 2XLVA 4QI1A 4IARA 5JJJA 2YL7A 1EHKB 4MQSA 5H2OA 2LNLA 5J7AA 2QLAA 3TOLA 3S8GB 2KSYA 4MQTA 2JAFA 4BVNA 1QKPA 3C62A 3EH5B 4GRVA 2Z73A 1XJIA 3DE9A 3QJVB 2ZFEA 1U19A 3IQ6A 2YL3A 3M79A 1EKYA 1BRXA 4DAJA 3REYA 1GQAA 2HPYA 3ABWA 1GUEA 2G87A 3RFMA 5DHGA 3QVYA 3IQ5A 3NS0A 1TN5A 1M0KA 3AYNA 2JAGA 2R4RA 3WQJA 5JT4A 5LWEA 256BA 4G7SB 4CDVA 1JV6A 2Z55A 2YCXA 3S3BB 3D4SA 3UTYA 2M3GA 5JUAA 3ZPQA 5AX0A 1BRDA 4EIYA 3EMLA 1IW6A 4KLYA 4EJ4A 4XXJA 3ODUA 3M4CA 4A4MA 2QPEB 4G72B 1E85A 1TN0A 3NMJA 1JGJA 2NTWA 3PQRA 1S51A 5G53A 1QKOA 3HNLA 1XMEB 2XM0A 5B6ZA 1E83A 1BM1A 3ZTZA 1HZXA 1KG9A 4KNFA 3X3CA 4FA7B 3UZAA 5JP7A 3VHZA 2I20A 4DJHA 1LM3B 2XLMA 1S05A 4L35A 5B0WA 4QIDA 1S54A 1BBHA 2I35A 4GYCA 2X72A 4XTNA 3QJQB 5B2NA 3QBGA 3PDSA 2KSAA 1QQ3A 1PXRA 4N4WA 3ZPRA 4MD2A 4G7QB 1P8UA 4JKVA 1VJMA 3QW0A 4FPDA 4GP4B 3UTXA 1BRRA 5FJGA 2F95A 1M6TA 4N6HA 1C8RA 4D4XA 4BUOA 2NTUA 1X0SA 1JV7A 5B6YA 4HYJA 2L6XA 2XLOA 5B3IA 4Y9HA 3V2YA 3QW1A 4GP8B 4BEYA 5H2MA 2YLIA 2Y00A 2ZIYA 3QBKA 3ZEVA 1F4ZA 3OE6A 3PBLA 2YLGA 1E12A 1FBBA 2XLWA 4WGYA 1IXFA 5ITEA 3C9LA 2XL6A 4J4QA 1C3WA 3V2WA 3NY9A 4CIPA 4IB4A 4CX9A 1CPQA 3ZQVA 3DDLA 1UAZA 2PEDA 5A44A 1M0LA 4PXKA 2Y01A 3DQBA 2I1XA 3DE8A 3MBVA 1H2SA 5JSLA 1KMEA 3NY8A 3RZEA 3AM6A 2XLEA 5JJEA 3NYAA 3M15A 3VRCA 3S3DB 3CAPA 4FBZA 3C9MA 1E86A 1R2NA 4CDYA 5G2CA 4JE9A 5JJNA 1NBBA 3ZWIA 4JR8A 5DYSA 3EH4B 4MBSA 3PXOA 1CPRA 5F8UA 4JEAA 1PY6A 4MD1A 1QM8A 1GU8A 2XLDA 3M4BA 2XLHA 2YDOA 3HANA 1DZEA 4UG2A 4GPOA 3QVZA 1GZMA 4BEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJ6 A;  1AP9 A;  1F88 A;  4GP5 B;  5H2H A;  3ZQY A;  4X32 A;  5C1M A;  4CJO A;  2KS9 A;  2KSB A;  2F93 A;  4G7R B;  4U9E A;  5B34 A;  3U8P A;  4XT3 A;  4WGZ A;  4GBR A;  4LDL A;  3AYM A;  4G70 B;  3FOP A;  3TOM A;  1Q5I A;  3BVD B;  1VGO A;  3S8F B;  2YL1 A;  3UTV A;  4DKL A;  4OV0 A;  2ZZL A;  5AX1 A;  5H2P A;  1YZA A;  5AHZ A;  3SN6 R;  3S3C B;  5AHY A;  5A45 A;  1YZC A;  3COC A;  5KKH A;  1E84 A;  1YYJ A;  3OE9 A;  1IW9 A;  4AMJ A;  3VG9 A;  1X0I 1;  1UCQ A;  3NMK A;  1FBK A;  1H68 A;  1S53 A;  4X31 A;  4CDA A;  3QJR B;  4QRY A;  4FAA B;  1APC A;  3HAP A;  4XT1 A;  5ITC A;  3HAS A;  1KG8 A;  2J8W A;  3UZC A;  2YKZ A;  4WW3 A;  4JQ6 A;  1KGB A;  3QJU B;  4HWL A;  5B6W A;  3P0G A;  1R84 A;  3QJT B;  2RH1 A;  5EN0 A;  3OE8 A;  1AT9 A;  3QAK A;  2WJK A;  4UHR A;  4BV0 A;  2I21 A;  2QPD B;  5H2K A;  5B6X A;  3VGA A;  4NC3 A;  5H2N A;  5H2L A;  1MGY A;  2XM4 A;  2Y04 A;  2EI4 A;  3VI0 A;  1XIO A;  3NSB A;  3UG9 A;  5JVE A;  2WJL A;  4WAV A;  1QPU A;  5BR5 A;  3HNK A;  5H2I A;  3HAQ A;  1L9H A;  5H2J A;  2VT4 A;  3QBI A;  4XTO A;  1M0M A;  5G28 A;  2YLD A;  4D4N A;  4N4Y B;  3COD A;  4EA3 A;  2CCY A;  4U9D A;  5TGZ A;  1A7V A;  4L6R A;  4X1H A;  4JEB A;  2AT9 A;  4LDO A;  3HAR A;  5JRA A;  1YYX A;  4XTL A;  5A8E A;  1Q5J A;  3QBL A;  1L0M A;  2XL8 A;  1MQV A;  4PXF A;  3QDC A;  4BWB A;  3X3B A;  1C8S A;  1S52 A;  2J4Y A;  3HNJ A;  4ULV A;  3EH3 B;  1QHJ A;  3OAX A;  3PWH A;  5AWZ A;  5G54 A;  2J9B A;  5JS5 A;  1CGN A;  1P8I A;  1S8J A;  4K5Y A;  5BR2 A;  5B6V A;  3OE0 A;  3L1M A;  5AZD A;  1X0K 1;  3HNI A;  2YDV A;  1F50 A;  5G36 A;  5AGF A;  1E0P A;  1O0A A;  4AMI A;  3HAO A;  3UON A;  4CJG A;  2Y02 A;  3NMI A;  3FOO A;  1S8L A;  1RCP A;  4G71 B;  2Y03 A;  1PXS A;  5G2D A;  3QJS B;  5ETZ A;  4IAQ A;  3QAP A;  2BC5 A;  1P8H A;  4LDE A;  4TL3 A;  4ER9 A;  5JLI A;  5G2A A;  1LN6 A;  3UTW A;  2YCZ A;  1JAF A;  5DHH A;  2BRD A;  3T45 A;  3ZTM A;  3VW7 A;  1JFP A;  3A7K A;  3VVK A;  1CGO A;  2YCY A;  4HYX A;  1CWQ A;  2R4S A;  3C63 A;  2YL0 A;  2YCW A;  5B35 A;  2XLV A;  4QI1 A;  4IAR A;  5JJJ A;  2YL7 A;  1EHK B;  4MQS A;  5H2O A;  2LNL A;  5J7A A;  2QLA A;  3TOL A;  3S8G B;  2KSY A;  4MQT A;  2JAF A;  4BVN A;  1QKP A;  3C62 A;  3EH5 B;  4GRV A;  2Z73 A;  1XJI A;  3DE9 A;  3QJV B;  2ZFE A;  1U19 A;  3IQ6 A;  2YL3 A;  3M79 A;  1EKY A;  1BRX A;  4DAJ A;  3REY A;  1GQA A;  2HPY A;  3ABW A;  1GUE A;  2G87 A;  3RFM A;  5DHG A;  3QVY A;  3IQ5 A;  3NS0 A;  1TN5 A;  1M0K A;  3AYN A;  2JAG A;  2R4R A;  3WQJ A;  5JT4 A;  5LWE A;  256B A;  4G7S B;  4CDV A;  1JV6 A;  2Z55 A;  2YCX A;  3S3B B;  3D4S A;  3UTY A;  2M3G A;  5JUA A;  3ZPQ A;  5AX0 A;  1BRD A;  4EIY A;  3EML A;  1IW6 A;  4KLY A;  4EJ4 A;  4XXJ A;  3ODU A;  3M4C A;  4A4M A;  2QPE B;  4G72 B;  1E85 A;  1TN0 A;  3NMJ A;  1JGJ A;  2NTW A;  3PQR A;  1S51 A;  5G53 A;  1QKO A;  3HNL A;  1XME B;  2XM0 A;  5B6Z A;  1E83 A;  1BM1 A;  3ZTZ A;  1HZX A;  1KG9 A;  4KNF A;  3X3C A;  4FA7 B;  3UZA A;  5JP7 A;  3VHZ A;  2I20 A;  4DJH A;  1LM3 B;  2XLM A;  1S05 A;  4L35 A;  5B0W A;  4QID A;  1S54 A;  1BBH A;  2I35 A;  4GYC A;  2X72 A;  4XTN A;  3QJQ B;  5B2N A;  3QBG A;  3PDS A;  2KSA A;  1QQ3 A;  1PXR A;  4N4W A;  3ZPR A;  4MD2 A;  4G7Q B;  1P8U A;  4JKV A;  1VJM A;  3QW0 A;  4FPD A;  4GP4 B;  3UTX A;  1BRR A;  5FJG A;  2F95 A;  1M6T A;  4N6H A;  1C8R A;  4D4X A;  4BUO A;  2NTU A;  1X0S A;  1JV7 A;  5B6Y A;  4HYJ A;  2L6X A;  2XLO A;  5B3I A;  4Y9H A;  3V2Y A;  3QW1 A;  4GP8 B;  4BEY A;  5H2M A;  2YLI A;  2Y00 A;  2ZIY A;  3QBK A;  3ZEV A;  1F4Z A;  3OE6 A;  3PBL A;  2YLG A;  1E12 A;  1FBB A;  2XLW A;  4WGY A;  1IXF A;  5ITE A;  3C9L A;  2XL6 A;  4J4Q A;  1C3W A;  3V2W A;  3NY9 A;  4CIP A;  4IB4 A;  4CX9 A;  1CPQ A;  3ZQV A;  3DDL A;  1UAZ A;  2PED A;  5A44 A;  1M0L A;  4PXK A;  2Y01 A;  3DQB A;  2I1X A;  3DE8 A;  3MBV A;  1H2S A;  5JSL A;  1KME A;  3NY8 A;  3RZE A;  3AM6 A;  2XLE A;  5JJE A;  3NYA A;  3M15 A;  3VRC A;  3S3D B;  3CAP A;  4FBZ A;  3C9M A;  1E86 A;  1R2N A;  4CDY A;  5G2C A;  4JE9 A;  5JJN A;  1NBB A;  3ZWI A;  4JR8 A;  5DYS A;  3EH4 B;  4MBS A;  3PXO A;  1CPR A;  5F8U A;  4JEA A;  1PY6 A;  4MD1 A;  1QM8 A;  1GU8 A;  2XLD A;  3M4B A;  2XLH A;  2YDO A;  3HAN A;  1DZE A;  4UG2 A;  4GPO A;  3QVZ A;  1GZM A;  4BEZ A; 
#chains in the Genus database with same CATH topology
 1AP9 A;  1F88 A;  3KH2 A;  1YA7 O;  4NTA A;  4X32 A;  1LI5 A;  1ZW2 A;  4G7R B;  5B34 A;  4GBR A;  3AYM A;  4G70 B;  3TOM A;  1HMO A;  4N06 A;  2EIJ C;  2CW0 F;  2YL1 A;  1OCZ C;  4DRJ B;  3DD7 A;  3I5P A;  3S3C B;  2HMZ A;  2ICW G;  4ZLD A;  4YWQ A;  4CS7 A;  1MNE A;  1VB5 A;  2CNW D;  1H9T A;  3EHN A;  1FBK A;  4OIP F;  4P6I C;  4X31 A;  1AVO B;  4CDA A;  1ST6 A;  3UZC A;  2XSE A;  5B6W A;  4HWL A;  4DS7 E;  2KGO A;  2OU6 A;  2RH1 A;  4I1O B;  3ASN C;  1VLT A;  4EBK A;  2KQ9 A;  2WJK A;  4JIO A;  4JCZ A;  2W4M A;  1LKX A;  3SP1 A;  5H2K A;  5B6X A;  4JCH A;  1XIO A;  1D0Y A;  3JYY A;  3SXM A;  3HNK A;  4I3M A;  3HAQ A;  1K05 A;  4XEF A;  5H2J A;  2EPM X;  4XTO A;  1HW1 A;  4JTD B;  2YWA A;  4EA3 A;  3HLZ A;  4EHP A;  4XPY A;  2UUH A;  3K66 A;  2IM8 A;  2PNO A;  3DI5 A;  3S0X A;  3K7D A;  4XTL A;  1L0M A;  3ZIB A;  3QDC A;  4NTB A;  4PFP A;  1IW7 F;  3FXH A;  1S52 A;  2D4U A;  4ULV A;  4MTG A;  3PCV A;  5G54 A;  1S8J A;  4K5Y A;  5BR2 A;  3OE0 A;  1SZI A;  2RSE B;  1J8Y F;  3S28 A;  3EGX B;  3Q7L A;  1JPN A;  3JTL O;  2R7V A;  4A4A A;  1E0P A;  2Y39 A;  4O7G A;  3U3B A;  4CJG A;  3PMR A;  2Y02 A;  2IXM A;  1ZHT A;  2J45 A;  3FOO A;  1RCP A;  1PV3 A;  4LDR A;  2Y03 A;  1MMA A;  5COF A;  3FHD A;  2M4E A;  5D91 A;  2P7V A;  1P8H A;  3W2W A;  2R7O A;  3KKB A;  1LN6 A;  2Q4F A;  1XWJ A;  1OCR C;  5DHH A;  3IQT A;  1JFP A;  1OXB A;  4HYX A;  5FCL A;  3C63 A;  3TK0 A;  3OA1 A;  2P1A A;  3G4X A;  3AG3 C;  1B68 A;  4QI1 A;  5JJJ A;  4JRZ A;  3MYI A;  2QLA A;  2QTV A;  4MQT A;  1SMY F;  4IAO A;  4BVN A;  4HFK B;  2YZS A;  3C62 A;  4XEK A;  2DB4 A;  3EZH A;  1XZP A;  4E18 A;  3QJV B;  1EA8 A;  3GOR A;  1A7E A;  2YL3 A;  3M79 A;  1BRX A;  3K33 A;  3ABW A;  4NTF A;  2L81 A;  1ZHW A;  3QVY A;  1S7Z A;  1G4U S;  2KC3 A;  2HMQ A;  2Q7R A;  3WHN A;  4AL0 A;  1M0K A;  3AYN A;  2R4R A;  2HZ8 A;  5FZT A;  5LWE A;  2LD6 A;  4DBR A;  4CDV A;  4M63 A;  2YEV A;  5DQZ A;  1NG1 A;  3UTY A;  1LE4 A;  3ZPQ A;  2IYL D;  2VH3 A;  4XXJ A;  5EHH A;  3M4C A;  3S27 A;  4A4M A;  5L0J A;  3V5Z A;  1E85 A;  1TN0 A;  2DGJ A;  4JTC B;  1T01 A;  2NTW A;  4MVU A;  1QKO A;  1XME B;  1BM1 A;  4KNW A;  3LLI A;  3UZA A;  1T6U A;  4DJH A;  4KC9 A;  3EH2 A;  1LM3 B;  1YVI A;  4XWJ A;  5B0W A;  1Q0F A;  2V3C C;  1OKK A;  4QID A;  3I5Q A;  3AQB A;  4DOZ A;  3GEH A;  4O6Y A;  3DM9 B;  3R2P A;  3FMS A;  1QQ3 A;  3ZPR A;  3AQC A;  3QZC A;  1C03 A;  4JKV A;  2WZF A;  1OCO C;  3EQL F;  2ZXW C;  5EK0 A;  1C17 M;  1NFO A;  2XS8 A;  1VYI A;  4IGG A;  2J7P D;  2NG1 A;  3QTH A;  5B6Y A;  2L6X A;  1Z6A A;  2Y69 C;  4Y9H A;  1QLE C;  2H8A A;  3F46 A;  2YQY A;  2WVO A;  1D0X A;  3QBK A;  4LDK A;  3LNM B;  2IXN A;  3OE6 A;  3HTK C;  1YLM A;  3ITF A;  2FAP B;  1YDI A;  1E12 A;  2XL6 A;  2NUP A;  2VC9 A;  4J4Q A;  3NYM A;  1FAP B;  2P6V A;  3S84 A;  1G8X A;  2AVK A;  4H4K C;  4CIP A;  4CX9 A;  3SYN A;  3ZQV A;  2AP3 A;  4FAP B;  2MWQ A;  4BJ1 A;  3DQB A;  4KI2 A;  3MBV A;  3NY8 A;  1HMD A;  3AM6 A;  2XLE A;  4CBE A;  3NYA A;  3VRC A;  4FBZ A;  1E86 A;  5G2C A;  4JE9 A;  1NBB A;  3ZWI A;  5DYS A;  1Z63 A;  3PXO A;  4MW3 A;  5F8U A;  3X1O A;  1MMN A;  2LQG A;  5E33 A;  4MD1 A;  1JOG A;  1WAT A;  5D92 A;  1GU8 A;  4YN0 B;  1WAS A;  3HAN A;  4GPO A;  1NSG B;  3KJ6 A;  4ANJ A;  5KYW A;  4RDA A;  2UUI A;  2R7Q A;  5L3V A;  3HJC A;  2KSB A;  2ZD9 A;  4U9E A;  4DBQ A;  4WGZ A;  4LDL A;  2XL4 A;  3EPV A;  3FOP A;  3S9O A;  4DKL A;  2NSF A;  2R7X A;  1Z23 A;  5AX1 A;  1Z3I X;  1YZA A;  5AHZ A;  1W2W A;  1YZC A;  3COC A;  3H65 A;  5KKH A;  4MW8 A;  3WAQ A;  3R7C A;  1X0I 1;  3ABL C;  1H68 A;  5BUO A;  2W45 A;  2KW3 C;  3QJR B;  2HJ3 A;  1APC A;  3UNG C;  1Z5Z A;  3HAS A;  1Y6D A;  1KGB A;  3QJU B;  3P0G A;  3QJT B;  4MVO A;  2Q3T A;  1TWH A;  3OE8 A;  1IZM A;  1AT9 A;  1O87 A;  3UGO A;  2Y3D A;  1OR2 A;  4XLN F;  4K1O A;  5F5H A;  3VGA A;  5DVW A;  5H2L A;  3W8H A;  1MGY A;  2ZXO A;  3NSB A;  1ORS C;  1LI7 A;  4LAC B;  3RKO F;  3DJN B;  5JVE A;  2XRH A;  5AC5 A;  1GS9 A;  5T3W A;  1H7I A;  1M0M A;  1KTM A;  4N4Y B;  4EWC A;  1LS4 A;  4IRU A;  3COD A;  5TGZ A;  3A11 A;  1A7V A;  4OD5 A;  5B3S C;  2CDQ A;  2AT9 A;  4YL3 A;  4LDO A;  3ZDL A;  3V7O A;  1QZX A;  3L34 A;  5A8E A;  2P61 A;  1EQ1 A;  3CZ6 A;  4CS8 A;  4BWB A;  1L7C A;  4OD4 A;  3EH3 B;  3JRT A;  3K1H A;  1K04 A;  1QHJ A;  3OAX A;  5AWZ A;  3H2V A;  5JS5 A;  1CGN A;  3FAP B;  5B6V A;  3LS0 A;  3JSE O;  2GWW A;  3AGU A;  4O6M A;  2CGE A;  1X0K 1;  2J0W A;  3OEO A;  1ZU4 A;  5G36 A;  3HAO A;  4GEH A;  1G4W R;  1OW8 A;  1S8L A;  3QJS B;  2HSB A;  4MND A;  3TJ5 A;  3PDM P;  4TL3 A;  4A2N B;  1NU7 D;  5JLI A;  4G7Z F;  3UTW A;  2YCZ A;  1OW6 A;  2BRD A;  1VLS A;  3A7K A;  5K0I A;  1VK5 A;  1CWQ A;  1I4Z A;  3CSK A;  3T9O A;  3CAX A;  2YCW A;  2E87 A;  5B35 A;  1ZYR F;  2A6E F;  3O6X A;  4IAR A;  1QKR A;  5L3Q A;  2OCC C;  3U2M A;  3EH5 B;  2X51 A;  4GRV A;  4RBN A;  2LCH A;  1D0Z A;  5L0F A;  5AC4 A;  1XJI A;  1BR4 A;  3DE9 A;  2EIL C;  3RQF A;  3Q6M A;  3IQ6 A;  4DAJ A;  3REY A;  1GQA A;  1D1A A;  2HPY A;  2NUP B;  2QNL A;  3V5Y A;  1GUE A;  2G87 A;  3C18 A;  2W4B A;  1NFN A;  1OKK D;  3NS0 A;  1O5H A;  5CIV A;  2VCA A;  3NKE A;  3U8V A;  3EGD A;  4AL1 A;  3NYL A;  5BQG A;  4G7S B;  1LVK A;  2R02 A;  1MMD A;  2M64 A;  3V5X A;  4JJF A;  3LES A;  2A69 F;  5JUA A;  5AX0 A;  3TQO A;  1BRD A;  1VOM A;  2L9J A;  4EJ4 A;  2B0J A;  4Q7C A;  3ATP A;  5EGY A;  2HFI A;  3PQR A;  3HNL A;  2XXA A;  3DM5 A;  4BJ6 A;  2XM0 A;  2QE9 A;  1G5Z A;  1E83 A;  1KG9 A;  4KNF A;  5KYW B;  5JP7 A;  3VHZ A;  4BJ6 C;  4U5C E;  2I20 A;  2IXP A;  3TD7 A;  2ETS A;  3SZR A;  2TMV P;  3MLG A;  4BEJ A;  2RD9 A;  4PJJ A;  2OKU A;  4MTF A;  1FFT C;  4JZA A;  1U89 A;  4YJW A;  4U5H A;  3RH3 A;  4GYC A;  5B2N A;  4PJM A;  3QBG A;  3JYH A;  2KSA A;  1YAU O;  4U5E E;  3GEI A;  2MYS A;  1NLX A;  2C03 A;  2R05 A;  4G7H F;  1ORY A;  1TR2 A;  2PP4 A;  3GEE A;  1WWP A;  1M6T A;  4N6H A;  2H7O A;  3DAG A;  4GYT A;  5CI8 A;  1V54 C;  2EPO A;  2NTU A;  1X0S A;  5TJ5 E;  4DJ9 A;  1ZU5 A;  5B3I A;  2AU5 A;  4GP8 B;  3JRM O;  3VYW A;  4BEY A;  5DLJ A;  1ZVZ A;  1JMW A;  2ZIY A;  1YAR O;  3F47 A;  1R5I D;  2ZXP A;  3C8G A;  1GGQ A;  2HJM A;  2JX0 A;  2B0H A;  1JR8 A;  3U5S A;  3NYJ A;  3C8Z A;  1FBB A;  3X2Q C;  4Q4Z F;  2VCB A;  1C02 A;  1UFB A;  3V2W A;  2WVN A;  5COG A;  3LEO A;  3NY9 A;  2KSF A;  3RQG A;  2OEX A;  2Z15 A;  3RFY A;  4BPM A;  3DDL A;  3SXK A;  3MYF A;  5A44 A;  4XEV A;  1OW7 A;  2Y01 A;  2J46 A;  2I1X A;  1ZHX A;  4Z9I A;  1H2S A;  5JSL A;  5JJE A;  2KJG A;  4XQ1 A;  4QI0 A;  2L6F A;  3S3D B;  4KNV A;  3CAP A;  1V74 B;  4JTA B;  4JR8 A;  3I4U A;  1FR0 A;  4QDL A;  4QI2 A;  4JEA A;  3U9J A;  2Q9A A;  4JUR I;  4X0R A;  1RKE A;  3LUT B;  1VMA A;  4KBL A;  2PBE A;  4CSA C;  2YDO A;  3OWT A;  3G50 A;  4DVY P;  1DZE A;  2WL8 A;  3AJM A;  3QVZ A;  4CS9 C;  2AWY A;  2LSE A;  3O10 A;  3O39 A;  2R7U A;  5H2H A;  3IQC A;  3ZQY A;  1M57 C;  3POV A;  2KS9 A;  2F93 A;  4XT3 A;  4K0D A;  4BEM J;  1RXQ A;  4MVR A;  1Q5I A;  2R03 A;  4MVQ A;  1ORJ A;  1VGO A;  3FDQ A;  4LLC A;  3UTV A;  3T6G B;  4OV0 A;  3G4Z A;  2ZZL A;  3SN6 R;  5KYY B;  4I44 A;  5AHY A;  4PFO A;  5A45 A;  2EPL X;  1U6H A;  1A41 A;  1YYJ A;  3OE9 A;  3VG9 A;  4AK9 A;  3TUL A;  3NMK A;  1WOL A;  3GM2 A;  1S53 A;  5T1D B;  2A68 F;  2DI3 A;  4FAA B;  1TWG A;  3HAP A;  4XT1 A;  4WAB A;  2J8W A;  4NQF A;  4WW3 A;  1N1C A;  1HW2 A;  4IWB A;  4PAC A;  4ULW A;  3LEV A;  2GA0 A;  4AX2 A;  3LNR A;  2OG2 A;  4K7B A;  2H7V C;  4UHR A;  2L6G A;  1BZ4 A;  3ZC4 A;  4BV0 A;  2I21 A;  1LPE A;  3ABM C;  2NPU A;  3GOD A;  1M2O A;  2Y04 A;  2EI4 A;  4XTK A;  3UG9 A;  1A7D A;  1ZHZ A;  4YL0 A;  4WAV A;  1Y4C A;  5BR5 A;  3B9Q A;  1VTM P;  5BQH A;  1NZE A;  2VT4 A;  2CCY A;  4U9D A;  1YJG A;  4Z9J A;  4OIQ F;  3KYI A;  4L6R A;  4XPW A;  4X1H A;  3Q6N A;  3KPH A;  4BEZ A;  1PCX A;  2GFH A;  3EGD B;  1I5N A;  1YYX A;  5F28 E;  4N6C A;  3UGP A;  1TFO B;  4PXF A;  2G62 A;  3JT1 A;  1C8S A;  2OJQ A;  1CGM E;  1T6Q A;  2EPN A;  3PWH A;  2J9B A;  1P8I A;  3JCU Q;  1MND A;  1QVX A;  3DZA A;  5A6B A;  2XXA B;  1A0B A;  5COM A;  4PK4 A;  1F50 A;  3U9M A;  4J7T A;  4YK5 A;  4AMI A;  3EZI A;  2IBF A;  3L8I A;  2I8B A;  2LFF A;  2Y3B A;  4P9T A;  2A0U A;  2WVQ A;  3HKK A;  1PXS A;  5ETZ A;  5GPG B;  4ONS A;  2BC5 A;  4YT8 A;  4ER9 A;  5G2A A;  2I15 A;  4BG0 A;  3ECS A;  1JAF A;  3ZTM A;  3US6 A;  1D1C A;  1FMV A;  4FWV A;  3IPM O;  2R4S A;  2VAS A;  3K1I C;  3T6B A;  1TQG A;  2HS5 A;  1SF8 A;  2WB7 A;  3RVY A;  3AGT A;  1TWA A;  2JD3 A;  5L0C A;  1EHK B;  4MQS A;  3H2U A;  3EJN A;  5H2O A;  2LNL A;  5J7A A;  3TOL A;  3UMH A;  1FFH A;  3J06 A;  4C7O A;  1QKP A;  5HSW A;  3RIP A;  1V4A A;  3TJ6 A;  2ZFE A;  3C8G B;  1U19 A;  3NG1 A;  1J8M F;  1EKY A;  4W8P A;  4OIO F;  1FNT c;  1LS1 A;  1HE1 A;  3MBG A;  1TN5 A;  3KL4 A;  3QMK A;  2JAG A;  2A1D D;  1SYQ A;  4U5F E;  3U2L A;  5JT4 A;  1LE2 A;  1DOW A;  2BE5 F;  2Z55 A;  3D4S A;  1RJ9 A;  1OXK A;  3DMD A;  3SXY A;  3W4Y A;  2M3G A;  2Q9B A;  4E7Z A;  1RKC A;  3LJB A;  1UG7 A;  4EIY A;  1E2X A;  3EML A;  4YL1 A;  1IW6 A;  4KLY A;  3ODU A;  1OR3 A;  5L0H A;  2KYH A;  2QPE B;  1AEP A;  5T3T A;  1RKE B;  3NMJ A;  1S51 A;  5L0I A;  2HV6 A;  3ASO C;  4E0H A;  4EUK B;  4BJ5 C;  3C8G D;  3X3C A;  2BL2 A;  2OQM A;  5KYX A;  3T6J A;  2LP4 A;  1MMG A;  1D1B A;  2XLM A;  4E17 A;  3AG4 C;  2VB6 A;  3T4R A;  1S54 A;  3GM1 A;  5DS6 A;  4C3B A;  3CEX A;  5KYY A;  2Q00 A;  2X72 A;  4XTN A;  1FTS A;  3EFO A;  3ZVR A;  4N4W A;  2EPK X;  1P8U A;  2ZXR A;  2DYR C;  3CQZ A;  5KYU A;  4FPD A;  4GP4 B;  3AG1 C;  2F95 A;  3DKA A;  1C8R A;  4JVS A;  4HYJ A;  2XLO A;  3EG9 A;  3GWL A;  4G0H A;  5H2M A;  2LK4 A;  4Q5S F;  1F4Z A;  5E3C A;  3PBL A;  4E0I A;  4MS2 A;  2XLW A;  4BJT A;  1TFK B;  3EHM A;  1C3W A;  3BEH A;  4NY3 A;  4DXW A;  3JSZ A;  1M2V A;  1H9G A;  2Q9C A;  1CPQ A;  3VM6 A;  4LLE A;  1UAZ A;  2PED A;  1M0L A;  1K40 A;  3RW0 A;  3N0T A;  3DE8 A;  4JC7 A;  3NRH A;  3EH1 A;  2F22 A;  3C9M A;  5JJN A;  3LLK A;  4AE4 A;  4C3D A;  1F1M A;  3EH4 B;  3RF3 A;  4MBS A;  3JZ0 A;  2A0B A;  4LER A;  2WZG A;  1SR2 A;  5BQI A;  1PD0 A;  2CYD A;  3VAY A;  5A6J A;  4H54 A;  4DRH B;  3AG2 C;  2XLD A;  2XLH A;  5CI9 A;  2FFH A;  3DWW A;  4F4B A;  3BRJ A;  4Z9H A;  4GP5 B;  3KMI A;  5C1M A;  2OOC A;  4CJO A;  1AUE A;  4XPX A;  3U8P A;  3E70 C;  2QY9 A;  2HSQ A;  3BVD B;  2D5R B;  3S8F B;  1WGW A;  3IEE A;  3B0P A;  3S29 A;  5H2P A;  2C04 A;  4UDV A;  2G3K A;  3IHU A;  3FAJ A;  4NCQ A;  2L6H A;  2IXO A;  3SEO A;  1E84 A;  1IW9 A;  3WG7 C;  4AMJ A;  2PX0 A;  1UCQ A;  1OQC A;  4HFF B;  4QRY A;  2W9Y A;  5ITC A;  1KG8 A;  2YKZ A;  4JQ6 A;  5A6A A;  1T6I A;  2LIG A;  1R84 A;  4C7O B;  3NKD A;  2A6H F;  5EN0 A;  1PD1 A;  3QAK A;  4EBJ A;  5A6B D;  5B1A C;  2QPD B;  1H6G A;  1BDJ B;  4NC3 A;  5H2N A;  2XM4 A;  3VI0 A;  2JPU A;  4J32 B;  2NUT A;  2O9X A;  3NDB B;  1DOV A;  2WJL A;  1QPU A;  2H7B A;  4XLP F;  5H2I A;  1L9H A;  3QBI A;  4IJJ A;  5G28 A;  1ZZP A;  3SXZ A;  2YLD A;  4D4N A;  1O3U A;  4YT4 A;  3L0I A;  4P9F A;  4DVZ A;  2J9U A;  4JEB A;  3U0C A;  3C7J A;  4E7S A;  3HAR A;  1TWC A;  5JRA A;  3FVY A;  2CNW A;  4B6I A;  1Q5J A;  3QBL A;  1RJ9 B;  3LS1 A;  2XL8 A;  1MQV A;  2J9V A;  1I4Y A;  4J7Y A;  3X3B A;  2J4Y A;  4CSA A;  3KYJ A;  2Y3H A;  3L8J A;  3HNJ A;  3RYL A;  4OIR F;  4CS9 A;  4G7O F;  3W8I A;  2WZL A;  2ASR A;  3UMK A;  4C3E A;  1FMW A;  4J30 B;  3L1M A;  5AZD A;  3M1C B;  2NSG A;  3HNI A;  4U5B E;  2YDV A;  5B1B C;  5AGF A;  3VF0 A;  1O0A A;  1ZHY A;  2J9W A;  4DRI B;  3UON A;  5KYX B;  1KNY A;  3NMI A;  1LIH A;  4MTO A;  1KU2 A;  4HE8 D;  4G71 B;  5G2D A;  4IAQ A;  3QAP A;  1M56 C;  4W8K A;  5E3A A;  4LDE A;  3DAF A;  3W2V A;  2HUJ A;  3EFO B;  4O79 A;  3T45 A;  3VW7 A;  2R9R B;  3VVK A;  1CGO A;  2PX3 A;  2YCY A;  5F5F A;  2YL0 A;  5KYU B;  5E2Q A;  3N2Z B;  2XLV A;  2YL7 A;  1T9K A;  4ZLC A;  1Q0M A;  3S8G B;  2FGY A;  2KSY A;  3EG9 B;  2G3V A;  2JAF A;  3A9C A;  2R7T A;  3S90 A;  2Z73 A;  2ZPA A;  2X0C A;  2XS1 A;  3O55 A;  1QSP A;  3UMI A;  3U3F A;  2LFD A;  1HY5 A;  2GDC A;  3ZSU A;  4MVS A;  2KNH A;  4YT5 A;  3RFM A;  5DHG A;  3IQ5 A;  2P0N A;  1M2V B;  1T5O A;  3GWN A;  1Q0D A;  2DYS C;  3WQJ A;  4MVM A;  2YVK A;  1RMV A;  256B A;  1JV6 A;  2YCX A;  3S3B B;  3LAY A;  1JPJ A;  3ABK C;  2VCC A;  4AE4 B;  3RQE A;  4FX5 A;  5A6K A;  1OCC C;  4G72 B;  4U5D E;  1JGJ A;  3EGX A;  5G53 A;  3DXJ F;  5B6Z A;  3ZTZ A;  1HZX A;  4FES A;  4FA7 B;  4OIN F;  3MX3 A;  2PF4 E;  3K6B A;  2KK1 A;  1BR1 A;  1S05 A;  5L0D A;  4JJG A;  4L35 A;  1EI7 A;  3B0V C;  3WOD F;  1BBH A;  2I35 A;  2V26 A;  4WJ0 A;  3K1I A;  4GQH A;  3QJQ B;  2EIN C;  4LDQ A;  1NU9 C;  3PDS A;  1V55 C;  1PXR A;  3AOU A;  4EBB A;  4MD2 A;  2GAQ A;  4G7Q B;  2QUP A;  1VJM A;  3QW0 A;  2HKV A;  2OJE D;  3UTX A;  4PJN A;  1BRR A;  5FJG A;  1GM5 A;  3PHF 2;  1ZW3 A;  4D4X A;  2HV7 A;  4BUO A;  2EIM C;  3B71 A;  1JV7 A;  5DQT A;  2EIK C;  4YT2 A;  1Q0K A;  3V2Y A;  3QW1 A;  1VYK A;  1WTY A;  4PR9 A;  3UR3 C;  2YLI A;  2L7A A;  2Y00 A;  2YHS A;  3DJU B;  3ZEV A;  4RD9 A;  5DS4 A;  3MFN A;  1L3P A;  2YLG A;  2MHR A;  5L0G A;  4WGY A;  1IXF A;  5ITE A;  3C9L A;  4MVZ A;  1WN0 A;  2AWC A;  2NUT B;  4HEA J;  4U5G A;  2OEV A;  1Z7Q c;  2IOQ A;  2PFD A;  3E9V A;  4IB4 A;  2R7W A;  4I1M A;  2Y3G A;  5IY5 C;  4O6N A;  3Q7G A;  3GM3 A;  4JW1 A;  4PXK A;  1R4T A;  3B29 A;  2J0X A;  3GAN A;  1U0B B;  1KME A;  3RZE A;  2R25 A;  5DS5 A;  3M15 A;  1XZQ A;  4EKW A;  1R2N A;  1YA9 A;  4CDY A;  1TKN A;  4G78 A;  3N24 A;  5A69 A;  2R7S A;  2J7P A;  1CPR A;  3ZG1 A;  2R7R A;  1PY6 A;  1BR2 A;  3RVZ A;  5HV9 A;  1QM8 A;  3SNH A;  4BJ5 A;  1JRA A;  5KYN A;  4CS8 C;  3M4B A;  4PJL A;  2YRF A;  4UG2 A;  4CIH A;  4MQ9 F;  1GZM A;  3B0U X;  1HE9 A;  4R32 A;  1Q0G A; 
#chains in the Genus database with same CATH homology
 3KJ6 A;  1AP9 A;  1F88 A;  4GP5 B;  5H2H A;  3ZQY A;  4X32 A;  5C1M A;  4CJO A;  2KS9 A;  2KSB A;  2F93 A;  4G7R B;  4U9E A;  5B34 A;  3U8P A;  4XT3 A;  4WGZ A;  4GBR A;  4LDL A;  3AYM A;  4G70 B;  3FOP A;  3TOM A;  1Q5I A;  3BVD B;  1VGO A;  3S8F B;  2YL1 A;  3UTV A;  4DKL A;  4OV0 A;  2ZZL A;  5AX1 A;  5H2P A;  1YZA A;  5AHZ A;  3SN6 R;  3S3C B;  5AHY A;  5A45 A;  1YZC A;  3COC A;  5KKH A;  1E84 A;  1YYJ A;  3OE9 A;  1IW9 A;  4AMJ A;  3VG9 A;  1X0I 1;  1UCQ A;  3NMK A;  1FBK A;  1H68 A;  1S53 A;  4X31 A;  4CDA A;  3QJR B;  4QRY A;  4FAA B;  1APC A;  3HAP A;  4XT1 A;  5ITC A;  3HAS A;  1KG8 A;  2J8W A;  3UZC A;  2YKZ A;  4WW3 A;  4JQ6 A;  1KGB A;  3QJU B;  4HWL A;  4DS7 E;  5B6W A;  3P0G A;  1R84 A;  3QJT B;  2RH1 A;  5EN0 A;  3OE8 A;  1AT9 A;  3QAK A;  2WJK A;  4UHR A;  4BV0 A;  2I21 A;  2QPD B;  5H2K A;  5B6X A;  3VGA A;  4NC3 A;  5H2N A;  5H2L A;  1MGY A;  2XM4 A;  2Y04 A;  2EI4 A;  3VI0 A;  1XIO A;  3NSB A;  3UG9 A;  5JVE A;  2WJL A;  4WAV A;  1QPU A;  5BR5 A;  3HNK A;  5H2I A;  3HAQ A;  1L9H A;  5H2J A;  2VT4 A;  3QBI A;  4XTO A;  1M0M A;  5G28 A;  2YLD A;  4D4N A;  4N4Y B;  3COD A;  4EA3 A;  2CCY A;  4U9D A;  5TGZ A;  1A7V A;  4L6R A;  4X1H A;  4JEB A;  2AT9 A;  4LDO A;  3HAR A;  5JRA A;  1YYX A;  4XTL A;  5A8E A;  1Q5J A;  3QBL A;  1L0M A;  2XL8 A;  1MQV A;  4PXF A;  3QDC A;  4BWB A;  3X3B A;  1C8S A;  1S52 A;  2J4Y A;  3HNJ A;  4ULV A;  3EH3 B;  1QHJ A;  3OAX A;  3PWH A;  5AWZ A;  5G54 A;  2J9B A;  5JS5 A;  1CGN A;  1P8I A;  1S8J A;  4K5Y A;  5BR2 A;  5B6V A;  3OE0 A;  3L1M A;  5AZD A;  1X0K 1;  3HNI A;  2YDV A;  1F50 A;  5G36 A;  5AGF A;  1E0P A;  1O0A A;  4AMI A;  3HAO A;  3UON A;  4CJG A;  2Y02 A;  3NMI A;  3FOO A;  1S8L A;  1RCP A;  4G71 B;  2Y03 A;  1PXS A;  5G2D A;  3QJS B;  5ETZ A;  4IAQ A;  3QAP A;  2BC5 A;  1P8H A;  4LDE A;  4TL3 A;  4ER9 A;  5JLI A;  5G2A A;  1LN6 A;  3UTW A;  2YCZ A;  1JAF A;  5DHH A;  2BRD A;  3T45 A;  3ZTM A;  3VW7 A;  1JFP A;  3A7K A;  3VVK A;  1CGO A;  2YCY A;  4HYX A;  1CWQ A;  2R4S A;  3C63 A;  2YL0 A;  2YCW A;  5B35 A;  2XLV A;  4QI1 A;  4IAR A;  5JJJ A;  2YL7 A;  1EHK B;  4MQS A;  5H2O A;  2LNL A;  5J7A A;  2QLA A;  3TOL A;  3S8G B;  2KSY A;  4MQT A;  2JAF A;  4BVN A;  1QKP A;  3C62 A;  3EH5 B;  4GRV A;  2Z73 A;  1XJI A;  3DE9 A;  3QJV B;  2ZFE A;  1U19 A;  3IQ6 A;  2YL3 A;  3M79 A;  1EKY A;  1BRX A;  4DAJ A;  3REY A;  1GQA A;  2HPY A;  3ABW A;  1GUE A;  2G87 A;  3RFM A;  5DHG A;  3QVY A;  3IQ5 A;  3NS0 A;  1TN5 A;  1M0K A;  3AYN A;  2JAG A;  2R4R A;  3WQJ A;  5JT4 A;  5LWE A;  256B A;  4G7S B;  4CDV A;  1JV6 A;  2Z55 A;  2YCX A;  3S3B B;  3D4S A;  3UTY A;  2M3G A;  5JUA A;  3ZPQ A;  5AX0 A;  1BRD A;  4EIY A;  3EML A;  1IW6 A;  4KLY A;  4EJ4 A;  4XXJ A;  3ODU A;  3M4C A;  4A4M A;  2QPE B;  4G72 B;  1E85 A;  1TN0 A;  3NMJ A;  1JGJ A;  2NTW A;  3PQR A;  1S51 A;  5G53 A;  1QKO A;  3HNL A;  1XME B;  2XM0 A;  5B6Z A;  1E83 A;  1BM1 A;  3ZTZ A;  1HZX A;  1KG9 A;  4KNF A;  3X3C A;  4FA7 B;  3UZA A;  5JP7 A;  3VHZ A;  2I20 A;  4DJH A;  1LM3 B;  2XLM A;  1S05 A;  4L35 A;  5B0W A;  4QID A;  1S54 A;  1BBH A;  2I35 A;  4GYC A;  2X72 A;  4XTN A;  3QJQ B;  5B2N A;  3QBG A;  3PDS A;  2KSA A;  1QQ3 A;  1PXR A;  4N4W A;  3ZPR A;  4MD2 A;  4G7Q B;  1P8U A;  4JKV A;  1VJM A;  3QW0 A;  4FPD A;  4GP4 B;  3UTX A;  1BRR A;  5FJG A;  2F95 A;  1M6T A;  4N6H A;  1C8R A;  4D4X A;  4BUO A;  2NTU A;  1X0S A;  1JV7 A;  5B6Y A;  4HYJ A;  2L6X A;  2XLO A;  5B3I A;  4Y9H A;  3V2Y A;  3QW1 A;  4GP8 B;  4BEY A;  5H2M A;  2YLI A;  2Y00 A;  2ZIY A;  3QBK A;  3ZEV A;  1F4Z A;  3OE6 A;  3PBL A;  2YLG A;  1E12 A;  1FBB A;  2XLW A;  4WGY A;  1IXF A;  5ITE A;  3C9L A;  2XL6 A;  4J4Q A;  1C3W A;  3V2W A;  3NY9 A;  4CIP A;  4IB4 A;  4CX9 A;  1CPQ A;  3ZQV A;  3DDL A;  1UAZ A;  2PED A;  5A44 A;  1M0L A;  4PXK A;  2Y01 A;  3DQB A;  2I1X A;  3DE8 A;  3MBV A;  1H2S A;  5JSL A;  1KME A;  3NY8 A;  3RZE A;  3AM6 A;  2XLE A;  5JJE A;  3NYA A;  3M15 A;  3VRC A;  3S3D B;  3CAP A;  4FBZ A;  3C9M A;  1E86 A;  1R2N A;  4CDY A;  5G2C A;  4JE9 A;  5JJN A;  1NBB A;  3ZWI A;  4JR8 A;  5DYS A;  3EH4 B;  4MBS A;  3PXO A;  1CPR A;  5F8U A;  4JEA A;  1PY6 A;  4MD1 A;  1QM8 A;  1GU8 A;  2XLD A;  3M4B A;  2XLH A;  2YDO A;  3HAN A;  1DZE A;  4UG2 A;  4GPO A;  3QVZ A;  1GZM A;  4BEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...