4N6HA

1.8 a structure of the human delta opioid 7tm receptor (psi community target)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
408
structure length
408
Chain Sequence
DLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562, Delta-type opioid receptor chimeric
publication title Molecular control of delta-opioid receptor signalling.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 175
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2013-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n6hA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n6hA02
3NMJA 2YLIA 4GPOA 4BEYA 1MQVA 5B34A 3QDCA 3M79A 1VJMA 1L0MA 1S8LA 2G87A 5H2OA 5H2LA 1IW9A 2XLHA 4GYCA 1BM1A 1VGOA 3ODUA 1E85A 2J8WA 1UAZA 2Y00A 4G70B 1XIOA 4HYXA 2YCYA 5JS5A 4GP4B 3S3DB 4L35A 1O0AA 3UTWA 2KSAA 1GZMA 2YLDA 1KGBA 4FAAB 5G28A 4IARA 2KSYA 3UTVA 3AM6A 2Y03A 2XM4A 4J4QA 2XLOA 2XLWA 5B6VA 1BRRA 3DQBA 4XTLA 1E86A 1MGYA 4DAJA 1M6TA 3QJQB 1JFPA 4WGYA 4XT3A 3T45A 1E84A 4BV0A 1TN5A 1P8IA 5C1MA 5TGZA 3CODA 3VG9A 1JV6A 1CPQA 5AX1A 1QKOA 2I1XA 1H2SA 1C8SA 3NY8A 3ZTMA 3ZQYA 3S3BB 4JEBA 4WAVA 5B35A 3S8FB 4MBSA 3QBLA 1C8RA 2I35A 3ZTZA 1QPUA 3PXOA 1CGOA 4LDEA 1JV7A 5JRAA 1AT9A 5ITCA 3UONA 1YYJA 3QVYA 1X0I1 3QBKA 4G72B 1UCQA 5G2CA 3TOLA 1TN0A 5H2KA 3VVKA 3X3CA 1LN6A 3V2YA 3DE9A 5FJGA 3QJRB 2XLEA 1JAFA 5H2JA 256BA 4LDLA 5F8UA 1A7VA 2YCWA 1APCA 1FBBA 3NYAA 1JGJA 4HWLA 3NY9A 5JUAA 3L1MA 2L6XA 3EMLA 1Q5IA 1QM8A 3A7KA 2I21A 5G2DA 5H2HA 1E12A 3VW7A 2BRDA 2XLMA 3QAPA 1R84A 4FPDA 2Z73A 4TL3A 5AZDA 5G54A 2M3GA 4CDVA 4JEAA 2YL3A 1EKYA 1QQ3A 3ZEVA 4BWBA 3QJVB 1KMEA 5G53A 4EA3A 4KLYA 5JSLA 5B6XA 1S8JA 2YL7A 3DE8A 1LM3B 4MQSA 5JJNA 5BR5A 3WQJA 3EH4B 3U8PA 2QPDB 2PEDA 3OE9A 4G7RB 5KKHA 4ER9A 5AX0A 1S53A 3X3BA 2HPYA 4Y9HA 3EH5B 1E83A 4QIDA 3HAQA 4BUOA 4UG2A 2F95A 1BRXA 4XXJA 4IAQA 2F93A 4PXKA 1E0PA 1GUEA 5H2PA 1M0MA 5EN0A 4PXFA 2WJKA 4CIPA 1YZCA 3M4BA 2XL8A 4CDYA 2J4YA 3M15A 1RCPA 3HANA 5B2NA 2JAFA 4X1HA 2JAGA 4ULVA 4CJGA 2Y02A 4N4WA 3OAXA 3QBGA 5J7AA 1X0K1 2YDOA 1PY6A 4BEZA 3DDLA 3V2WA 2YDVA 1X0SA 4QI1A 3UZCA 3VI0A 1F88A 4G7SB 4X31A 3C9LA 2QLAA 2QPEB 4N6HA 4D4XA 3QVZA 5B6ZA 3ZPQA 3PBLA 1F50A 5B3IA 2AT9A 1S54A 2XLVA 3M4CA 4HYJA 5G2AA 4AMJA 4NC3A 5H2MA 3REYA 1YYXA 3AYNA 1CWQA 4U9DA 1PXRA 1YZAA 3UZAA 4WW3A 1P8HA 1U19A 4DKLA 4IB4A 2VT4A 3FOOA 3HNJA 2YLGA 5ITEA 3S3CB 1F4ZA 1AP9A 2Y04A 2YCZA 2I20A 4MQTA 4FA7B 1PXSA 1IW6A 1DZEA 1M0KA 3ABWA 3EH3B 3PDSA 4CX9A 3COCA 3PWHA 3UG9A 5AGFA 3QBIA 4MD1A 2NTWA 3NS0A 3HNIA 5B6WA 1KG8A 4MD2A 5DHGA 4CDAA 4EIYA 3HARA 3HASA 3VRCA 3SN6R 3AYMA 1CPRA 3QW0A 3MBVA 5H2NA 2R4RA 3QJSB 5H2IA 4EJ4A 4X32A 4LDOA 4OV0A 2XM0A 5A44A 3OE8A 5DHHA 2J9BA 4XTOA 3NSBA 3UTYA 1P8UA 1S51A 2YL1A 1IXFA 3NMIA 3NMKA 1L9HA 3OE6A 1GU8A 2XL6A 4JE9A 4AMIA 3TOMA 2KSBA 1S05A 1Q5JA 3D4SA 4JKVA 3HAPA 3IQ6A 4QRYA 4BVNA 4GRVA 4JQ6A 4JR8A 5B0WA 3BVDB 1S52A 1NBBA 3P0GA 5AHZA 5B6YA 5A45A 1XJIA 5G36A 5ETZA 4XT1A 5JLIA 3ZQVA 1EHKB 3OE0A 1KG9A 3FOPA 3RZEA 2ZZLA 3HNLA 3ZPRA 4DJHA 5DYSA 3QAKA 5A8EA 2X72A 4G7QB 5JT4A 2WJLA 4KNFA 5AHYA 4UHRA 4K5YA 3QJUB 4D4NA 3C9MA 1M0LA 5JJJA 3HAOA 2R4SA 4FBZA 3ZWIA 2ZIYA 2Z55A 4XTNA 5BR2A 1C3WA 4WGZA 5JVEA 4U9EA 1QKPA 3CAPA 3C63A 3PQRA 2CCYA 1HZXA 1BBHA 2LNLA 4GBRA 3QJTB 3VHZA 2YKZA 1QHJA 2EI4A 3QW1A 1CGNA 2KS9A 1H68A 1GQAA 1FBKA 5AWZA 2YL0A 2BC5A 5LWEA 3IQ5A 4L6RA 2RH1A 3C62A 3RFMA 4GP8B 2NTUA 5JJEA 1BRDA 2XLDA 4CJOA 2YCXA 3UTXA 3VGAA 1XMEB 4N4YB 3KJ6A 5JP7A 4A4MA 2ZFEA 2Y01A 4GP5B 3S8GB 1R2NA 4G71B 3HNKA
chains in the Genus database with same CATH superfamily
3W8HA 1TFOB 2YLIA 2HKVA 1MQVA 5KYYB 3H65A 5L0CA 5K0IA 5H2OA 4EKWA 1OR3A 2PFDA 3AQCA 1VGOA 2CW0F 3ODUA 5L0HA 3UMKA 2XXAB 4G70B 2YCYA 4LACB 2YLDA 5G28A 4IARA 2Y03A 1OCZC 3US6A 1T6UA 4LDRA 2R02A 3UMHA 3K33A 4FESA 4J30B 4DRHB 3TQOA 2J9VA 3SXKA 3SP1A 4W8PA 4N6CA 4MVOA 1A7EA 2OEVA 4BV0A 2EPOA 1P8IA 3VG9A 2DYSC 2WVQA 1TR2A 3W8IA 2VCCA 1H7IA 3DD7A 1YA9A 3RQFA 3RQGA 2IBFA 4JEBA 4WAVA 1UFBA 4ULWA 2J7PD 1QPUA 2ZXWC 3T6JA 4LDEA 5ITCA 3UONA 4KI2A 4GQHA 4JIOA 4FAPB 3JYYA 2Y3BA 4EWCA 5G2CA 1TN0A 5H2KA 4DOZA 3V5YA 3X3CA 2C04A 2A68F 1HMOA 2AVKA 1QSPA 3KPHA 5KYXA 2HS5A 2B0JA 3EGDA 5H2JA 4LDLA 5A69A 1A7VA 2YCWA 3RVZA 4UDVA 1TWCA 1GM5A 5F28E 2L6XA 3RF3A 1QM8A 1WASA 2YZSA 3A7KA 2Q4FA 2A1DD 5G2DA 1RJ9A 1R84A 1HMDA 4FPDA 3LJBA 1OCRC 4BPMA 2M3GA 1EKYA 1VTMP 2FAPB 2XRHA 5GPGB 4CIHA 3QJVB 3RQEA 1NLXA 2IOQA 4MVQA 3ABMC 4KLYA 3NG1A 2L7AA 4MQSA 5L3QA 2F22A 2P1AA 2LIGA 4O6YA 5BR5A 3WQJA 3EH4B 4U5HA 4KC9A 5AX0A 4K7BA 3X1OA 1VYKA 4FWVA 1NFOA 2PF4E 4MTGA 1IZMA 3G50A 2F93A 1E0PA 1D1CA 2YQYA 3JSEO 5H2PA 3EG9B 5DLJA 4ZLCA 4PJNA 3KYJA 1LVKA 4CIPA 3R2PA 1GGQA 5F5HA 4CDYA 3M15A 1WWPA 2JAFA 4J7TA 4ULVA 2Y02A 2KJGA 4XLNF 3QBGA 1SMYF 3BEHA 4BEZA 4LDKA 2Y3GA 2AWCA 2NUPB 3DAFA 1LI7A 2YDVA 1X0SA 3Q7GA 2OKUA 3UZCA 2FFHA 2XS1A 3GEIA 3C9LA 3G4ZA 3QVZA 4JJFA 3NKEA 3PBLA 1LS4A 2J9WA 2R7RA 2XLVA 5H2MA 2LFFA 3REYA 2QUPA 1YYXA 3K1IC 4U5CE 1P8HA 3ZIBA 1U19A 4DKLA 4ZLDA 3WG7C 3X2QC 2VT4A 2WB7A 3TK0A 3LUTB 3UR3C 2YLGA 3L34A 4W8KA 3GWNA 3A11A 2ZXOA 2Y04A 1NU9C 1ZHWA 4MQTA 3SXMA 4CX9A 2Q3TA 1OCCC 3COCA 3EZHA 1KNYA 5KYWA 4RDAA 5AGFA 5A6AA 1NU7D 1Q0DA 4AE4B 4QDLA 3UMIA 2IXNA 1KU2A 4BJTA 3MX3A 3RVYA 3OA1A 3CQZA 1HW2A 5DHGA 4DJ9A 4IRUA 3HARA 4MTOA 3O55A 3AYMA 1M2VA 1ZW3A 1D0ZA 3EHNA 1LKXA 1WTYA 3U8VA 5A44A 2J9BA 1NFNA 2KW3C 3EGXB 1TWAA 3UTYA 2KC3A 1P8UA 2YL1A 3NMIA 1GU8A 4CS8A 1RKEA 2NSGA 4JE9A 4I1MA 3S29A 1SZIA 2KSBA 3TD7A 3IQ6A 4QRYA 4BVNA 1QKRA 2NG1A 4GRVA 4JQ6A 5BQHA 3Q7LA 3FVYA 3DI5A 2XXAA 1XJIA 5G36A 2Z15A 3V5ZA 2OJQA 1FAPB 3U0CA 3HTKC 3ZQVA 4OIOF 1EHKB 5KYXB 3OE0A 2DGJA 3EGDB 5L0FA 3RZEA 4GEHA 3QAKA 2WJLA 4K5YA 2EILC 2VCBA 3QJUB 3C9MA 3Q6NA 1LS1A 1RKCA 2H7OA 3Q6MA 5BR2A 2WZFA 1C3WA 4WGZA 4U9EA 5T1DB 2OCCC 5E3AA 3GEEA 1V74B 3H2VA 1S7ZA 4GBRA 1NZEA 2LD6A 3EQLF 4AX2A 1QHJA 4G7OF 3ITFA 4P6IC 2R7VA 2KS9A 2W4BA 2YL0A 2OG2A 2P7VA 3IQ5A 3B9QA 3LLIA 3MLGA 4L6RA 4A4AA 3C62A 3RFMA 4GP8B 2NTUA 2C03A 2CDQA 1R5ID 1G8XA 2YCXA 3DZAA 3VGAA 4KBLA 4H54A 5A6BA 2ZFEA 2Y01A 2FGYA 4GP5B 4Q4ZF 5DQZA 1K04A 1YVIA 3SNHA 3HNKA 3I4UA 1MMDA 4MVZA 3KL4A 1PD1A 1BR2A 4XEVA 1VJMA 1L0MA 4BJ6C 1IW9A 2XLHA 2R25A 2W4MA 4GYCA 1JRAA 1BM1A 1E85A 4P9TA 1AVOB 5JS5A 3S3DB 5B3SC 3UTWA 4DXWA 4LLCA 4XWJA 4FAAB 1U6HA 3TJ6A 4LLEA 3AM6A 3UTVA 2XM4A 4RD9A 3DMDA 2OQMA 1EA8A 4MVRA 4XTKA 1FMWA 5B6VA 3NYLA 1BR1A 3O10A 3U3FA 1BRRA 4JJGA 4XTLA 1MGYA 5KYNA 4XLPF 4KNVA 2Q9CA 4PJJA 4XT3A 1V54C 3JTLO 3T45A 4QI0A 1E84A 3ASOC 1TN5A 5C1MA 3AGUA 5DS4A 1OQCA 1RXQA 2YRFA 1JV6A 5AX1A 4YL1A 1C8SA 3NY8A 3NYMA 2LP4A 1Q0KA 3S3BB 3WHNA 1Z23A 2QE9A 4MBSA 3QBLA 1C8RA 2IXMA 3ZTZA 2W9YA 5JRAA 4E7SA 3TULA 2ZPAA 1ZHXA 1YYJA 5KYWB 1FFHA 3PCVA 3QBKA 1UCQA 1Z63A 1Z3IX 2YVKA 4ONSA 3CSKA 2Y39A 4MS2A 3V2YA 2J7PA 3DE9A 2KK1A 1JAFA 2MWQA 5A6BD 1APCA 1M2VB 1G5ZA 3KH2A 1WN0A 3IEEA 2EPKX 1Q5IA 2MHRA 4OIQF 3DAGA 2XLMA 2ZXRA 3SZRA 3JRTA 2A69F 4JCHA 4OD5A 1OKKD 1ZHTA 1KMEA 2R7XA 3K1HA 2A6HF 4EA3A 2R7TA 1S8JA 2OEXA 3E9VA 3LS1A 3LAYA 1LM3B 2IXPA 4CS9A 1UG7A 4G7RB 1SR2A 2KGOA 4YWQA 1LE2A 1PV3A 1O87A 4BUOA 4C7OA 2F95A 3RFYA 1A41A 4XXJA 4IAQA 4AE4A 3O6XA 1FR0A 4MW3A 4PXFA 2J0XA 2PNOA 1PD0A 2H7BA 2XL8A 2J4YA 1FNTc 2X0CA 2D4UA 2GA0A 4X1HA 4EHPA 1A7DA 4G7HF 1HE9A 3S84A 3OAXA 3EGXA 5BQIA 1ZU5A 5BQGA 5J7AA 4C3DA 1X0K1 2PX0A 3JSZA 4IAOA 2QY9A 3DDLA 3I5QA 3PDMP 4E17A 3U2MA 1TQGA 3HKKA 1ZYRF 2XL4A 4QI1A 1ZZPA 4G7SB 3L8IA 1ORSC 4BEJA 4MW8A 2QLAA 4AL0A 4D4XA 3FAPB 5DVWA 1C17M 2VASA 2CGEA 1O3UA 2YHSA 3BRJA 3MFNA 5G2AA 1T6QA 3SXZA 3N0TA 1LIHA 2GFHA 4JZAA 1Z5ZA 1PXRA 5EHHA 4WW3A 4JVSA 4IB4A 2CNWD 3FOOA 3VYWA 3HNJA 1I4ZA 5D92A 2V3CC 2AU5A 4HFKB 4PR9A 1MNEA 2YCZA 4MNDA 4OIRF 4NTFA 1DZEA 3EH3B 2GAQA 3UG9A 3MYFA 1ZU4A 1C02A 4E0HA 2JD3A 3AGTA 3DM5A 4C3BA 2VCAA 2EPNA 1OR2A 4J7YA 5A6JA 1AUEA 2EINC 3GM3A 5E3CA 3C18A 2UUIA 2UUHA 3QW0A 2ASRA 4EJ4A 4X0RA 1TWHA 1WGWA 4X32A 3ECSA 4OD4A 2RD9A 2XM0A 4YT4A 1JMWA 4XTOA 2YWAA 1S51A 1IXFA 3NMKA 5L0GA 4B6IA 5L0JA 3TOMA 1EQ1A 4PK4A 3KKBA 4YT2A 1Q5JA 4JKVA 1EI7A 1AEPA 2G62A 3FMSA 3BVDB 1C03A 5B6YA 3M1CB 2IM8A 4JRZA 4I3MA 5JLIA 4O7GA 3CEXA 4M63A 3QMKA 3IQCA 3ATPA 5HV9A 3FOPA 3HNLA 3ZPRA 4DJHA 3S27A 2Y69C 4NCQA 2A0UA 3AQBA 5AHYA 3GM1A 1JPJA 1DOVA 1M0LA 2TMVP 3DM9B 5JJJA 2HJMA 1E2XA 2HSBA 1WOLA 1D1BA 1T6IA 2KNHA 1Q0MA 1VLSA 3ABKC 4DS7E 3LEVA 3PQRA 4NTBA 4AK9A 2CCYA 4IGGA 3EH2A 4NTAA 1ZHZA 1LI5A 3HJCA 1U0BB 4EUKB 3AG2C 5E33A 4LERA 2EI4A 2Q00A 3ZC4A 2LK4A 1H68A 1GQAA 1RMVA 4YJWA 5LWEA 2PP4A 1T5OA 5HSWA 4BJ5A 4EBKA 1G4WR 3SEOA 4C7OB 2VC9A 2BE5F 5KYUA 1XMEB 2OOCA 4A4MA 4MTFA 5DQTA 5FZTA 4A2NB 4G71B 4GPOA 4BEYA 1IW7F 5B34A 1M56C 4Z9HA 3M79A 1S8LA 3LNMB 1XWJA 2WL8A 1DOWA 3QTHA 2Y00A 1UAZA 1XIOA 4HYXA 4GP4B 1YJGA 3ABLC 1O0AA 2KSAA 3VAYA 1GZMA 4K0DA 3POVA 1KGBA 3JRMO 3RKOF 3OWTA 2KSYA 1OW7A 3DJUB 2D5RB 3B71A 4BG0A 4J4QA 2J9UA 4DVZA 3DQBA 3NYJA 1NG1A 3S90A 4BJ5C 4WGYA 4JTAB 5FCLA 1ORJA 3IPMO 2H8AA 1U89A 2I1XA 2M4EA 4MQ9F 2LQGA 3CZ6A 5L3VA 3ZTMA 2HSQA 3ZQYA 3S8FB 5F5FA 1JR8A 2I35A 3PXOA 2DB4A 3E70C 1JV7A 3TJ5A 3MYIA 3KMIA 4DVYP 1K05A 4XPWA 3QVYA 1Q0FA 4CS8C 1X0I1 3QZCA 4YL0A 3TOLA 3T9OA 4XQ1A 3LLKA 2A0BA 5FJGA 2HFIA 1L7CA 2XLEA 4C3EA 256BA 5F8UA 1O5HA 4ANJA 1FBBA 1JPNA 3DJNB 2R7OA 5JUAA 2LCHA 4AL1A 3L1MA 4E0IA 3EMLA 4JTCB 2I21A 3B0UX 5H2HA 2PX3A 3VW7A 2P61A 4TL3A 2LSEA 1T01A 5G54A 4CDVA 4JEAA 2NSFA 2QTVA 2L6GA 5B6XA 5JSLA 2X51A 2YL7A 3V7OA 2O9XA 5EGYA 3SXYA 5JJNA 1OKKA 3C8GD 3HLZA 3JYHA 2PEDA 2QPDB 5KKHA 1B68A 3X3BA 2NUTB 1OXBA 2HPYA 4Y9HA 1YDIA 3EH5B 1E83A 4QIDA 2J46A 3HAQA 4JC7A 2L81A 2ETSA 3GEHA 3U5SA 4PXKA 1LPEA 2R7QA 1GUEA 1M0MA 5EN0A 1YZCA 3WAQA 2J0WA 3M4BA 3FAJA 1RCPA 4JTDB 3FDQA 2KQ9A 1J8MF 4CJGA 3PMRA 4N4WA 3IQTA 4EBJA 2P0NA 1I5NA 2YDOA 5COMA 3EZIA 4PACA 3ZG1A 3VI0A 1F88A 4X31A 1YLMA 3MBGA 4MVUA 1VYIA 4N6HA 1F50A 1KTMA 1K40A 1VB5A 4DRIB 5KYUB 3LNRA 1W2WA 3VM6A 2AT9A 2HZ8A 4HYJA 4AMJA 4NC3A 1G4US 5T3TA 4E18A 3UZAA 4IWBA 4HFFB 1M57C 1LE4A 2J45A 1YA7O 4J32B 3W2WA 3EFOA 1Q0GA 3V5XA 5AC5A 2ZD9A 2I20A 2XS8A 2CNWA 1M2OA 1FMVA 3PWHA 2I15A 3QBIA 1YARO 2R9RB 2ICWG 1PCXA 2P6VA 2NTWA 3C7JA 3NS0A 4CSAA 1KG8A 4MD2A 4CDAA 3HASA 3SN6R 3UNGC 3MBVA 2V26A 2R4RA 5H2IA 4U5GA 4PJLA 4OV0A 3U3BA 4WABA 2HMQA 3LS0A 3OE6A 1L9HA 2XL6A 2XSEA 3GM2A 4AMIA 2RSEB 1L3PA 3RIPA 1S05A 3GORA 3FXHA 4JR8A 5B0WA 1NBBA 5AHZA 4XT1A 2HV6A 1XZPA 2CYDA 1FFTC 2ZZLA 2A6EF 1ORYA 4CSAC 2Q7RA 3GODA 4CS9C 3N2ZB 3HAOA 2R4SA 4FBZA 3I5PA 4U5BE 1Y4CA 2R7WA 2ZIYA 1JOGA 3A9CA 1QKPA 5JVEA 4I1OB 5AC4A 1HZXA 1BBHA 3K66A 5B1BC 3K6BA 5TJ5E 2DI3A 2EIJC 4BJ1A 3CAXA 3QW1A 1HW1A 1FBKA 5AWZA 2NPUA 1OCOC 1VLTA 4N06A 5E2QA 1BDJB 3AG1C 4DRJB 1TKNA 2I8BA 4CJOA 3ZDLA 2JX0A 4O6NA 1H6GA 5JP7A 3DWWA 2LFDA 2PBEA 3S8GB 2QNLA 1R2NA 1T9KA 4EBBA 2E87A 3NMJA 5L0IA 3H2UA 3R7CA 2R05A 1YAUO 3QDCA 1ZVZA 4FX5A 2G87A 2W45A 5H2LA 5COGA 2J8WA 2IYLD 1Z6AA 1OW6A 4I44A 4L35A 1HY5A 2GWWA 2WVOA 4G78A 4OINF 3K1IA 5D91A 2XLOA 2XLWA 5EK0A 1TWGA 3OEOA 1A0BA 1GS9A 5BUOA 4PFPA 3DXJF 4R32A 3U9MA 1E86A 4DAJA 1M6TA 3QJQB 1JFPA 2AWYA 3EPVA 3NDBB 2NUTA 1BZ4A 1HE1A 5TGZA 3CODA 1MMAA 3B29A 4Z9JA 3FHDA 4XPYA 1Z7Qc 1CPQA 2EIMC 1QKOA 1H2SA 1QZXA 5CI9A 3GWLA 3EFOB 1OW8A 2DYRC 5B35A 2EPLX 1ZHYA 4CS7A 1CGOA 3DKAA 1AT9A 2AP3A 4JURI 1H9TA 4XEFA 4G72B 3VVKA 1LN6A 2WVNA 3AG3C 3QJRB 4Q5SF 4DBQA 1MMNA 3ZSUA 4QI2A 3NYAA 1JGJA 4HWLA 3NY9A 2Q9AA 2WZGA 4K1OA 3RYLA 3T6BA 2YEVA 3IHUA 5IY5C 1E12A 3VF0A 2BRDA 4YT5A 3QAPA 2Z73A 1H9GA 5AZDA 2OU6A 1D0YA 2YL3A 2VH3A 5DS5A 1QQ3A 3ZEVA 4BWBA 3ZVRA 1TFKB 5G53A 3NKDA 1MNDA 4P9FA 3DE8A 4JCZA 3RH3A 5CIVA 3U8PA 3OE9A 4ER9A 2ZXPA 1S53A 5CI8A 3RW0A 3K7DA 3T4RA 4MVMA 1VK5A 4HE8D 4UG2A 4PFOA 4XPXA 3EJNA 1BRXA 3C8GA 4YN0B 1Y6DA 2WJKA 1R4TA 3O39A 3HANA 5KYYA 2JPUA 5B2NA 3KYIA 4RBNA 3B0VC 2JAGA 2R7SA 1V4AA 2R03A 4Z9IA 1XZQA 2G3KA 1PY6A 3F46A 1MMGA 2HJ3A 4KNWA 2MYSA 1QVXA 3S0XA 3V2WA 4YK5A 2WZLA 4YL3A 3L0IA 3L8JA 2GDCA 2QPEB 2M64A 5B6ZA 3ZPQA 4OIPF 5T3WA 1VOMA 5B3IA 3LESA 3SYNA 1BR4A 1S54A 1SF8A 3AJMA 3M4CA 4BJ6A 1RJ9B 2L9JA 1VMAA 1WATA 2B0HA 1SYQA 1QLEC 2L6HA 4WJ0A 3AYNA 1CWQA 4U9DA 1YZAA 3U9JA 3C8ZA 3AG4C 4G7ZF 4BEMJ 5ITEA 3S3CB 3GANA 1F4ZA 1AP9A 3PHF2 4FA7B 1PXSA 1IW6A 1M0KA 3ABWA 3PDSA 1CGME 2VB6A 4U5DE 2G3VA 4MD1A 3JCUQ 2BL2A 4NQFA 2Y3HA 4H4KC 3HNIA 5B6WA 4G0HA 3AOUA 4EIYA 3EH1A 3VRCA 1CPRA 4U5EE 5H2NA 4YT8A 4O79A 3QJSB 2OJED 3JZ0A 4CBEA 4E7ZA 2Y3DA 1F1MA 2H7VC 3EHMA 4LDOA 3OE8A 5DHHA 1N1CA 3NSBA 4F4BA 3UGPA 1D0XA 3F47A 1ST6A 5A6KA 3D4SA 3HAPA 2HV7A 2KYHA 2R7UA 1S52A 3P0GA 4IJJA 5A45A 4NY3A 5ETZA 1ZW2A 1D1AA 3T6GB 2KSFA 3UGOA 5COFA 1KG9A 1J8YF 4XEKA 5A8EA 5DYSA 2X72A 4G7QB 2HUJA 5JT4A 2EIKC 4KNFA 4UHRA 3N24A 4O6MA 4Q7CA 3J06A 3B0PA 4D4NA 3EG9A 5L0DA 3U2LA 3ZWIA 3ASNC 3G4XA 2Z55A 4XTNA 3W2VA 3JT1A 3S9OA 3CAPA 3C63A 1I4YA 2LNLA 1NSGB 1FTSA 3W4YA 1OXKA 3QJTB 2YKZA 3VHZA 4DBRA 2IXOA 5DS6A 1CGNA 2NUPA 1V55C 4GYTA 2BC5A 4PJMA 2Q9BA 4JW1A 2RH1A 3LEOA 5JJEA 1BRDA 2L6FA 3S28A 2XLDA 3UTXA 4LDQA 2EPMX 3C8GB 4N4YB 3KJ6A 3NRHA 4HEAJ 3WODF 4U5FE 1RKEB 5B1AC 2HMZA 4MVSA
chains in the Genus database with same CATH topology
3NMJA 2YLIA 4GPOA 4BEYA 1MQVA 5B34A 3QDCA 3M79A 1VJMA 1L0MA 1S8LA 2G87A 5H2OA 5H2LA 1IW9A 2XLHA 4GYCA 1BM1A 1VGOA 3ODUA 1E85A 2J8WA 1UAZA 2Y00A 4G70B 1XIOA 4HYXA 2YCYA 5JS5A 4GP4B 3S3DB 4L35A 1O0AA 3UTWA 2KSAA 1GZMA 2YLDA 1KGBA 4FAAB 5G28A 4IARA 2KSYA 3UTVA 3AM6A 2Y03A 2XM4A 4J4QA 2XLOA 2XLWA 5B6VA 1BRRA 3DQBA 4XTLA 1E86A 1MGYA 4DAJA 1M6TA 3QJQB 1JFPA 4WGYA 4XT3A 3T45A 1E84A 4BV0A 1TN5A 1P8IA 5C1MA 5TGZA 3CODA 3VG9A 1JV6A 1CPQA 5AX1A 1QKOA 2I1XA 1H2SA 1C8SA 3NY8A 3ZTMA 3ZQYA 3S3BB 4JEBA 4WAVA 5B35A 3S8FB 4MBSA 3QBLA 1C8RA 2I35A 3ZTZA 1QPUA 3PXOA 1CGOA 4LDEA 1JV7A 5JRAA 1AT9A 5ITCA 3UONA 1YYJA 3QVYA 1X0I1 3QBKA 4G72B 1UCQA 5G2CA 3TOLA 1TN0A 5H2KA 3VVKA 3X3CA 1LN6A 3V2YA 3DE9A 5FJGA 3QJRB 2XLEA 1JAFA 5H2JA 256BA 4LDLA 5F8UA 1A7VA 2YCWA 1APCA 1FBBA 3NYAA 1JGJA 4HWLA 3NY9A 5JUAA 3L1MA 2L6XA 3EMLA 1Q5IA 1QM8A 3A7KA 2I21A 5G2DA 5H2HA 1E12A 3VW7A 2BRDA 2XLMA 3QAPA 1R84A 4FPDA 2Z73A 4TL3A 5AZDA 5G54A 2M3GA 4CDVA 4JEAA 2YL3A 1EKYA 1QQ3A 3ZEVA 4BWBA 3QJVB 1KMEA 5G53A 4EA3A 4KLYA 5JSLA 5B6XA 1S8JA 2YL7A 3DE8A 1LM3B 4MQSA 5JJNA 5BR5A 3WQJA 3EH4B 3U8PA 2QPDB 2PEDA 3OE9A 4G7RB 5KKHA 4ER9A 5AX0A 1S53A 3X3BA 2HPYA 4Y9HA 3EH5B 1E83A 4QIDA 3HAQA 4BUOA 4UG2A 2F95A 1BRXA 4XXJA 4IAQA 2F93A 4PXKA 1E0PA 1GUEA 5H2PA 1M0MA 5EN0A 4PXFA 2WJKA 4CIPA 1YZCA 3M4BA 2XL8A 4CDYA 2J4YA 3M15A 1RCPA 3HANA 5B2NA 2JAFA 4X1HA 2JAGA 4ULVA 4CJGA 2Y02A 4N4WA 3OAXA 3QBGA 5J7AA 1X0K1 2YDOA 1PY6A 4BEZA 3DDLA 3V2WA 2YDVA 1X0SA 4QI1A 3UZCA 3VI0A 1F88A 4G7SB 4X31A 3C9LA 2QLAA 2QPEB 4N6HA 4D4XA 3QVZA 5B6ZA 3ZPQA 3PBLA 1F50A 5B3IA 2AT9A 1S54A 2XLVA 3M4CA 4HYJA 5G2AA 4AMJA 4NC3A 5H2MA 3REYA 1YYXA 3AYNA 1CWQA 4U9DA 1PXRA 1YZAA 3UZAA 4WW3A 1P8HA 1U19A 4DKLA 4IB4A 2VT4A 3FOOA 3HNJA 2YLGA 5ITEA 3S3CB 1F4ZA 1AP9A 2Y04A 2YCZA 2I20A 4MQTA 4FA7B 1PXSA 1IW6A 1DZEA 1M0KA 3ABWA 3EH3B 3PDSA 4CX9A 3COCA 3PWHA 3UG9A 5AGFA 3QBIA 4MD1A 2NTWA 3NS0A 3HNIA 5B6WA 1KG8A 4MD2A 5DHGA 4CDAA 4EIYA 3HARA 3HASA 3VRCA 3SN6R 3AYMA 1CPRA 3QW0A 3MBVA 5H2NA 2R4RA 3QJSB 5H2IA 4EJ4A 4X32A 4LDOA 4OV0A 2XM0A 5A44A 3OE8A 5DHHA 2J9BA 4XTOA 3NSBA 3UTYA 1P8UA 1S51A 2YL1A 1IXFA 3NMIA 3NMKA 1L9HA 3OE6A 1GU8A 2XL6A 4JE9A 4AMIA 3TOMA 2KSBA 1S05A 1Q5JA 3D4SA 4JKVA 3HAPA 3IQ6A 4QRYA 4BVNA 4GRVA 4JQ6A 4JR8A 5B0WA 3BVDB 1S52A 1NBBA 3P0GA 5AHZA 5B6YA 5A45A 1XJIA 5G36A 5ETZA 4XT1A 5JLIA 3ZQVA 1EHKB 3OE0A 1KG9A 3FOPA 3RZEA 2ZZLA 3HNLA 3ZPRA 4DJHA 5DYSA 3QAKA 5A8EA 2X72A 4G7QB 5JT4A 2WJLA 4KNFA 5AHYA 4UHRA 4K5YA 3QJUB 4D4NA 3C9MA 1M0LA 5JJJA 3HAOA 2R4SA 4FBZA 3ZWIA 2ZIYA 2Z55A 4XTNA 5BR2A 1C3WA 4WGZA 5JVEA 4U9EA 1QKPA 3CAPA 3C63A 4DS7E 3PQRA 2CCYA 1HZXA 1BBHA 2LNLA 4GBRA 3QJTB 3VHZA 2YKZA 1QHJA 2EI4A 3QW1A 1CGNA 2KS9A 1H68A 1GQAA 1FBKA 5AWZA 2YL0A 2BC5A 5LWEA 3IQ5A 4L6RA 2RH1A 3C62A 3RFMA 4GP8B 2NTUA 5JJEA 1BRDA 2XLDA 4CJOA 2YCXA 3UTXA 3VGAA 1XMEB 4N4YB 3KJ6A 5JP7A 4A4MA 2ZFEA 2Y01A 4GP5B 3S8GB 1R2NA 4G71B 3HNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMJ A;  2YLI A;  4GPO A;  4BEY A;  1MQV A;  5B34 A;  3QDC A;  3M79 A;  1VJM A;  1L0M A;  1S8L A;  2G87 A;  5H2O A;  5H2L A;  1IW9 A;  2XLH A;  4GYC A;  1BM1 A;  1VGO A;  3ODU A;  1E85 A;  2J8W A;  1UAZ A;  2Y00 A;  4G70 B;  1XIO A;  4HYX A;  2YCY A;  5JS5 A;  4GP4 B;  3S3D B;  4L35 A;  1O0A A;  3UTW A;  2KSA A;  1GZM A;  2YLD A;  1KGB A;  4FAA B;  5G28 A;  4IAR A;  2KSY A;  3UTV A;  3AM6 A;  2Y03 A;  2XM4 A;  4J4Q A;  2XLO A;  2XLW A;  5B6V A;  1BRR A;  3DQB A;  4XTL A;  1E86 A;  1MGY A;  4DAJ A;  1M6T A;  3QJQ B;  1JFP A;  4WGY A;  4XT3 A;  3T45 A;  1E84 A;  4BV0 A;  1TN5 A;  1P8I A;  5C1M A;  5TGZ A;  3COD A;  3VG9 A;  1JV6 A;  1CPQ A;  5AX1 A;  1QKO A;  2I1X A;  1H2S A;  1C8S A;  3NY8 A;  3ZTM A;  3ZQY A;  3S3B B;  4JEB A;  4WAV A;  5B35 A;  3S8F B;  4MBS A;  3QBL A;  1C8R A;  2I35 A;  3ZTZ A;  1QPU A;  3PXO A;  1CGO A;  4LDE A;  1JV7 A;  5JRA A;  1AT9 A;  5ITC A;  3UON A;  1YYJ A;  3QVY A;  1X0I 1;  3QBK A;  4G72 B;  1UCQ A;  5G2C A;  3TOL A;  1TN0 A;  5H2K A;  3VVK A;  3X3C A;  1LN6 A;  3V2Y A;  3DE9 A;  5FJG A;  3QJR B;  2XLE A;  1JAF A;  5H2J A;  256B A;  4LDL A;  5F8U A;  1A7V A;  2YCW A;  1APC A;  1FBB A;  3NYA A;  1JGJ A;  4HWL A;  3NY9 A;  5JUA A;  3L1M A;  2L6X A;  3EML A;  1Q5I A;  1QM8 A;  3A7K A;  2I21 A;  5G2D A;  5H2H A;  1E12 A;  3VW7 A;  2BRD A;  2XLM A;  3QAP A;  1R84 A;  4FPD A;  2Z73 A;  4TL3 A;  5AZD A;  5G54 A;  2M3G A;  4CDV A;  4JEA A;  2YL3 A;  1EKY A;  1QQ3 A;  3ZEV A;  4BWB A;  3QJV B;  1KME A;  5G53 A;  4EA3 A;  4KLY A;  5JSL A;  5B6X A;  1S8J A;  2YL7 A;  3DE8 A;  1LM3 B;  4MQS A;  5JJN A;  5BR5 A;  3WQJ A;  3EH4 B;  3U8P A;  2QPD B;  2PED A;  3OE9 A;  4G7R B;  5KKH A;  4ER9 A;  5AX0 A;  1S53 A;  3X3B A;  2HPY A;  4Y9H A;  3EH5 B;  1E83 A;  4QID A;  3HAQ A;  4BUO A;  4UG2 A;  2F95 A;  1BRX A;  4XXJ A;  4IAQ A;  2F93 A;  4PXK A;  1E0P A;  1GUE A;  5H2P A;  1M0M A;  5EN0 A;  4PXF A;  2WJK A;  4CIP A;  1YZC A;  3M4B A;  2XL8 A;  4CDY A;  2J4Y A;  3M15 A;  1RCP A;  3HAN A;  5B2N A;  2JAF A;  4X1H A;  2JAG A;  4ULV A;  4CJG A;  2Y02 A;  4N4W A;  3OAX A;  3QBG A;  5J7A A;  1X0K 1;  2YDO A;  1PY6 A;  4BEZ A;  3DDL A;  3V2W A;  2YDV A;  1X0S A;  4QI1 A;  3UZC A;  3VI0 A;  1F88 A;  4G7S B;  4X31 A;  3C9L A;  2QLA A;  2QPE B;  4N6H A;  4D4X A;  3QVZ A;  5B6Z A;  3ZPQ A;  3PBL A;  1F50 A;  5B3I A;  2AT9 A;  1S54 A;  2XLV A;  3M4C A;  4HYJ A;  5G2A A;  4AMJ A;  4NC3 A;  5H2M A;  3REY A;  1YYX A;  3AYN A;  1CWQ A;  4U9D A;  1PXR A;  1YZA A;  3UZA A;  4WW3 A;  1P8H A;  1U19 A;  4DKL A;  4IB4 A;  2VT4 A;  3FOO A;  3HNJ A;  2YLG A;  5ITE A;  3S3C B;  1F4Z A;  1AP9 A;  2Y04 A;  2YCZ A;  2I20 A;  4MQT A;  4FA7 B;  1PXS A;  1IW6 A;  1DZE A;  1M0K A;  3ABW A;  3EH3 B;  3PDS A;  4CX9 A;  3COC A;  3PWH A;  3UG9 A;  5AGF A;  3QBI A;  4MD1 A;  2NTW A;  3NS0 A;  3HNI A;  5B6W A;  1KG8 A;  4MD2 A;  5DHG A;  4CDA A;  4EIY A;  3HAR A;  3HAS A;  3VRC A;  3SN6 R;  3AYM A;  1CPR A;  3QW0 A;  3MBV A;  5H2N A;  2R4R A;  3QJS B;  5H2I A;  4EJ4 A;  4X32 A;  4LDO A;  4OV0 A;  2XM0 A;  5A44 A;  3OE8 A;  5DHH A;  2J9B A;  4XTO A;  3NSB A;  3UTY A;  1P8U A;  1S51 A;  2YL1 A;  1IXF A;  3NMI A;  3NMK A;  1L9H A;  3OE6 A;  1GU8 A;  2XL6 A;  4JE9 A;  4AMI A;  3TOM A;  2KSB A;  1S05 A;  1Q5J A;  3D4S A;  4JKV A;  3HAP A;  3IQ6 A;  4QRY A;  4BVN A;  4GRV A;  4JQ6 A;  4JR8 A;  5B0W A;  3BVD B;  1S52 A;  1NBB A;  3P0G A;  5AHZ A;  5B6Y A;  5A45 A;  1XJI A;  5G36 A;  5ETZ A;  4XT1 A;  5JLI A;  3ZQV A;  1EHK B;  3OE0 A;  1KG9 A;  3FOP A;  3RZE A;  2ZZL A;  3HNL A;  3ZPR A;  4DJH A;  5DYS A;  3QAK A;  5A8E A;  2X72 A;  4G7Q B;  5JT4 A;  2WJL A;  4KNF A;  5AHY A;  4UHR A;  4K5Y A;  3QJU B;  4D4N A;  3C9M A;  1M0L A;  5JJJ A;  3HAO A;  2R4S A;  4FBZ A;  3ZWI A;  2ZIY A;  2Z55 A;  4XTN A;  5BR2 A;  1C3W A;  4WGZ A;  5JVE A;  4U9E A;  1QKP A;  3CAP A;  3C63 A;  3PQR A;  2CCY A;  1HZX A;  1BBH A;  2LNL A;  4GBR A;  3QJT B;  3VHZ A;  2YKZ A;  1QHJ A;  2EI4 A;  3QW1 A;  1CGN A;  2KS9 A;  1H68 A;  1GQA A;  1FBK A;  5AWZ A;  2YL0 A;  2BC5 A;  5LWE A;  3IQ5 A;  4L6R A;  2RH1 A;  3C62 A;  3RFM A;  4GP8 B;  2NTU A;  5JJE A;  1BRD A;  2XLD A;  4CJO A;  2YCX A;  3UTX A;  3VGA A;  1XME B;  4N4Y B;  3KJ6 A;  5JP7 A;  4A4M A;  2ZFE A;  2Y01 A;  4GP5 B;  3S8G B;  1R2N A;  4G71 B;  3HNK A; 
#chains in the Genus database with same CATH topology
 3W8H A;  1TFO B;  2YLI A;  2HKV A;  1MQV A;  5KYY B;  3H65 A;  5L0C A;  5K0I A;  5H2O A;  4EKW A;  1OR3 A;  2PFD A;  3AQC A;  1VGO A;  2CW0 F;  3ODU A;  5L0H A;  3UMK A;  2XXA B;  4G70 B;  2YCY A;  4LAC B;  2YLD A;  5G28 A;  4IAR A;  2Y03 A;  1OCZ C;  3US6 A;  1T6U A;  4LDR A;  2R02 A;  3UMH A;  3K33 A;  4FES A;  4J30 B;  4DRH B;  3TQO A;  2J9V A;  3SXK A;  3SP1 A;  4W8P A;  4N6C A;  4MVO A;  1A7E A;  2OEV A;  4BV0 A;  2EPO A;  1P8I A;  3VG9 A;  2DYS C;  2WVQ A;  1TR2 A;  3W8I A;  2VCC A;  1H7I A;  3DD7 A;  1YA9 A;  3RQF A;  3RQG A;  2IBF A;  4JEB A;  4WAV A;  1UFB A;  4ULW A;  2J7P D;  1QPU A;  2ZXW C;  3T6J A;  4LDE A;  5ITC A;  3UON A;  4KI2 A;  4GQH A;  4JIO A;  4FAP B;  3JYY A;  2Y3B A;  4EWC A;  5G2C A;  1TN0 A;  5H2K A;  4DOZ A;  3V5Y A;  3X3C A;  2C04 A;  2A68 F;  1HMO A;  2AVK A;  1QSP A;  3KPH A;  5KYX A;  2HS5 A;  2B0J A;  3EGD A;  5H2J A;  4LDL A;  5A69 A;  1A7V A;  2YCW A;  3RVZ A;  4UDV A;  1TWC A;  1GM5 A;  5F28 E;  2L6X A;  3RF3 A;  1QM8 A;  1WAS A;  2YZS A;  3A7K A;  2Q4F A;  2A1D D;  5G2D A;  1RJ9 A;  1R84 A;  1HMD A;  4FPD A;  3LJB A;  1OCR C;  4BPM A;  2M3G A;  1EKY A;  1VTM P;  2FAP B;  2XRH A;  5GPG B;  4CIH A;  3QJV B;  3RQE A;  1NLX A;  2IOQ A;  4MVQ A;  3ABM C;  4KLY A;  3NG1 A;  2L7A A;  4MQS A;  5L3Q A;  2F22 A;  2P1A A;  2LIG A;  4O6Y A;  5BR5 A;  3WQJ A;  3EH4 B;  4U5H A;  4KC9 A;  5AX0 A;  4K7B A;  3X1O A;  1VYK A;  4FWV A;  1NFO A;  2PF4 E;  4MTG A;  1IZM A;  3G50 A;  2F93 A;  1E0P A;  1D1C A;  2YQY A;  3JSE O;  5H2P A;  3EG9 B;  5DLJ A;  4ZLC A;  4PJN A;  3KYJ A;  1LVK A;  4CIP A;  3R2P A;  1GGQ A;  5F5H A;  4CDY A;  3M15 A;  1WWP A;  2JAF A;  4J7T A;  4ULV A;  2Y02 A;  2KJG A;  4XLN F;  3QBG A;  1SMY F;  3BEH A;  4BEZ A;  4LDK A;  2Y3G A;  2AWC A;  2NUP B;  3DAF A;  1LI7 A;  2YDV A;  1X0S A;  3Q7G A;  2OKU A;  3UZC A;  2FFH A;  2XS1 A;  3GEI A;  3C9L A;  3G4Z A;  3QVZ A;  4JJF A;  3NKE A;  3PBL A;  1LS4 A;  2J9W A;  2R7R A;  2XLV A;  5H2M A;  2LFF A;  3REY A;  2QUP A;  1YYX A;  3K1I C;  4U5C E;  1P8H A;  3ZIB A;  1U19 A;  4DKL A;  4ZLD A;  3WG7 C;  3X2Q C;  2VT4 A;  2WB7 A;  3TK0 A;  3LUT B;  3UR3 C;  2YLG A;  3L34 A;  4W8K A;  3GWN A;  3A11 A;  2ZXO A;  2Y04 A;  1NU9 C;  1ZHW A;  4MQT A;  3SXM A;  4CX9 A;  2Q3T A;  1OCC C;  3COC A;  3EZH A;  1KNY A;  5KYW A;  4RDA A;  5AGF A;  5A6A A;  1NU7 D;  1Q0D A;  4AE4 B;  4QDL A;  3UMI A;  2IXN A;  1KU2 A;  4BJT A;  3MX3 A;  3RVY A;  3OA1 A;  3CQZ A;  1HW2 A;  5DHG A;  4DJ9 A;  4IRU A;  3HAR A;  4MTO A;  3O55 A;  3AYM A;  1M2V A;  1ZW3 A;  1D0Z A;  3EHN A;  1LKX A;  1WTY A;  3U8V A;  5A44 A;  2J9B A;  1NFN A;  2KW3 C;  3EGX B;  1TWA A;  3UTY A;  2KC3 A;  1P8U A;  2YL1 A;  3NMI A;  1GU8 A;  4CS8 A;  1RKE A;  2NSG A;  4JE9 A;  4I1M A;  3S29 A;  1SZI A;  2KSB A;  3TD7 A;  3IQ6 A;  4QRY A;  4BVN A;  1QKR A;  2NG1 A;  4GRV A;  4JQ6 A;  5BQH A;  3Q7L A;  3FVY A;  3DI5 A;  2XXA A;  1XJI A;  5G36 A;  2Z15 A;  3V5Z A;  2OJQ A;  1FAP B;  3U0C A;  3HTK C;  3ZQV A;  4OIO F;  1EHK B;  5KYX B;  3OE0 A;  2DGJ A;  3EGD B;  5L0F A;  3RZE A;  4GEH A;  3QAK A;  2WJL A;  4K5Y A;  2EIL C;  2VCB A;  3QJU B;  3C9M A;  3Q6N A;  1LS1 A;  1RKC A;  2H7O A;  3Q6M A;  5BR2 A;  2WZF A;  1C3W A;  4WGZ A;  4U9E A;  5T1D B;  2OCC C;  5E3A A;  3GEE A;  1V74 B;  3H2V A;  1S7Z A;  4GBR A;  1NZE A;  2LD6 A;  3EQL F;  4AX2 A;  1QHJ A;  4G7O F;  3ITF A;  4P6I C;  2R7V A;  2KS9 A;  2W4B A;  2YL0 A;  2OG2 A;  2P7V A;  3IQ5 A;  3B9Q A;  3LLI A;  3MLG A;  4L6R A;  4A4A A;  3C62 A;  3RFM A;  4GP8 B;  2NTU A;  2C03 A;  2CDQ A;  1R5I D;  1G8X A;  2YCX A;  3DZA A;  3VGA A;  4KBL A;  4H54 A;  5A6B A;  2ZFE A;  2Y01 A;  2FGY A;  4GP5 B;  4Q4Z F;  5DQZ A;  1K04 A;  1YVI A;  3SNH A;  3HNK A;  3I4U A;  1MMD A;  4MVZ A;  3KL4 A;  1PD1 A;  1BR2 A;  4XEV A;  1VJM A;  1L0M A;  4BJ6 C;  1IW9 A;  2XLH A;  2R25 A;  2W4M A;  4GYC A;  1JRA A;  1BM1 A;  1E85 A;  4P9T A;  1AVO B;  5JS5 A;  3S3D B;  5B3S C;  3UTW A;  4DXW A;  4LLC A;  4XWJ A;  4FAA B;  1U6H A;  3TJ6 A;  4LLE A;  3AM6 A;  3UTV A;  2XM4 A;  4RD9 A;  3DMD A;  2OQM A;  1EA8 A;  4MVR A;  4XTK A;  1FMW A;  5B6V A;  3NYL A;  1BR1 A;  3O10 A;  3U3F A;  1BRR A;  4JJG A;  4XTL A;  1MGY A;  5KYN A;  4XLP F;  4KNV A;  2Q9C A;  4PJJ A;  4XT3 A;  1V54 C;  3JTL O;  3T45 A;  4QI0 A;  1E84 A;  3ASO C;  1TN5 A;  5C1M A;  3AGU A;  5DS4 A;  1OQC A;  1RXQ A;  2YRF A;  1JV6 A;  5AX1 A;  4YL1 A;  1C8S A;  3NY8 A;  3NYM A;  2LP4 A;  1Q0K A;  3S3B B;  3WHN A;  1Z23 A;  2QE9 A;  4MBS A;  3QBL A;  1C8R A;  2IXM A;  3ZTZ A;  2W9Y A;  5JRA A;  4E7S A;  3TUL A;  2ZPA A;  1ZHX A;  1YYJ A;  5KYW B;  1FFH A;  3PCV A;  3QBK A;  1UCQ A;  1Z63 A;  1Z3I X;  2YVK A;  4ONS A;  3CSK A;  2Y39 A;  4MS2 A;  3V2Y A;  2J7P A;  3DE9 A;  2KK1 A;  1JAF A;  2MWQ A;  5A6B D;  1APC A;  1M2V B;  1G5Z A;  3KH2 A;  1WN0 A;  3IEE A;  2EPK X;  1Q5I A;  2MHR A;  4OIQ F;  3DAG A;  2XLM A;  2ZXR A;  3SZR A;  3JRT A;  2A69 F;  4JCH A;  4OD5 A;  1OKK D;  1ZHT A;  1KME A;  2R7X A;  3K1H A;  2A6H F;  4EA3 A;  2R7T A;  1S8J A;  2OEX A;  3E9V A;  3LS1 A;  3LAY A;  1LM3 B;  2IXP A;  4CS9 A;  1UG7 A;  4G7R B;  1SR2 A;  2KGO A;  4YWQ A;  1LE2 A;  1PV3 A;  1O87 A;  4BUO A;  4C7O A;  2F95 A;  3RFY A;  1A41 A;  4XXJ A;  4IAQ A;  4AE4 A;  3O6X A;  1FR0 A;  4MW3 A;  4PXF A;  2J0X A;  2PNO A;  1PD0 A;  2H7B A;  2XL8 A;  2J4Y A;  1FNT c;  2X0C A;  2D4U A;  2GA0 A;  4X1H A;  4EHP A;  1A7D A;  4G7H F;  1HE9 A;  3S84 A;  3OAX A;  3EGX A;  5BQI A;  1ZU5 A;  5BQG A;  5J7A A;  4C3D A;  1X0K 1;  2PX0 A;  3JSZ A;  4IAO A;  2QY9 A;  3DDL A;  3I5Q A;  3PDM P;  4E17 A;  3U2M A;  1TQG A;  3HKK A;  1ZYR F;  2XL4 A;  4QI1 A;  1ZZP A;  4G7S B;  3L8I A;  1ORS C;  4BEJ A;  4MW8 A;  2QLA A;  4AL0 A;  4D4X A;  3FAP B;  5DVW A;  1C17 M;  2VAS A;  2CGE A;  1O3U A;  2YHS A;  3BRJ A;  3MFN A;  5G2A A;  1T6Q A;  3SXZ A;  3N0T A;  1LIH A;  2GFH A;  4JZA A;  1Z5Z A;  1PXR A;  5EHH A;  4WW3 A;  4JVS A;  4IB4 A;  2CNW D;  3FOO A;  3VYW A;  3HNJ A;  1I4Z A;  5D92 A;  2V3C C;  2AU5 A;  4HFK B;  4PR9 A;  1MNE A;  2YCZ A;  4MND A;  4OIR F;  4NTF A;  1DZE A;  3EH3 B;  2GAQ A;  3UG9 A;  3MYF A;  1ZU4 A;  1C02 A;  4E0H A;  2JD3 A;  3AGT A;  3DM5 A;  4C3B A;  2VCA A;  2EPN A;  1OR2 A;  4J7Y A;  5A6J A;  1AUE A;  2EIN C;  3GM3 A;  5E3C A;  3C18 A;  2UUI A;  2UUH A;  3QW0 A;  2ASR A;  4EJ4 A;  4X0R A;  1TWH A;  1WGW A;  4X32 A;  3ECS A;  4OD4 A;  2RD9 A;  2XM0 A;  4YT4 A;  1JMW A;  4XTO A;  2YWA A;  1S51 A;  1IXF A;  3NMK A;  5L0G A;  4B6I A;  5L0J A;  3TOM A;  1EQ1 A;  4PK4 A;  3KKB A;  4YT2 A;  1Q5J A;  4JKV A;  1EI7 A;  1AEP A;  2G62 A;  3FMS A;  3BVD B;  1C03 A;  5B6Y A;  3M1C B;  2IM8 A;  4JRZ A;  4I3M A;  5JLI A;  4O7G A;  3CEX A;  4M63 A;  3QMK A;  3IQC A;  3ATP A;  5HV9 A;  3FOP A;  3HNL A;  3ZPR A;  4DJH A;  3S27 A;  2Y69 C;  4NCQ A;  2A0U A;  3AQB A;  5AHY A;  3GM1 A;  1JPJ A;  1DOV A;  1M0L A;  2TMV P;  3DM9 B;  5JJJ A;  2HJM A;  1E2X A;  2HSB A;  1WOL A;  1D1B A;  1T6I A;  2KNH A;  1Q0M A;  1VLS A;  3ABK C;  4DS7 E;  3LEV A;  3PQR A;  4NTB A;  4AK9 A;  2CCY A;  4IGG A;  3EH2 A;  4NTA A;  1ZHZ A;  1LI5 A;  3HJC A;  1U0B B;  4EUK B;  3AG2 C;  5E33 A;  4LER A;  2EI4 A;  2Q00 A;  3ZC4 A;  2LK4 A;  1H68 A;  1GQA A;  1RMV A;  4YJW A;  5LWE A;  2PP4 A;  1T5O A;  5HSW A;  4BJ5 A;  4EBK A;  1G4W R;  3SEO A;  4C7O B;  2VC9 A;  2BE5 F;  5KYU A;  1XME B;  2OOC A;  4A4M A;  4MTF A;  5DQT A;  5FZT A;  4A2N B;  4G71 B;  4GPO A;  4BEY A;  1IW7 F;  5B34 A;  1M56 C;  4Z9H A;  3M79 A;  1S8L A;  3LNM B;  1XWJ A;  2WL8 A;  1DOW A;  3QTH A;  2Y00 A;  1UAZ A;  1XIO A;  4HYX A;  4GP4 B;  1YJG A;  3ABL C;  1O0A A;  2KSA A;  3VAY A;  1GZM A;  4K0D A;  3POV A;  1KGB A;  3JRM O;  3RKO F;  3OWT A;  2KSY A;  1OW7 A;  3DJU B;  2D5R B;  3B71 A;  4BG0 A;  4J4Q A;  2J9U A;  4DVZ A;  3DQB A;  3NYJ A;  1NG1 A;  3S90 A;  4BJ5 C;  4WGY A;  4JTA B;  5FCL A;  1ORJ A;  3IPM O;  2H8A A;  1U89 A;  2I1X A;  2M4E A;  4MQ9 F;  2LQG A;  3CZ6 A;  5L3V A;  3ZTM A;  2HSQ A;  3ZQY A;  3S8F B;  5F5F A;  1JR8 A;  2I35 A;  3PXO A;  2DB4 A;  3E70 C;  1JV7 A;  3TJ5 A;  3MYI A;  3KMI A;  4DVY P;  1K05 A;  4XPW A;  3QVY A;  1Q0F A;  4CS8 C;  1X0I 1;  3QZC A;  4YL0 A;  3TOL A;  3T9O A;  4XQ1 A;  3LLK A;  2A0B A;  5FJG A;  2HFI A;  1L7C A;  2XLE A;  4C3E A;  256B A;  5F8U A;  1O5H A;  4ANJ A;  1FBB A;  1JPN A;  3DJN B;  2R7O A;  5JUA A;  2LCH A;  4AL1 A;  3L1M A;  4E0I A;  3EML A;  4JTC B;  2I21 A;  3B0U X;  5H2H A;  2PX3 A;  3VW7 A;  2P61 A;  4TL3 A;  2LSE A;  1T01 A;  5G54 A;  4CDV A;  4JEA A;  2NSF A;  2QTV A;  2L6G A;  5B6X A;  5JSL A;  2X51 A;  2YL7 A;  3V7O A;  2O9X A;  5EGY A;  3SXY A;  5JJN A;  1OKK A;  3C8G D;  3HLZ A;  3JYH A;  2PED A;  2QPD B;  5KKH A;  1B68 A;  3X3B A;  2NUT B;  1OXB A;  2HPY A;  4Y9H A;  1YDI A;  3EH5 B;  1E83 A;  4QID A;  2J46 A;  3HAQ A;  4JC7 A;  2L81 A;  2ETS A;  3GEH A;  3U5S A;  4PXK A;  1LPE A;  2R7Q A;  1GUE A;  1M0M A;  5EN0 A;  1YZC A;  3WAQ A;  2J0W A;  3M4B A;  3FAJ A;  1RCP A;  4JTD B;  3FDQ A;  2KQ9 A;  1J8M F;  4CJG A;  3PMR A;  4N4W A;  3IQT A;  4EBJ A;  2P0N A;  1I5N A;  2YDO A;  5COM A;  3EZI A;  4PAC A;  3ZG1 A;  3VI0 A;  1F88 A;  4X31 A;  1YLM A;  3MBG A;  4MVU A;  1VYI A;  4N6H A;  1F50 A;  1KTM A;  1K40 A;  1VB5 A;  4DRI B;  5KYU B;  3LNR A;  1W2W A;  3VM6 A;  2AT9 A;  2HZ8 A;  4HYJ A;  4AMJ A;  4NC3 A;  1G4U S;  5T3T A;  4E18 A;  3UZA A;  4IWB A;  4HFF B;  1M57 C;  1LE4 A;  2J45 A;  1YA7 O;  4J32 B;  3W2W A;  3EFO A;  1Q0G A;  3V5X A;  5AC5 A;  2ZD9 A;  2I20 A;  2XS8 A;  2CNW A;  1M2O A;  1FMV A;  3PWH A;  2I15 A;  3QBI A;  1YAR O;  2R9R B;  2ICW G;  1PCX A;  2P6V A;  2NTW A;  3C7J A;  3NS0 A;  4CSA A;  1KG8 A;  4MD2 A;  4CDA A;  3HAS A;  3SN6 R;  3UNG C;  3MBV A;  2V26 A;  2R4R A;  5H2I A;  4U5G A;  4PJL A;  4OV0 A;  3U3B A;  4WAB A;  2HMQ A;  3LS0 A;  3OE6 A;  1L9H A;  2XL6 A;  2XSE A;  3GM2 A;  4AMI A;  2RSE B;  1L3P A;  3RIP A;  1S05 A;  3GOR A;  3FXH A;  4JR8 A;  5B0W A;  1NBB A;  5AHZ A;  4XT1 A;  2HV6 A;  1XZP A;  2CYD A;  1FFT C;  2ZZL A;  2A6E F;  1ORY A;  4CSA C;  2Q7R A;  3GOD A;  4CS9 C;  3N2Z B;  3HAO A;  2R4S A;  4FBZ A;  3I5P A;  4U5B E;  1Y4C A;  2R7W A;  2ZIY A;  1JOG A;  3A9C A;  1QKP A;  5JVE A;  4I1O B;  5AC4 A;  1HZX A;  1BBH A;  3K66 A;  5B1B C;  3K6B A;  5TJ5 E;  2DI3 A;  2EIJ C;  4BJ1 A;  3CAX A;  3QW1 A;  1HW1 A;  1FBK A;  5AWZ A;  2NPU A;  1OCO C;  1VLT A;  4N06 A;  5E2Q A;  1BDJ B;  3AG1 C;  4DRJ B;  1TKN A;  2I8B A;  4CJO A;  3ZDL A;  2JX0 A;  4O6N A;  1H6G A;  5JP7 A;  3DWW A;  2LFD A;  2PBE A;  3S8G B;  2QNL A;  1R2N A;  1T9K A;  4EBB A;  2E87 A;  3NMJ A;  5L0I A;  3H2U A;  3R7C A;  2R05 A;  1YAU O;  3QDC A;  1ZVZ A;  4FX5 A;  2G87 A;  2W45 A;  5H2L A;  5COG A;  2J8W A;  2IYL D;  1Z6A A;  1OW6 A;  4I44 A;  4L35 A;  1HY5 A;  2GWW A;  2WVO A;  4G78 A;  4OIN F;  3K1I A;  5D91 A;  2XLO A;  2XLW A;  5EK0 A;  1TWG A;  3OEO A;  1A0B A;  1GS9 A;  5BUO A;  4PFP A;  3DXJ F;  4R32 A;  3U9M A;  1E86 A;  4DAJ A;  1M6T A;  3QJQ B;  1JFP A;  2AWY A;  3EPV A;  3NDB B;  2NUT A;  1BZ4 A;  1HE1 A;  5TGZ A;  3COD A;  1MMA A;  3B29 A;  4Z9J A;  3FHD A;  4XPY A;  1Z7Q c;  1CPQ A;  2EIM C;  1QKO A;  1H2S A;  1QZX A;  5CI9 A;  3GWL A;  3EFO B;  1OW8 A;  2DYR C;  5B35 A;  2EPL X;  1ZHY A;  4CS7 A;  1CGO A;  3DKA A;  1AT9 A;  2AP3 A;  4JUR I;  1H9T A;  4XEF A;  4G72 B;  3VVK A;  1LN6 A;  2WVN A;  3AG3 C;  3QJR B;  4Q5S F;  4DBQ A;  1MMN A;  3ZSU A;  4QI2 A;  3NYA A;  1JGJ A;  4HWL A;  3NY9 A;  2Q9A A;  2WZG A;  4K1O A;  3RYL A;  3T6B A;  2YEV A;  3IHU A;  5IY5 C;  1E12 A;  3VF0 A;  2BRD A;  4YT5 A;  3QAP A;  2Z73 A;  1H9G A;  5AZD A;  2OU6 A;  1D0Y A;  2YL3 A;  2VH3 A;  5DS5 A;  1QQ3 A;  3ZEV A;  4BWB A;  3ZVR A;  1TFK B;  5G53 A;  3NKD A;  1MND A;  4P9F A;  3DE8 A;  4JCZ A;  3RH3 A;  5CIV A;  3U8P A;  3OE9 A;  4ER9 A;  2ZXP A;  1S53 A;  5CI8 A;  3RW0 A;  3K7D A;  3T4R A;  4MVM A;  1VK5 A;  4HE8 D;  4UG2 A;  4PFO A;  4XPX A;  3EJN A;  1BRX A;  3C8G A;  4YN0 B;  1Y6D A;  2WJK A;  1R4T A;  3O39 A;  3HAN A;  5KYY A;  2JPU A;  5B2N A;  3KYI A;  4RBN A;  3B0V C;  2JAG A;  2R7S A;  1V4A A;  2R03 A;  4Z9I A;  1XZQ A;  2G3K A;  1PY6 A;  3F46 A;  1MMG A;  2HJ3 A;  4KNW A;  2MYS A;  1QVX A;  3S0X A;  3V2W A;  4YK5 A;  2WZL A;  4YL3 A;  3L0I A;  3L8J A;  2GDC A;  2QPE B;  2M64 A;  5B6Z A;  3ZPQ A;  4OIP F;  5T3W A;  1VOM A;  5B3I A;  3LES A;  3SYN A;  1BR4 A;  1S54 A;  1SF8 A;  3AJM A;  3M4C A;  4BJ6 A;  1RJ9 B;  2L9J A;  1VMA A;  1WAT A;  2B0H A;  1SYQ A;  1QLE C;  2L6H A;  4WJ0 A;  3AYN A;  1CWQ A;  4U9D A;  1YZA A;  3U9J A;  3C8Z A;  3AG4 C;  4G7Z F;  4BEM J;  5ITE A;  3S3C B;  3GAN A;  1F4Z A;  1AP9 A;  3PHF 2;  4FA7 B;  1PXS A;  1IW6 A;  1M0K A;  3ABW A;  3PDS A;  1CGM E;  2VB6 A;  4U5D E;  2G3V A;  4MD1 A;  3JCU Q;  2BL2 A;  4NQF A;  2Y3H A;  4H4K C;  3HNI A;  5B6W A;  4G0H A;  3AOU A;  4EIY A;  3EH1 A;  3VRC A;  1CPR A;  4U5E E;  5H2N A;  4YT8 A;  4O79 A;  3QJS B;  2OJE D;  3JZ0 A;  4CBE A;  4E7Z A;  2Y3D A;  1F1M A;  2H7V C;  3EHM A;  4LDO A;  3OE8 A;  5DHH A;  1N1C A;  3NSB A;  4F4B A;  3UGP A;  1D0X A;  3F47 A;  1ST6 A;  5A6K A;  3D4S A;  3HAP A;  2HV7 A;  2KYH A;  2R7U A;  1S52 A;  3P0G A;  4IJJ A;  5A45 A;  4NY3 A;  5ETZ A;  1ZW2 A;  1D1A A;  3T6G B;  2KSF A;  3UGO A;  5COF A;  1KG9 A;  1J8Y F;  4XEK A;  5A8E A;  5DYS A;  2X72 A;  4G7Q B;  2HUJ A;  5JT4 A;  2EIK C;  4KNF A;  4UHR A;  3N24 A;  4O6M A;  4Q7C A;  3J06 A;  3B0P A;  4D4N A;  3EG9 A;  5L0D A;  3U2L A;  3ZWI A;  3ASN C;  3G4X A;  2Z55 A;  4XTN A;  3W2V A;  3JT1 A;  3S9O A;  3CAP A;  3C63 A;  1I4Y A;  2LNL A;  1NSG B;  1FTS A;  3W4Y A;  1OXK A;  3QJT B;  2YKZ A;  3VHZ A;  4DBR A;  2IXO A;  5DS6 A;  1CGN A;  2NUP A;  1V55 C;  4GYT A;  2BC5 A;  4PJM A;  2Q9B A;  4JW1 A;  2RH1 A;  3LEO A;  5JJE A;  1BRD A;  2L6F A;  3S28 A;  2XLD A;  3UTX A;  4LDQ A;  2EPM X;  3C8G B;  4N4Y B;  3KJ6 A;  3NRH A;  4HEA J;  3WOD F;  4U5F E;  1RKE B;  5B1A C;  2HMZ A;  4MVS A; 
#chains in the Genus database with same CATH homology
 3NMJ A;  2YLI A;  4GPO A;  4BEY A;  1MQV A;  5B34 A;  3QDC A;  3M79 A;  1VJM A;  1L0M A;  1S8L A;  2G87 A;  5H2O A;  5H2L A;  1IW9 A;  2XLH A;  4GYC A;  1BM1 A;  1VGO A;  3ODU A;  1E85 A;  2J8W A;  1UAZ A;  2Y00 A;  4G70 B;  1XIO A;  4HYX A;  2YCY A;  5JS5 A;  4GP4 B;  3S3D B;  4L35 A;  1O0A A;  3UTW A;  2KSA A;  1GZM A;  2YLD A;  1KGB A;  4FAA B;  5G28 A;  4IAR A;  2KSY A;  3UTV A;  3AM6 A;  2Y03 A;  2XM4 A;  4J4Q A;  2XLO A;  2XLW A;  5B6V A;  1BRR A;  3DQB A;  4XTL A;  1E86 A;  1MGY A;  4DAJ A;  1M6T A;  3QJQ B;  1JFP A;  4WGY A;  4XT3 A;  3T45 A;  1E84 A;  4BV0 A;  1TN5 A;  1P8I A;  5C1M A;  5TGZ A;  3COD A;  3VG9 A;  1JV6 A;  1CPQ A;  5AX1 A;  1QKO A;  2I1X A;  1H2S A;  1C8S A;  3NY8 A;  3ZTM A;  3ZQY A;  3S3B B;  4JEB A;  4WAV A;  5B35 A;  3S8F B;  4MBS A;  3QBL A;  1C8R A;  2I35 A;  3ZTZ A;  1QPU A;  3PXO A;  1CGO A;  4LDE A;  1JV7 A;  5JRA A;  1AT9 A;  5ITC A;  3UON A;  1YYJ A;  3QVY A;  1X0I 1;  3QBK A;  4G72 B;  1UCQ A;  5G2C A;  3TOL A;  1TN0 A;  5H2K A;  3VVK A;  3X3C A;  1LN6 A;  3V2Y A;  3DE9 A;  5FJG A;  3QJR B;  2XLE A;  1JAF A;  5H2J A;  256B A;  4LDL A;  5F8U A;  1A7V A;  2YCW A;  1APC A;  1FBB A;  3NYA A;  1JGJ A;  4HWL A;  3NY9 A;  5JUA A;  3L1M A;  2L6X A;  3EML A;  1Q5I A;  1QM8 A;  3A7K A;  2I21 A;  5G2D A;  5H2H A;  1E12 A;  3VW7 A;  2BRD A;  2XLM A;  3QAP A;  1R84 A;  4FPD A;  2Z73 A;  4TL3 A;  5AZD A;  5G54 A;  2M3G A;  4CDV A;  4JEA A;  2YL3 A;  1EKY A;  1QQ3 A;  3ZEV A;  4BWB A;  3QJV B;  1KME A;  5G53 A;  4EA3 A;  4KLY A;  5JSL A;  5B6X A;  1S8J A;  2YL7 A;  3DE8 A;  1LM3 B;  4MQS A;  5JJN A;  5BR5 A;  3WQJ A;  3EH4 B;  3U8P A;  2QPD B;  2PED A;  3OE9 A;  4G7R B;  5KKH A;  4ER9 A;  5AX0 A;  1S53 A;  3X3B A;  2HPY A;  4Y9H A;  3EH5 B;  1E83 A;  4QID A;  3HAQ A;  4BUO A;  4UG2 A;  2F95 A;  1BRX A;  4XXJ A;  4IAQ A;  2F93 A;  4PXK A;  1E0P A;  1GUE A;  5H2P A;  1M0M A;  5EN0 A;  4PXF A;  2WJK A;  4CIP A;  1YZC A;  3M4B A;  2XL8 A;  4CDY A;  2J4Y A;  3M15 A;  1RCP A;  3HAN A;  5B2N A;  2JAF A;  4X1H A;  2JAG A;  4ULV A;  4CJG A;  2Y02 A;  4N4W A;  3OAX A;  3QBG A;  5J7A A;  1X0K 1;  2YDO A;  1PY6 A;  4BEZ A;  3DDL A;  3V2W A;  2YDV A;  1X0S A;  4QI1 A;  3UZC A;  3VI0 A;  1F88 A;  4G7S B;  4X31 A;  3C9L A;  2QLA A;  2QPE B;  4N6H A;  4D4X A;  3QVZ A;  5B6Z A;  3ZPQ A;  3PBL A;  1F50 A;  5B3I A;  2AT9 A;  1S54 A;  2XLV A;  3M4C A;  4HYJ A;  5G2A A;  4AMJ A;  4NC3 A;  5H2M A;  3REY A;  1YYX A;  3AYN A;  1CWQ A;  4U9D A;  1PXR A;  1YZA A;  3UZA A;  4WW3 A;  1P8H A;  1U19 A;  4DKL A;  4IB4 A;  2VT4 A;  3FOO A;  3HNJ A;  2YLG A;  5ITE A;  3S3C B;  1F4Z A;  1AP9 A;  2Y04 A;  2YCZ A;  2I20 A;  4MQT A;  4FA7 B;  1PXS A;  1IW6 A;  1DZE A;  1M0K A;  3ABW A;  3EH3 B;  3PDS A;  4CX9 A;  3COC A;  3PWH A;  3UG9 A;  5AGF A;  3QBI A;  4MD1 A;  2NTW A;  3NS0 A;  3HNI A;  5B6W A;  1KG8 A;  4MD2 A;  5DHG A;  4CDA A;  4EIY A;  3HAR A;  3HAS A;  3VRC A;  3SN6 R;  3AYM A;  1CPR A;  3QW0 A;  3MBV A;  5H2N A;  2R4R A;  3QJS B;  5H2I A;  4EJ4 A;  4X32 A;  4LDO A;  4OV0 A;  2XM0 A;  5A44 A;  3OE8 A;  5DHH A;  2J9B A;  4XTO A;  3NSB A;  3UTY A;  1P8U A;  1S51 A;  2YL1 A;  1IXF A;  3NMI A;  3NMK A;  1L9H A;  3OE6 A;  1GU8 A;  2XL6 A;  4JE9 A;  4AMI A;  3TOM A;  2KSB A;  1S05 A;  1Q5J A;  3D4S A;  4JKV A;  3HAP A;  3IQ6 A;  4QRY A;  4BVN A;  4GRV A;  4JQ6 A;  4JR8 A;  5B0W A;  3BVD B;  1S52 A;  1NBB A;  3P0G A;  5AHZ A;  5B6Y A;  5A45 A;  1XJI A;  5G36 A;  5ETZ A;  4XT1 A;  5JLI A;  3ZQV A;  1EHK B;  3OE0 A;  1KG9 A;  3FOP A;  3RZE A;  2ZZL A;  3HNL A;  3ZPR A;  4DJH A;  5DYS A;  3QAK A;  5A8E A;  2X72 A;  4G7Q B;  5JT4 A;  2WJL A;  4KNF A;  5AHY A;  4UHR A;  4K5Y A;  3QJU B;  4D4N A;  3C9M A;  1M0L A;  5JJJ A;  3HAO A;  2R4S A;  4FBZ A;  3ZWI A;  2ZIY A;  2Z55 A;  4XTN A;  5BR2 A;  1C3W A;  4WGZ A;  5JVE A;  4U9E A;  1QKP A;  3CAP A;  3C63 A;  4DS7 E;  3PQR A;  2CCY A;  1HZX A;  1BBH A;  2LNL A;  4GBR A;  3QJT B;  3VHZ A;  2YKZ A;  1QHJ A;  2EI4 A;  3QW1 A;  1CGN A;  2KS9 A;  1H68 A;  1GQA A;  1FBK A;  5AWZ A;  2YL0 A;  2BC5 A;  5LWE A;  3IQ5 A;  4L6R A;  2RH1 A;  3C62 A;  3RFM A;  4GP8 B;  2NTU A;  5JJE A;  1BRD A;  2XLD A;  4CJO A;  2YCX A;  3UTX A;  3VGA A;  1XME B;  4N4Y B;  3KJ6 A;  5JP7 A;  4A4M A;  2ZFE A;  2Y01 A;  4GP5 B;  3S8G B;  1R2N A;  4G71 B;  3HNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...