4N6HA

1.8 a structure of the human delta opioid 7tm receptor (psi community target)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
408
structure length
408
Chain Sequence
DLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Soluble cytochrome b562, Delta-type opioid receptor chimeric
publication title Molecular control of delta-opioid receptor signalling.
pubmed doi rcsb
source organism Escherichia coli
total genus 175
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2013-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n6hA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n6hA02
2L6XA 1S54A 1CPQA 1S51A 5G2DA 1H68A 1MQVA 3VW7A 1F88A 2YCWA 4K5YA 4FPDA 3QAPA 5LWEA 1S05A 1C3WA 5TGZA 1PXSA 3NMJA 3TOLA 5H2JA 2XL8A 4L6RA 4LDLA 2YKZA 5B35A 1IW6A 1M0MA 3HAOA 1LM3B 2XL6A 2BC5A 1BRDA 3TOMA 5ITCA 5JUAA 3U8PA 5H2IA 3X3CA 1PXRA 3QW1A 3M4CA 3QDCA 4OV0A 2J8WA 5DYSA 2YCYA 3WQJA 5B6ZA 1X0I1 2YL1A 2QPDB 3EH5B 3VI0A 3X3BA 4GRVA 4CDAA 5AX0A 4G7SB 1KGBA 1BM1A 1UAZA 3HASA 4J4QA 1CPRA 4WGYA 2QLAA 4BVNA 1IW9A 5G2CA 3PWHA 4D4XA 4CJGA 2KSAA 3QBKA 3QVYA 3QJSB 4XTLA 1NBBA 3PXOA 4HYJA 4PXFA 4MD1A 4JR8A 2YDOA 3MBVA 4IB4A 3OE9A 4LDEA 5B2NA 4CJOA 2JAFA 1U19A 4U9EA 5AGFA 3HAPA 1GQAA 2R4SA 4GP4B 4CIPA 1UCQA 3DDLA 3DE9A 1PY6A 2I35A 3NMKA 2YL3A 1JGJA 3HARA 3NMIA 2YLDA 3QJRB 1YZAA 1X0SA 2PEDA 5JS5A 3ZQYA 2CCYA 4G72B 3ZEVA 2XLOA 2EI4A 3S8GB 3HNLA 4G70B 1L9HA 1RCPA 4HYXA 2YDVA 4N4WA 2XLHA 1AP9A 1R84A 3UTYA 1BRRA 1EHKB 3P0GA 3UZCA 5A8EA 1C8RA 2XLDA 3D4SA 2J9BA 5BR2A 4DKLA 4KLYA 3DE8A 3AM6A 5DHHA 4NC3A 4FAAB 2HPYA 2Y03A 1E85A 3HNIA 5JJNA 3QBGA 3UTXA 1CWQA 4N4YB 5B6WA 2Y04A 5H2MA 2LNLA 5ETZA 4QI1A 5G36A 3BVDB 1S8JA 2ZZLA 3C63A 5F8UA 3NYAA 4MQSA 4IARA 3ZTMA 4X32A 2I1XA 2JAGA 2F93A 3IQ6A 3DQBA 5J7AA 3EH3B 3AYMA 1AT9A 4JKVA 2YLGA 4G7RB 5JLIA 3FOPA 3VRCA 5JVEA 4DJHA 3EMLA 1F50A 4JEBA 3ZTZA 4GP8B 2NTWA 1L0MA 1BBHA 3OE8A 4CX9A 3C62A 3S3CB 2YCXA 1E84A 1CGNA 2XM4A 3PDSA 4BV0A 2M3GA 4XT3A 4KNFA 2KSYA 1JV7A 2Z73A 4QIDA 4FA7B 1QPUA 1YZCA 1Q5IA 4FBZA 1HZXA 5JT4A 3M15A 1QKOA 2Y00A 5B6VA 5A44A 5ITEA 2F95A 3C9LA 4WW3A 5B3IA 1GUEA 4WAVA 3QBLA 4MD2A 2XLVA 2BRDA 3NY9A 4WGZA 1GU8A 5FJGA 2J4YA 1APCA 1R2NA 4QRYA 1M6TA 2I21A 3COCA 3QJTB 2KS9A 3NY8A 1KG8A 1O0AA 1VGOA 3OE0A 4LDOA 1MGYA 4BUOA 1BRXA 1KG9A 5C1MA 4ER9A 4N6HA 3UTWA 1QKPA 5A45A 5H2PA 5KKHA 5DHGA 3M4BA 5JSLA 4AMJA 4IAQA 1YYXA 3FOOA 3EH4B 3REYA 3ABWA 3A7KA 4BWBA 1XIOA 5JJEA 5AWZA 5BR5A 2ZIYA 3CAPA 4X31A 4DAJA 4MBSA 4A4MA 3VVKA 3AYNA 3OE6A 1XJIA 1A7VA 3QBIA 3KJ6A 5H2NA 2XLWA 1IXFA 1KMEA 4BEYA 2WJKA 1QQ3A 4CDVA 1H2SA 2NTUA 3L1MA 3QAKA 1QHJA 1JAFA 4HWLA 1F4ZA 1QM8A 3ZWIA 5JP7A 3QJQB 3OAXA 4XXJA 5AX1A 3SN6R 3UG9A 2YL7A 4EA3A 3ODUA 2RH1A 1GZMA 3NS0A 4JQ6A 4L35A 5AZDA 2ZFEA 3V2WA 2AT9A 4GPOA 4U9DA 2KSBA 1JFPA 1S52A 5JJJA 1Q5JA 4G7QB 3VHZA 3CODA 3NSBA 1JV6A 3IQ5A 4XT1A 3HNJA 4XTNA 4JE9A 4G71B 3RZEA 2G87A 4BEZA 3HANA 5B0WA 1S8LA 5B34A 3C9MA 1YYJA 3V2YA 2VT4A 1S53A 3UTVA 4PXKA 1E12A 2XLMA 3S8FB 5H2HA 1EKYA 5EN0A 2Y02A 4TL3A 2XM0A 3UONA 1E86A 1M0LA 4Y9HA 3QJVB 3VGAA 1TN5A 4UHRA 3QVZA 1TN0A 2X72A 1E0PA 2XLEA 3QJUB 256BA 1VJMA 4EJ4A 3RFMA 5AHYA 5AHZA 2YL0A 2R4RA 1XMEB 2YLIA 1DZEA 5JRAA 1E83A 5H2LA 4UG2A 4AMIA 1LN6A 3ZPQA 1CGOA 1FBKA 2I20A 1P8UA 4EIYA 3VG9A 5B6XA 3T45A 4CDYA 5H2OA 2Z55A 3PBLA 1M0KA 4GYCA 3ZQVA 3HNKA 3S3BB 4X1HA 5G54A 4XTOA 4ULVA 4GP5B 1P8HA 4MQTA 3PQRA 4GBRA 3S3DB 1FBBA 3QW0A 2WJLA 4D4NA 4JEAA 3HAQA 2QPEB 5G2AA 5H2KA 5G28A 1P8IA 2YCZA 1C8SA 3M79A 2Y01A 5G53A 1X0K1 3UZAA 3ZPRA 5B6YA
chains in the Genus database with same CATH superfamily
3EG9B 3VW7A 4O79A 4K1OA 2Q7RA 4K5YA 2P1AA 3Q6MA 1VLTA 3LAYA 1XZPA 2DYRC 2VH3A 4BJ5A 2G3KA 5H2JA 4LDLA 2YKZA 4DRJB 3TULA 2GAQA 1M0MA 2XSEA 2WVQA 5E3AA 1GGQA 2MHRA 4JJFA 1D0XA 5H2IA 4OV0A 5E2QA 1VK5A 3DAGA 2YWAA 5DYSA 1WN0A 2R9RB 1M2VA 1HE9A 1SYQA 2QE9A 1Q0FA 3X3BA 4GRVA 2VCBA 2IXOA 2XL4A 2O9XA 1IW9A 4LDRA 5G2CA 2PNOA 4E0HA 1U0BB 1CGME 1AUEA 4NQFA 1WASA 3OE9A 5B2NA 1OW7A 1G8XA 4U9EA 2LFFA 2XXAA 1FFTC 2I35A 3DM9B 1T5OA 2R7QA 4JTCB 1JGJA 2YEVA 1YDIA 2DGJA 1VTMP 4FESA 2J0WA 3AJMA 5JS5A 3ZQYA 2C04A 3HNLA 1L9HA 4C3BA 4P6IC 5D91A 2VB6A 2YDVA 4O6MA 2XLHA 2J9UA 2A0UA 4BJTA 4PJJA 3P0GA 5DS6A 5F5FA 5A8EA 2XLDA 2J9BA 4DKLA 3VYWA 4KLYA 4HFKB 1B68A 3S90A 4NTAA 3CZ6A 2R7SA 2Y03A 1E85A 3QBGA 1R5ID 5DS5A 4N4YB 5B6WA 5A6AA 2LNLA 4QI1A 5G36A 1FAPB 3BVDB 1S8JA 3C63A 3EFOA 3VAYA 3ZTMA 4M63A 2I1XA 2DB4A 3ITFA 4G0HA 2JAGA 4K0DA 4U5EE 1UG7A 4EBBA 4PJLA 3LNRA 3EH3B 4JKVA 2HMZA 4WJ0A 4FAPB 4YJWA 2Y69C 3ECSA 3EMLA 1HW1A 4GP8B 2ICWG 3H2UA 2NTWA 2G3VA 5A6BA 1L0MA 1JPNA 3SP1A 1MMAA 1U89A 1E84A 1A0BA 3PDSA 2NUPA 4BV0A 3GM3A 3C18A 3EQLF 4MQ9F 2WZFA 3K33A 4FA7B 1Q5IA 4O6NA 1HZXA 3M15A 3S29A 3DZAA 1D1BA 5B6VA 5A44A 5ITEA 2F95A 1HMDA 5L0DA 2X0CA 3NY9A 4DBRA 5T3TA 2J4YA 1NG1A 1F1MA 1FNTc 2KS9A 1KG8A 1O0AA 1MGYA 4BUOA 1BRXA 3EGDA 4C7OA 1YA7O 4CSAA 2CDQA 4GQHA 4ER9A 3FAPB 1QKPA 1YJGA 2NPUA 3DMDA 1TWAA 3M4BA 4AMJA 4IAQA 2NSFA 2W45A 3FAJA 1XIOA 5AWZA 5BR5A 3CAPA 4U5DE 4MBSA 4A4MA 4KI2A 1RKEA 3AYNA 1O87A 3OE6A 3U2LA 3VVKA 1XJIA 1FMVA 1SMYF 2I8BA 2XLWA 2OQMA 4DBQA 1KMEA 2ZPAA 2WJKA 1SR2A 1ORJA 4MW8A 1RJ9A 1H2SA 3RVZA 1JAFA 4KC9A 1TQGA 3G50A 3AG4C 3NRHA 1F4ZA 1LI5A 4YT4A 2XXAB 2XS8A 5DQZA 2YL7A 4EA3A 2RH1A 4U5BE 1WWPA 3OA1A 4AK9A 2TMVP 5A6JA 2R25A 1Q5JA 3VHZA 3G4XA 1RMVA 1JV6A 3IQ5A 4BEJA 1H7IA 4I1MA 4FWVA 4QI2A 3RZEA 3US6A 1EA8A 4BEZA 5E33A 3HANA 2GFHA 5CI8A 3A9CA 1BR4A 2UUIA 4U5GA 1YLMA 1NU9C 4E0IA 3S8FB 5BQHA 5H2HA 3W2VA 3O39A 4I44A 1VB5A 2NG1A 3QJVB 4ZLCA 2Q3TA 2XLEA 2RSEB 4AX2A 1ZVZA 2CGEA 1M2OA 1XWJA 4OD5A 3DD7A 3QZCA 3S28A 1LN6A 2PP4A 5H2OA 1M0KA 4EBJA 2H7BA 4E18A 2L9JA 4NTBA 4XTOA 4ULVA 4MQTA 4GBRA 2LP4A 3ASOC 2WJLA 1Y6DA 3O6XA 4JCHA 3CSKA 4J32B 5H2KA 2R7TA 2Y01A 1I4ZA 3UZAA 1JPJA 4AE4B 3H65A 2OEXA 1OW8A 3EGXA 3PCVA 4W8KA 5G2DA 3MX3A 1H68A 1F88A 2YRFA 2YCWA 5KYWB 4X0RA 5KYYB 3ZC4A 3QAPA 4DRHB 1C3WA 2KJGA 2KGOA 3C8ZA 1G5ZA 1PXSA 3EZIA 2P0NA 3VM6A 5B35A 1IW6A 2DYSC 3HAOA 2IBFA 2VCCA 2IXNA 3EJNA 2KK1A 3J06A 3X3CA 3DJNB 3NYLA 1BR2A 4U5CE 4KNWA 1OCZC 2W4BA 2J8WA 1T6QA 3ATPA 2YCYA 3WQJA 2D5RB 2YL1A 2QPDB 3EH5B 3VI0A 4G7HF 3LNMB 1RKEB 5AX0A 2R02A 3DI5A 2OG2A 4G7SB 1IW7F 3MLGA 1BM1A 3RQFA 4J4QA 1CPRA 1K04A 2CW0F 3PWHA 4BJ1A 1O3UA 3AG3C 5CIVA 3B29A 4YL3A 1M56C 1OXBA 3QVYA 1RJ9B 3PXOA 4HYJA 2IXMA 4MD1A 3B0VC 4O7GA 5K0IA 4E7SA 3V5YA 3N24A 4LDEA 4U5FE 4DOZA 4JW1A 3U2MA 2JAFA 1U19A 5AGFA 3TJ5A 1HE1A 4CIPA 1UCQA 1MNDA 4JZAA 1MMDA 3F46A 1PY6A 3AGUA 2YL3A 2A69F 4OIRF 4CS8C 3NMIA 2YLDA 4MVRA 4WABA 1EI7A 3T9OA 4ULWA 2WZLA 1G4US 3KKBA 3PHF2 1PD0A 1NU7D 2WB7A 2AU5A 4HYXA 4N4WA 3A11A 4YT8A 3B9QA 3UZCA 2LQGA 1FFHA 3KMIA 3EPVA 4J7TA 2EPMX 2J45A 2ETSA 4NC3A 4FAAB 1ZW2A 4PFPA 3O55A 3HNIA 3UTXA 2HV7A 3RF3A 3FMSA 5ETZA 4H54A 1ZZPA 4BJ6C 2ZZLA 1ZU4A 1AEPA 5F8UA 1I4YA 3NYAA 4IARA 1V55C 1TKNA 1NFNA 2LCHA 1D1CA 3IQ6A 3MFNA 3DQBA 4GEHA 1AT9A 4G7RB 2EIKC 2LFDA 3FOPA 3LS0A 3VRCA 1H9TA 4OINF 4PACA 4OIOF 1T6IA 4Q4ZF 1LPEA 5AC4A 3DXJF 4QI0A 3S3CB 2WL8A 3JZ0A 5EK0A 4OIQF 4YT5A 4LDKA 2OJQA 2EPLX 3JSEO 2R05A 5HSWA 2KSYA 2R7UA 3DAFA 4MTFA 2L6GA 3KL4A 2Z73A 4QIDA 1QPUA 2FAPB 4ONSA 3LS1A 4FBZA 5JT4A 4E17A 1QKOA 2HKVA 3C9LA 3MYFA 4WW3A 3EGXB 1OKKD 3QBLA 1GU8A 5FJGA 4G7OF 1QSPA 3I4UA 3ABMC 1OCCC 1Q0KA 2I21A 3COCA 3QJTB 2KNHA 1E2XA 3IEEA 2MYSA 3OEOA 1N1CA 3T6GB 3MYIA 1LVKA 5C1MA 1MMGA 2EILC 3T6BA 1PV3A 5KKHA 3WAQA 1YAUO 5DS4A 3FOOA 3V7OA 1Q0DA 3REYA 4XTKA 3A7KA 3T4RA 5JJEA 3I5QA 3SXMA 2HSBA 4X31A 4LLCA 5KYNA 2HUJA 4EHPA 4CS9C 3KJ6A 5H2NA 1DOVA 1QQ3A 2NTUA 2HSQA 4PJMA 3QAKA 4J30B 3HLZA 3W4YA 1QM8A 3ZWIA 4RDAA 2NUTA 2H7OA 4XEKA 5AX1A 2AP3A 3L0IA 3ODUA 3FDQA 4JQ6A 2D4UA 1Z5ZA 2KW3C 4U9DA 1JFPA 4G7QB 1OW6A 3JSZA 5L0HA 3NSBA 2OKUA 3LEVA 2L6FA 2X51A 3K1IC 4XTNA 4JE9A 1ZYRF 3EZHA 4IRUA 1V54C 1Y4CA 4YL0A 3CAXA 3GWNA 3GANA 4NCQA 4NY3A 2Y3DA 3LLIA 3NDBB 1LE4A 2J9WA 1OQCA 4TL3A 2XM0A 2OCCC 4JJGA 4DJ9A 3UMKA 3VGAA 4UHRA 3ZG1A 1T6UA 4XPYA 2X72A 5KYUA 2FFHA 1E0PA 1ST6A 2MWQA 1OR3A 1VJMA 3GODA 3U8VA 5AHZA 4MVSA 5JRAA 1E83A 3BEHA 1HW2A 5H2LA 1Z63A 4AMIA 3AQBA 3TD7A 3K7DA 2J7PA 3ZPQA 2I20A 4EIYA 2CNWA 4MNDA 3VG9A 3VF0A 1M2VB 4YT2A 4GYCA 2IOQA 2ZXRA 4AL1A 3S3BB 1BDJB 5TJ5E 1P8HA 5A6BD 3UMHA 1C02A 3S3DB 5G2AA 1VOMA 3SZRA 4MTOA 3GM2A 1C8SA 3M79A 5G53A 1X0K1 5B1AC 2VC9A 1S54A 3CEXA 1S51A 1HMOA 3K1HA 3AGTA 2YVKA 3UGPA 3X2QC 4DVYP 5LWEA 2A0BA 2RD9A 1S05A 4XWJA 4CIHA 1KTMA 5TGZA 3NMJA 3TOLA 3KYIA 1L7CA 2XL8A 4L6RA 4I3MA 1LM3B 2XL6A 1BRDA 4PJNA 3TOMA 1QLEC 5JUAA 3U8PA 4CS8A 3QDCA 5KYXA 3LESA 1EQ1A 5FCLA 1Q0GA 1C03A 2HS5A 3EH2A 5EGYA 4HE8D 5L0IA 4F4BA 4YK5A 3FVYA 5AC5A 4XLNF 1KGBA 2OEVA 2AVKA 4BVNA 3RKOF 1NLXA 3NYJA 2PF4E 2KSAA 2GWWA 2FGYA 5IY5C 3QBKA 1C17M 1VMAA 3R2PA 1ZHTA 4PXFA 3EFOB 4OD4A 1MNEA 4JVSA 2B0HA 2YDOA 4J7YA 3AOUA 4IB4A 4QDLA 3RIPA 3GEIA 3DKAA 4JRZA 3KYJA 2M64A 1OCOC 3JYYA 2R4SA 4GP4B 4G7ZF 3SNHA 3EG9A 3DDLA 3DE9A 2EIMC 3NMKA 3UGOA 5DQTA 3IHUA 1X0SA 2Y3BA 1OXKA 2EPKX 1ZHWA 2IXPA 3V5XA 3IPMO 2Q9AA 2XLOA 5FZTA 3B0PA 2EI4A 2PFDA 3S8GB 2NUPB 4G70B 2W9YA 3HKKA 1AP9A 1R84A 3UTYA 3Q6NA 1BRRA 1EHKB 3PMRA 1BZ4A 3RYLA 4LLEA 5T3WA 2OU6A 3D4SA 2Q9BA 3DE8A 3AM6A 2AWYA 5L3VA 2L7AA 5JJNA 1DOWA 2ASRA 1CWQA 3RVYA 3LJBA 4X32A 1V74B 2YQYA 3EGDB 4C7OB 5J7AA 1S7ZA 1ZHXA 3F47A 3AYMA 2V3CC 3E70C 5JLIA 2HJMA 2I15A 3Q7LA 5JVEA 4DJHA 1WGWA 1F50A 3K6BA 4JEBA 3ZTZA 3S0XA 4Q5SF 4MTGA 3POVA 2YCXA 3N0TA 4I1OB 4LACB 2A6HF 4MVUA 2XM4A 2LIGA 4R32A 5CI9A 2M3GA 3M1CB 4XT3A 3PDMP 2HJ3A 2Y3HA 2L81A 1JV7A 2H8AA 1Z3IX 1A41A 1ZHYA 1BR1A 3L34A 4XLPF 1NSGB 4LERA 1GUEA 4MD2A 3GEEA 2XLVA 4WGZA 3Q7GA 1R2NA 2J0XA 1M6TA 2R03A 1OR2A 3NY8A 1SF8A 4HEAJ 5L0CA 4U5HA 4YWQA 4MVMA 4LDOA 1Z7Qc 3G4ZA 1KG9A 2J46A 4MS2A 4DXWA 3JT1A 2VASA 4KBLA 2QTVA 3AG1C 5DHGA 5JSLA 1YYXA 1JR8A 1FMWA 3L8IA 3GM1A 3EH4B 3GEHA 3ABWA 2IM8A 4RD9A 4DAJA 1V4AA 1VYKA 3N2ZB 1A7VA 1WOLA 4N6CA 1TWGA 3QBIA 4DVZA 3LUTB 4CBEA 3V5ZA 1IXFA 2J9VA 2OOCA 3L1MA 1QHJA 3AG2C 1VYIA 5COGA 4HWLA 5JP7A 2EPOA 1TR2A 3QJQB 4XXJA 3SN6R 5GPGB 3HJCA 1GZMA 2UUHA 5AZDA 4UDVA 2ZFEA 1LKXA 2BE5F 3I5PA 1ORSC 4DRIB 2WVOA 2HMQA 4XEVA 2KSBA 1S52A 5JJJA 3E9VA 2AWCA 3CQZA 4XT1A 4JC7A 1WTYA 1L3PA 4G71B 2G87A 3LLKA 3TQOA 3C9MA 3WODF 3V2YA 4GYTA 2V26A 1S53A 3UTVA 1TFOB 3RW0A 2Q4FA 4C3DA 1EKYA 2Y02A 5B1BC 3UONA 2YZSA 2EINC 1IZMA 1M0LA 3T6JA 4XPWA 2G62A 2XS1A 2KC3A 1LIHA 4MW3A 3QVZA 2ZXOA 2XRHA 256BA 3SEOA 3RFMA 2QUPA 5AHYA 1XMEB 3SXKA 3QMKA 3TK0A 2QNLA 4A2NB 1LS4A 2B0JA 2HFIA 5L0GA 1CGOA 1FBKA 1LS1A 1P8UA 2CYDA 4P9FA 3W2WA 3T45A 3JYHA 2Z55A 3PBLA 3ZQVA 3HNKA 4LDQA 3NG1A 3JRMO 4GP5B 5L0JA 5L3QA 5COFA 2DI3A 2M4EA 2PBEA 1FBBA 3QW0A 3HAQA 2W4MA 1A7DA 3ABLC 2Z15A 1ZW3A 1G4WR 1QZXA 5G28A 2YCZA 4FX5A 2EPNA 4BPMA 3SYNA 3QTHA 2L6XA 5DVWA 3S27A 4OIPF 1CPQA 3JRTA 1PCXA 1MQVA 2Y3GA 4KNVA 4H4KC 3O10A 4FPDA 2PX3A 4B6IA 3IQCA 5BQGA 2KQ9A 3OWTA 3AQCA 2P7VA 2BC5A 1TWCA 5ITCA 3UMIA 3WHNA 3IQTA 1PXRA 3QW1A 3M4CA 3KH2A 3NKDA 5HV9A 5B6ZA 2OJED 1X0I1 3UR3C 4IGGA 1K05A 3W8IA 4CDAA 1Q0MA 5EHHA 1UAZA 3HASA 3S84A 1OCRC 4WGYA 2QLAA 3C8GA 4IWBA 2H7VC 1R4TA 4D4XA 1SZIA 4CJGA 4C3EA 3QJSB 4XTLA 1NBBA 1YA9A 5B3SC 4JR8A 2C03A 3MBVA 4BJ5C 4BEMJ 5DLJA 4CJOA 4AE4A 4YL1A 3HAPA 1GQAA 2ZD9A 2R7XA 2KSFA 4JTAB 1NFOA 3KPHA 5A6KA 5KYWA 5KYYA 2BL2A 3HARA 4EKWA 4Q7CA 3QJRB 1YZAA 2GA0A 2A6EF 2PEDA 5BQIA 3RFYA 3B0UX 1TFKB 2CCYA 4G72B 3ZEVA 4EWCA 2LSEA 1VLSA 3U9MA 3JCUQ 4NTFA 5A69A 1RCPA 3DWWA 1T9KA 2LD6A 2Q9CA 4W8PA 4XEFA 3H2VA 1K40A 3U3FA 1C8RA 4Z9JA 2Q00A 5BR2A 3RH3A 3FXHA 3ZDLA 5DHHA 1Z6AA 4HFFB 2HPYA 3W8HA 2Y04A 5H2MA 3EHNA 3WG7C 2QY9A 3C8GD 1M57C 3DM5A 4MQSA 1D0ZA 1RKCA 2F93A 1U6HA 2LK4A 3ZVRA 2YLGA 2IYLD 3ZSUA 5BUOA 2R7RA 4Z9HA 4PK4A 2ZXWC 1BBHA 4PR9A 3OE8A 4CX9A 1ZU5A 2J7PD 3C62A 1Z23A 2R7VA 1YARO 1CGNA 2CNWD 4YN0B 1JOGA 1D1AA 4IJJA 4KNFA 1AVOB 4G78A 3HTKC 2R7WA 4JTDB 1YZCA 4RBNA 4CS7A 1UFBA 2Y39A 2Y00A 2NUTB 5B3IA 3UNGC 1J8MF 4WAVA 2BRDA 1A7EA 4XPXA 2L6HA 1APCA 4QRYA 4BJ6A 5T1DB 1VGOA 3S9OA 4MVQA 2ZXPA 3OE0A 4P9TA 1GM5A 3RQGA 1JMWA 2P61A 4N6HA 3UTWA 1LE2A 1I5NA 5A45A 5H2PA 2KYHA 2E87A 5COMA 4BWBA 3U3BA 3ZIBA 2ZIYA 3NKEA 1GS9A 4MVOA 2YHSA 3C8GB 1O5HA 3ASNC 1TWHA 4BEYA 4K7BA 5E3CA 4JCZA 1QVXA 3L8JA 4CDVA 1LI7A 3B71A 1ZHZA 5KYUB 4Z9IA 3EH1A 1NZEA 3X1OA 1D0YA 3C7JA 2A68F 3RQEA 3OAXA 4DS7E 4E7ZA 3U9JA 4CSAC 3UG9A 4PFOA 4EUKB 3NS0A 3U0CA 4L35A 3V2WA 2AT9A 4GPOA 2GDCA 4MVZA 4BG0A 3K66A 3CODA 3NYMA 2R7OA 3HNJA 1FR0A 2A1DD 1KNYA 5F28E 4EBKA 5B0WA 2HV6A 2JD3A 1S8LA 5B34A 1RXQA 1YYJA 4N06A 4XQ1A 3LEOA 2VT4A 1KU2A 1MMNA 4AL0A 4PXKA 1E12A 2XLMA 3R7CA 5F5HA 2HZ8A 5EN0A 4ANJA 3GWLA 4CS9A 1E86A 2PX0A 4Y9HA 1H9GA 1WATA 1XZQA 3U5SA 1ORYA 1TN5A 2JPUA 4A4AA 4IAOA 2P6VA 1TN0A 3DJUB 3QJUB 3EHMA 4EJ4A 3SXZA 2YL0A 2R4RA 3GORA 3TJ6A 2YLIA 4JURI 1DZEA 3JTLO 1QKRA 4UG2A 2NSGA 1HY5A 2EIJC 1J8YF 1PD1A 5KYXB 1H6GA 3ABKC 5D92A 5B6XA 4JIOA 4CDYA 1JRAA 3K1IA 4X1HA 5G54A 2JX0A 3BRJA 1T01A 1W2WA 2WVNA 3PQRA 4ZLDA 2F22A 4D4NA 4JEAA 2QPEB 2VCAA 3MBGA 1YVIA 1OKKA 1P8IA 3SXYA 5L0FA 4O6YA 2WZGA 3ZPRA 3FHDA 5B6YA 1FTSA
chains in the Genus database with same CATH topology
2L6XA 1S54A 1CPQA 1S51A 5G2DA 1H68A 1MQVA 3VW7A 1F88A 2YCWA 4K5YA 4FPDA 3QAPA 5LWEA 1S05A 1C3WA 5TGZA 1PXSA 3NMJA 3TOLA 5H2JA 2XL8A 4L6RA 4LDLA 2YKZA 5B35A 1IW6A 1M0MA 3HAOA 1LM3B 2XL6A 2BC5A 1BRDA 3TOMA 5ITCA 5JUAA 3U8PA 5H2IA 3X3CA 1PXRA 3QW1A 3M4CA 3QDCA 4OV0A 2J8WA 5DYSA 2YCYA 3WQJA 5B6ZA 1X0I1 2YL1A 2QPDB 3EH5B 3VI0A 3X3BA 4GRVA 4CDAA 5AX0A 4G7SB 1KGBA 1BM1A 1UAZA 3HASA 4J4QA 1CPRA 4WGYA 2QLAA 4BVNA 1IW9A 5G2CA 3PWHA 4D4XA 4CJGA 2KSAA 3QBKA 3QVYA 3QJSB 4XTLA 1NBBA 3PXOA 4HYJA 4PXFA 4MD1A 4JR8A 2YDOA 3MBVA 4IB4A 3OE9A 4LDEA 5B2NA 4CJOA 2JAFA 1U19A 4U9EA 5AGFA 3HAPA 1GQAA 2R4SA 4GP4B 4CIPA 1UCQA 3DDLA 3DE9A 1PY6A 2I35A 3NMKA 2YL3A 1JGJA 3HARA 3NMIA 2YLDA 3QJRB 1YZAA 1X0SA 2PEDA 5JS5A 3ZQYA 2CCYA 4G72B 3ZEVA 2XLOA 2EI4A 3S8GB 3HNLA 4G70B 1L9HA 1RCPA 4HYXA 2YDVA 4N4WA 2XLHA 1AP9A 1R84A 3UTYA 1BRRA 1EHKB 3P0GA 3UZCA 5A8EA 1C8RA 2XLDA 3D4SA 2J9BA 5BR2A 4DKLA 4KLYA 3DE8A 3AM6A 5DHHA 4NC3A 4FAAB 2HPYA 2Y03A 1E85A 3HNIA 5JJNA 3QBGA 3UTXA 1CWQA 4N4YB 5B6WA 2Y04A 5H2MA 2LNLA 5ETZA 4QI1A 5G36A 3BVDB 1S8JA 2ZZLA 3C63A 5F8UA 3NYAA 4MQSA 4IARA 3ZTMA 4X32A 2I1XA 2JAGA 2F93A 3IQ6A 3DQBA 5J7AA 3EH3B 3AYMA 1AT9A 4JKVA 2YLGA 4G7RB 5JLIA 3FOPA 3VRCA 5JVEA 4DJHA 3EMLA 1F50A 4JEBA 3ZTZA 4GP8B 2NTWA 1L0MA 1BBHA 3OE8A 4CX9A 3C62A 3S3CB 2YCXA 1E84A 1CGNA 2XM4A 3PDSA 4BV0A 2M3GA 4XT3A 4KNFA 2KSYA 1JV7A 2Z73A 4QIDA 4FA7B 1QPUA 1YZCA 1Q5IA 4FBZA 1HZXA 5JT4A 3M15A 1QKOA 2Y00A 5B6VA 5A44A 5ITEA 2F95A 3C9LA 4WW3A 5B3IA 1GUEA 4WAVA 3QBLA 4MD2A 2XLVA 2BRDA 3NY9A 4WGZA 1GU8A 5FJGA 2J4YA 1APCA 1R2NA 4QRYA 1M6TA 2I21A 3COCA 3QJTB 2KS9A 3NY8A 1KG8A 1O0AA 1VGOA 3OE0A 4LDOA 1MGYA 4BUOA 1BRXA 1KG9A 5C1MA 4ER9A 4N6HA 3UTWA 1QKPA 5A45A 5H2PA 5KKHA 5DHGA 3M4BA 5JSLA 4AMJA 4IAQA 1YYXA 3FOOA 3EH4B 3REYA 3ABWA 3A7KA 4BWBA 1XIOA 5JJEA 5AWZA 5BR5A 2ZIYA 3CAPA 4X31A 4DAJA 4MBSA 4A4MA 3VVKA 3AYNA 3OE6A 1XJIA 1A7VA 3QBIA 3KJ6A 5H2NA 2XLWA 1IXFA 1KMEA 4BEYA 2WJKA 1QQ3A 4CDVA 1H2SA 2NTUA 3L1MA 3QAKA 1QHJA 1JAFA 4HWLA 1F4ZA 1QM8A 3ZWIA 5JP7A 3QJQB 3OAXA 4DS7E 4XXJA 5AX1A 3SN6R 3UG9A 2YL7A 4EA3A 3ODUA 2RH1A 1GZMA 3NS0A 4JQ6A 4L35A 5AZDA 2ZFEA 3V2WA 2AT9A 4GPOA 4U9DA 2KSBA 1JFPA 1S52A 5JJJA 1Q5JA 4G7QB 3VHZA 3CODA 3NSBA 1JV6A 3IQ5A 4XT1A 3HNJA 4XTNA 4JE9A 4G71B 3RZEA 2G87A 4BEZA 3HANA 5B0WA 1S8LA 5B34A 3C9MA 1YYJA 3V2YA 2VT4A 1S53A 3UTVA 4PXKA 1E12A 2XLMA 3S8FB 5H2HA 1EKYA 5EN0A 2Y02A 4TL3A 2XM0A 3UONA 1E86A 1M0LA 4Y9HA 3QJVB 3VGAA 1TN5A 4UHRA 3QVZA 1TN0A 2X72A 1E0PA 2XLEA 3QJUB 256BA 1VJMA 4EJ4A 3RFMA 5AHYA 5AHZA 2YL0A 2R4RA 1XMEB 2YLIA 1DZEA 5JRAA 1E83A 5H2LA 4UG2A 4AMIA 1LN6A 3ZPQA 1CGOA 1FBKA 2I20A 1P8UA 4EIYA 3VG9A 5B6XA 3T45A 4CDYA 5H2OA 2Z55A 3PBLA 1M0KA 4GYCA 3ZQVA 3HNKA 3S3BB 4X1HA 5G54A 4XTOA 4ULVA 4GP5B 1P8HA 4MQTA 3PQRA 4GBRA 3S3DB 1FBBA 3QW0A 2WJLA 4D4NA 4JEAA 3HAQA 2QPEB 5G2AA 5H2KA 5G28A 1P8IA 2YCZA 1C8SA 3M79A 2Y01A 5G53A 1X0K1 3UZAA 3ZPRA 5B6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6X A;  1S54 A;  1CPQ A;  1S51 A;  5G2D A;  1H68 A;  1MQV A;  3VW7 A;  1F88 A;  2YCW A;  4K5Y A;  4FPD A;  3QAP A;  5LWE A;  1S05 A;  1C3W A;  5TGZ A;  1PXS A;  3NMJ A;  3TOL A;  5H2J A;  2XL8 A;  4L6R A;  4LDL A;  2YKZ A;  5B35 A;  1IW6 A;  1M0M A;  3HAO A;  1LM3 B;  2XL6 A;  2BC5 A;  1BRD A;  3TOM A;  5ITC A;  5JUA A;  3U8P A;  5H2I A;  3X3C A;  1PXR A;  3QW1 A;  3M4C A;  3QDC A;  4OV0 A;  2J8W A;  5DYS A;  2YCY A;  3WQJ A;  5B6Z A;  1X0I 1;  2YL1 A;  2QPD B;  3EH5 B;  3VI0 A;  3X3B A;  4GRV A;  4CDA A;  5AX0 A;  4G7S B;  1KGB A;  1BM1 A;  1UAZ A;  3HAS A;  4J4Q A;  1CPR A;  4WGY A;  2QLA A;  4BVN A;  1IW9 A;  5G2C A;  3PWH A;  4D4X A;  4CJG A;  2KSA A;  3QBK A;  3QVY A;  3QJS B;  4XTL A;  1NBB A;  3PXO A;  4HYJ A;  4PXF A;  4MD1 A;  4JR8 A;  2YDO A;  3MBV A;  4IB4 A;  3OE9 A;  4LDE A;  5B2N A;  4CJO A;  2JAF A;  1U19 A;  4U9E A;  5AGF A;  3HAP A;  1GQA A;  2R4S A;  4GP4 B;  4CIP A;  1UCQ A;  3DDL A;  3DE9 A;  1PY6 A;  2I35 A;  3NMK A;  2YL3 A;  1JGJ A;  3HAR A;  3NMI A;  2YLD A;  3QJR B;  1YZA A;  1X0S A;  2PED A;  5JS5 A;  3ZQY A;  2CCY A;  4G72 B;  3ZEV A;  2XLO A;  2EI4 A;  3S8G B;  3HNL A;  4G70 B;  1L9H A;  1RCP A;  4HYX A;  2YDV A;  4N4W A;  2XLH A;  1AP9 A;  1R84 A;  3UTY A;  1BRR A;  1EHK B;  3P0G A;  3UZC A;  5A8E A;  1C8R A;  2XLD A;  3D4S A;  2J9B A;  5BR2 A;  4DKL A;  4KLY A;  3DE8 A;  3AM6 A;  5DHH A;  4NC3 A;  4FAA B;  2HPY A;  2Y03 A;  1E85 A;  3HNI A;  5JJN A;  3QBG A;  3UTX A;  1CWQ A;  4N4Y B;  5B6W A;  2Y04 A;  5H2M A;  2LNL A;  5ETZ A;  4QI1 A;  5G36 A;  3BVD B;  1S8J A;  2ZZL A;  3C63 A;  5F8U A;  3NYA A;  4MQS A;  4IAR A;  3ZTM A;  4X32 A;  2I1X A;  2JAG A;  2F93 A;  3IQ6 A;  3DQB A;  5J7A A;  3EH3 B;  3AYM A;  1AT9 A;  4JKV A;  2YLG A;  4G7R B;  5JLI A;  3FOP A;  3VRC A;  5JVE A;  4DJH A;  3EML A;  1F50 A;  4JEB A;  3ZTZ A;  4GP8 B;  2NTW A;  1L0M A;  1BBH A;  3OE8 A;  4CX9 A;  3C62 A;  3S3C B;  2YCX A;  1E84 A;  1CGN A;  2XM4 A;  3PDS A;  4BV0 A;  2M3G A;  4XT3 A;  4KNF A;  2KSY A;  1JV7 A;  2Z73 A;  4QID A;  4FA7 B;  1QPU A;  1YZC A;  1Q5I A;  4FBZ A;  1HZX A;  5JT4 A;  3M15 A;  1QKO A;  2Y00 A;  5B6V A;  5A44 A;  5ITE A;  2F95 A;  3C9L A;  4WW3 A;  5B3I A;  1GUE A;  4WAV A;  3QBL A;  4MD2 A;  2XLV A;  2BRD A;  3NY9 A;  4WGZ A;  1GU8 A;  5FJG A;  2J4Y A;  1APC A;  1R2N A;  4QRY A;  1M6T A;  2I21 A;  3COC A;  3QJT B;  2KS9 A;  3NY8 A;  1KG8 A;  1O0A A;  1VGO A;  3OE0 A;  4LDO A;  1MGY A;  4BUO A;  1BRX A;  1KG9 A;  5C1M A;  4ER9 A;  4N6H A;  3UTW A;  1QKP A;  5A45 A;  5H2P A;  5KKH A;  5DHG A;  3M4B A;  5JSL A;  4AMJ A;  4IAQ A;  1YYX A;  3FOO A;  3EH4 B;  3REY A;  3ABW A;  3A7K A;  4BWB A;  1XIO A;  5JJE A;  5AWZ A;  5BR5 A;  2ZIY A;  3CAP A;  4X31 A;  4DAJ A;  4MBS A;  4A4M A;  3VVK A;  3AYN A;  3OE6 A;  1XJI A;  1A7V A;  3QBI A;  3KJ6 A;  5H2N A;  2XLW A;  1IXF A;  1KME A;  4BEY A;  2WJK A;  1QQ3 A;  4CDV A;  1H2S A;  2NTU A;  3L1M A;  3QAK A;  1QHJ A;  1JAF A;  4HWL A;  1F4Z A;  1QM8 A;  3ZWI A;  5JP7 A;  3QJQ B;  3OAX A;  4XXJ A;  5AX1 A;  3SN6 R;  3UG9 A;  2YL7 A;  4EA3 A;  3ODU A;  2RH1 A;  1GZM A;  3NS0 A;  4JQ6 A;  4L35 A;  5AZD A;  2ZFE A;  3V2W A;  2AT9 A;  4GPO A;  4U9D A;  2KSB A;  1JFP A;  1S52 A;  5JJJ A;  1Q5J A;  4G7Q B;  3VHZ A;  3COD A;  3NSB A;  1JV6 A;  3IQ5 A;  4XT1 A;  3HNJ A;  4XTN A;  4JE9 A;  4G71 B;  3RZE A;  2G87 A;  4BEZ A;  3HAN A;  5B0W A;  1S8L A;  5B34 A;  3C9M A;  1YYJ A;  3V2Y A;  2VT4 A;  1S53 A;  3UTV A;  4PXK A;  1E12 A;  2XLM A;  3S8F B;  5H2H A;  1EKY A;  5EN0 A;  2Y02 A;  4TL3 A;  2XM0 A;  3UON A;  1E86 A;  1M0L A;  4Y9H A;  3QJV B;  3VGA A;  1TN5 A;  4UHR A;  3QVZ A;  1TN0 A;  2X72 A;  1E0P A;  2XLE A;  3QJU B;  256B A;  1VJM A;  4EJ4 A;  3RFM A;  5AHY A;  5AHZ A;  2YL0 A;  2R4R A;  1XME B;  2YLI A;  1DZE A;  5JRA A;  1E83 A;  5H2L A;  4UG2 A;  4AMI A;  1LN6 A;  3ZPQ A;  1CGO A;  1FBK A;  2I20 A;  1P8U A;  4EIY A;  3VG9 A;  5B6X A;  3T45 A;  4CDY A;  5H2O A;  2Z55 A;  3PBL A;  1M0K A;  4GYC A;  3ZQV A;  3HNK A;  3S3B B;  4X1H A;  5G54 A;  4XTO A;  4ULV A;  4GP5 B;  1P8H A;  4MQT A;  3PQR A;  4GBR A;  3S3D B;  1FBB A;  3QW0 A;  2WJL A;  4D4N A;  4JEA A;  3HAQ A;  2QPE B;  5G2A A;  5H2K A;  5G28 A;  1P8I A;  2YCZ A;  1C8S A;  3M79 A;  2Y01 A;  5G53 A;  1X0K 1;  3UZA A;  3ZPR A;  5B6Y A; 
#chains in the Genus database with same CATH topology
 3EG9 B;  3VW7 A;  4O79 A;  4K1O A;  2Q7R A;  4K5Y A;  2P1A A;  3Q6M A;  1VLT A;  3LAY A;  1XZP A;  2DYR C;  2VH3 A;  4BJ5 A;  2G3K A;  5H2J A;  4LDL A;  2YKZ A;  4DRJ B;  3TUL A;  2GAQ A;  1M0M A;  2XSE A;  2WVQ A;  5E3A A;  1GGQ A;  2MHR A;  4JJF A;  1D0X A;  5H2I A;  4OV0 A;  5E2Q A;  1VK5 A;  3DAG A;  2YWA A;  5DYS A;  1WN0 A;  2R9R B;  1M2V A;  1HE9 A;  1SYQ A;  2QE9 A;  1Q0F A;  3X3B A;  4GRV A;  2VCB A;  2IXO A;  2XL4 A;  2O9X A;  1IW9 A;  4LDR A;  5G2C A;  2PNO A;  4E0H A;  1U0B B;  1CGM E;  1AUE A;  4NQF A;  1WAS A;  3OE9 A;  5B2N A;  1OW7 A;  1G8X A;  4U9E A;  2LFF A;  2XXA A;  1FFT C;  2I35 A;  3DM9 B;  1T5O A;  2R7Q A;  4JTC B;  1JGJ A;  2YEV A;  1YDI A;  2DGJ A;  1VTM P;  4FES A;  2J0W A;  3AJM A;  5JS5 A;  3ZQY A;  2C04 A;  3HNL A;  1L9H A;  4C3B A;  4P6I C;  5D91 A;  2VB6 A;  2YDV A;  4O6M A;  2XLH A;  2J9U A;  2A0U A;  4BJT A;  4PJJ A;  3P0G A;  5DS6 A;  5F5F A;  5A8E A;  2XLD A;  2J9B A;  4DKL A;  3VYW A;  4KLY A;  4HFK B;  1B68 A;  3S90 A;  4NTA A;  3CZ6 A;  2R7S A;  2Y03 A;  1E85 A;  3QBG A;  1R5I D;  5DS5 A;  4N4Y B;  5B6W A;  5A6A A;  2LNL A;  4QI1 A;  5G36 A;  1FAP B;  3BVD B;  1S8J A;  3C63 A;  3EFO A;  3VAY A;  3ZTM A;  4M63 A;  2I1X A;  2DB4 A;  3ITF A;  4G0H A;  2JAG A;  4K0D A;  4U5E E;  1UG7 A;  4EBB A;  4PJL A;  3LNR A;  3EH3 B;  4JKV A;  2HMZ A;  4WJ0 A;  4FAP B;  4YJW A;  2Y69 C;  3ECS A;  3EML A;  1HW1 A;  4GP8 B;  2ICW G;  3H2U A;  2NTW A;  2G3V A;  5A6B A;  1L0M A;  1JPN A;  3SP1 A;  1MMA A;  1U89 A;  1E84 A;  1A0B A;  3PDS A;  2NUP A;  4BV0 A;  3GM3 A;  3C18 A;  3EQL F;  4MQ9 F;  2WZF A;  3K33 A;  4FA7 B;  1Q5I A;  4O6N A;  1HZX A;  3M15 A;  3S29 A;  3DZA A;  1D1B A;  5B6V A;  5A44 A;  5ITE A;  2F95 A;  1HMD A;  5L0D A;  2X0C A;  3NY9 A;  4DBR A;  5T3T A;  2J4Y A;  1NG1 A;  1F1M A;  1FNT c;  2KS9 A;  1KG8 A;  1O0A A;  1MGY A;  4BUO A;  1BRX A;  3EGD A;  4C7O A;  1YA7 O;  4CSA A;  2CDQ A;  4GQH A;  4ER9 A;  3FAP B;  1QKP A;  1YJG A;  2NPU A;  3DMD A;  1TWA A;  3M4B A;  4AMJ A;  4IAQ A;  2NSF A;  2W45 A;  3FAJ A;  1XIO A;  5AWZ A;  5BR5 A;  3CAP A;  4U5D E;  4MBS A;  4A4M A;  4KI2 A;  1RKE A;  3AYN A;  1O87 A;  3OE6 A;  3U2L A;  3VVK A;  1XJI A;  1FMV A;  1SMY F;  2I8B A;  2XLW A;  2OQM A;  4DBQ A;  1KME A;  2ZPA A;  2WJK A;  1SR2 A;  1ORJ A;  4MW8 A;  1RJ9 A;  1H2S A;  3RVZ A;  1JAF A;  4KC9 A;  1TQG A;  3G50 A;  3AG4 C;  3NRH A;  1F4Z A;  1LI5 A;  4YT4 A;  2XXA B;  2XS8 A;  5DQZ A;  2YL7 A;  4EA3 A;  2RH1 A;  4U5B E;  1WWP A;  3OA1 A;  4AK9 A;  2TMV P;  5A6J A;  2R25 A;  1Q5J A;  3VHZ A;  3G4X A;  1RMV A;  1JV6 A;  3IQ5 A;  4BEJ A;  1H7I A;  4I1M A;  4FWV A;  4QI2 A;  3RZE A;  3US6 A;  1EA8 A;  4BEZ A;  5E33 A;  3HAN A;  2GFH A;  5CI8 A;  3A9C A;  1BR4 A;  2UUI A;  4U5G A;  1YLM A;  1NU9 C;  4E0I A;  3S8F B;  5BQH A;  5H2H A;  3W2V A;  3O39 A;  4I44 A;  1VB5 A;  2NG1 A;  3QJV B;  4ZLC A;  2Q3T A;  2XLE A;  2RSE B;  4AX2 A;  1ZVZ A;  2CGE A;  1M2O A;  1XWJ A;  4OD5 A;  3DD7 A;  3QZC A;  3S28 A;  1LN6 A;  2PP4 A;  5H2O A;  1M0K A;  4EBJ A;  2H7B A;  4E18 A;  2L9J A;  4NTB A;  4XTO A;  4ULV A;  4MQT A;  4GBR A;  2LP4 A;  3ASO C;  2WJL A;  1Y6D A;  3O6X A;  4JCH A;  3CSK A;  4J32 B;  5H2K A;  2R7T A;  2Y01 A;  1I4Z A;  3UZA A;  1JPJ A;  4AE4 B;  3H65 A;  2OEX A;  1OW8 A;  3EGX A;  3PCV A;  4W8K A;  5G2D A;  3MX3 A;  1H68 A;  1F88 A;  2YRF A;  2YCW A;  5KYW B;  4X0R A;  5KYY B;  3ZC4 A;  3QAP A;  4DRH B;  1C3W A;  2KJG A;  2KGO A;  3C8Z A;  1G5Z A;  1PXS A;  3EZI A;  2P0N A;  3VM6 A;  5B35 A;  1IW6 A;  2DYS C;  3HAO A;  2IBF A;  2VCC A;  2IXN A;  3EJN A;  2KK1 A;  3J06 A;  3X3C A;  3DJN B;  3NYL A;  1BR2 A;  4U5C E;  4KNW A;  1OCZ C;  2W4B A;  2J8W A;  1T6Q A;  3ATP A;  2YCY A;  3WQJ A;  2D5R B;  2YL1 A;  2QPD B;  3EH5 B;  3VI0 A;  4G7H F;  3LNM B;  1RKE B;  5AX0 A;  2R02 A;  3DI5 A;  2OG2 A;  4G7S B;  1IW7 F;  3MLG A;  1BM1 A;  3RQF A;  4J4Q A;  1CPR A;  1K04 A;  2CW0 F;  3PWH A;  4BJ1 A;  1O3U A;  3AG3 C;  5CIV A;  3B29 A;  4YL3 A;  1M56 C;  1OXB A;  3QVY A;  1RJ9 B;  3PXO A;  4HYJ A;  2IXM A;  4MD1 A;  3B0V C;  4O7G A;  5K0I A;  4E7S A;  3V5Y A;  3N24 A;  4LDE A;  4U5F E;  4DOZ A;  4JW1 A;  3U2M A;  2JAF A;  1U19 A;  5AGF A;  3TJ5 A;  1HE1 A;  4CIP A;  1UCQ A;  1MND A;  4JZA A;  1MMD A;  3F46 A;  1PY6 A;  3AGU A;  2YL3 A;  2A69 F;  4OIR F;  4CS8 C;  3NMI A;  2YLD A;  4MVR A;  4WAB A;  1EI7 A;  3T9O A;  4ULW A;  2WZL A;  1G4U S;  3KKB A;  3PHF 2;  1PD0 A;  1NU7 D;  2WB7 A;  2AU5 A;  4HYX A;  4N4W A;  3A11 A;  4YT8 A;  3B9Q A;  3UZC A;  2LQG A;  1FFH A;  3KMI A;  3EPV A;  4J7T A;  2EPM X;  2J45 A;  2ETS A;  4NC3 A;  4FAA B;  1ZW2 A;  4PFP A;  3O55 A;  3HNI A;  3UTX A;  2HV7 A;  3RF3 A;  3FMS A;  5ETZ A;  4H54 A;  1ZZP A;  4BJ6 C;  2ZZL A;  1ZU4 A;  1AEP A;  5F8U A;  1I4Y A;  3NYA A;  4IAR A;  1V55 C;  1TKN A;  1NFN A;  2LCH A;  1D1C A;  3IQ6 A;  3MFN A;  3DQB A;  4GEH A;  1AT9 A;  4G7R B;  2EIK C;  2LFD A;  3FOP A;  3LS0 A;  3VRC A;  1H9T A;  4OIN F;  4PAC A;  4OIO F;  1T6I A;  4Q4Z F;  1LPE A;  5AC4 A;  3DXJ F;  4QI0 A;  3S3C B;  2WL8 A;  3JZ0 A;  5EK0 A;  4OIQ F;  4YT5 A;  4LDK A;  2OJQ A;  2EPL X;  3JSE O;  2R05 A;  5HSW A;  2KSY A;  2R7U A;  3DAF A;  4MTF A;  2L6G A;  3KL4 A;  2Z73 A;  4QID A;  1QPU A;  2FAP B;  4ONS A;  3LS1 A;  4FBZ A;  5JT4 A;  4E17 A;  1QKO A;  2HKV A;  3C9L A;  3MYF A;  4WW3 A;  3EGX B;  1OKK D;  3QBL A;  1GU8 A;  5FJG A;  4G7O F;  1QSP A;  3I4U A;  3ABM C;  1OCC C;  1Q0K A;  2I21 A;  3COC A;  3QJT B;  2KNH A;  1E2X A;  3IEE A;  2MYS A;  3OEO A;  1N1C A;  3T6G B;  3MYI A;  1LVK A;  5C1M A;  1MMG A;  2EIL C;  3T6B A;  1PV3 A;  5KKH A;  3WAQ A;  1YAU O;  5DS4 A;  3FOO A;  3V7O A;  1Q0D A;  3REY A;  4XTK A;  3A7K A;  3T4R A;  5JJE A;  3I5Q A;  3SXM A;  2HSB A;  4X31 A;  4LLC A;  5KYN A;  2HUJ A;  4EHP A;  4CS9 C;  3KJ6 A;  5H2N A;  1DOV A;  1QQ3 A;  2NTU A;  2HSQ A;  4PJM A;  3QAK A;  4J30 B;  3HLZ A;  3W4Y A;  1QM8 A;  3ZWI A;  4RDA A;  2NUT A;  2H7O A;  4XEK A;  5AX1 A;  2AP3 A;  3L0I A;  3ODU A;  3FDQ A;  4JQ6 A;  2D4U A;  1Z5Z A;  2KW3 C;  4U9D A;  1JFP A;  4G7Q B;  1OW6 A;  3JSZ A;  5L0H A;  3NSB A;  2OKU A;  3LEV A;  2L6F A;  2X51 A;  3K1I C;  4XTN A;  4JE9 A;  1ZYR F;  3EZH A;  4IRU A;  1V54 C;  1Y4C A;  4YL0 A;  3CAX A;  3GWN A;  3GAN A;  4NCQ A;  4NY3 A;  2Y3D A;  3LLI A;  3NDB B;  1LE4 A;  2J9W A;  1OQC A;  4TL3 A;  2XM0 A;  2OCC C;  4JJG A;  4DJ9 A;  3UMK A;  3VGA A;  4UHR A;  3ZG1 A;  1T6U A;  4XPY A;  2X72 A;  5KYU A;  2FFH A;  1E0P A;  1ST6 A;  2MWQ A;  1OR3 A;  1VJM A;  3GOD A;  3U8V A;  5AHZ A;  4MVS A;  5JRA A;  1E83 A;  3BEH A;  1HW2 A;  5H2L A;  1Z63 A;  4AMI A;  3AQB A;  3TD7 A;  3K7D A;  2J7P A;  3ZPQ A;  2I20 A;  4EIY A;  2CNW A;  4MND A;  3VG9 A;  3VF0 A;  1M2V B;  4YT2 A;  4GYC A;  2IOQ A;  2ZXR A;  4AL1 A;  3S3B B;  1BDJ B;  5TJ5 E;  1P8H A;  5A6B D;  3UMH A;  1C02 A;  3S3D B;  5G2A A;  1VOM A;  3SZR A;  4MTO A;  3GM2 A;  1C8S A;  3M79 A;  5G53 A;  1X0K 1;  5B1A C;  2VC9 A;  1S54 A;  3CEX A;  1S51 A;  1HMO A;  3K1H A;  3AGT A;  2YVK A;  3UGP A;  3X2Q C;  4DVY P;  5LWE A;  2A0B A;  2RD9 A;  1S05 A;  4XWJ A;  4CIH A;  1KTM A;  5TGZ A;  3NMJ A;  3TOL A;  3KYI A;  1L7C A;  2XL8 A;  4L6R A;  4I3M A;  1LM3 B;  2XL6 A;  1BRD A;  4PJN A;  3TOM A;  1QLE C;  5JUA A;  3U8P A;  4CS8 A;  3QDC A;  5KYX A;  3LES A;  1EQ1 A;  5FCL A;  1Q0G A;  1C03 A;  2HS5 A;  3EH2 A;  5EGY A;  4HE8 D;  5L0I A;  4F4B A;  4YK5 A;  3FVY A;  5AC5 A;  4XLN F;  1KGB A;  2OEV A;  2AVK A;  4BVN A;  3RKO F;  1NLX A;  3NYJ A;  2PF4 E;  2KSA A;  2GWW A;  2FGY A;  5IY5 C;  3QBK A;  1C17 M;  1VMA A;  3R2P A;  1ZHT A;  4PXF A;  3EFO B;  4OD4 A;  1MNE A;  4JVS A;  2B0H A;  2YDO A;  4J7Y A;  3AOU A;  4IB4 A;  4QDL A;  3RIP A;  3GEI A;  3DKA A;  4JRZ A;  3KYJ A;  2M64 A;  1OCO C;  3JYY A;  2R4S A;  4GP4 B;  4G7Z F;  3SNH A;  3EG9 A;  3DDL A;  3DE9 A;  2EIM C;  3NMK A;  3UGO A;  5DQT A;  3IHU A;  1X0S A;  2Y3B A;  1OXK A;  2EPK X;  1ZHW A;  2IXP A;  3V5X A;  3IPM O;  2Q9A A;  2XLO A;  5FZT A;  3B0P A;  2EI4 A;  2PFD A;  3S8G B;  2NUP B;  4G70 B;  2W9Y A;  3HKK A;  1AP9 A;  1R84 A;  3UTY A;  3Q6N A;  1BRR A;  1EHK B;  3PMR A;  1BZ4 A;  3RYL A;  4LLE A;  5T3W A;  2OU6 A;  3D4S A;  2Q9B A;  3DE8 A;  3AM6 A;  2AWY A;  5L3V A;  2L7A A;  5JJN A;  1DOW A;  2ASR A;  1CWQ A;  3RVY A;  3LJB A;  4X32 A;  1V74 B;  2YQY A;  3EGD B;  4C7O B;  5J7A A;  1S7Z A;  1ZHX A;  3F47 A;  3AYM A;  2V3C C;  3E70 C;  5JLI A;  2HJM A;  2I15 A;  3Q7L A;  5JVE A;  4DJH A;  1WGW A;  1F50 A;  3K6B A;  4JEB A;  3ZTZ A;  3S0X A;  4Q5S F;  4MTG A;  3POV A;  2YCX A;  3N0T A;  4I1O B;  4LAC B;  2A6H F;  4MVU A;  2XM4 A;  2LIG A;  4R32 A;  5CI9 A;  2M3G A;  3M1C B;  4XT3 A;  3PDM P;  2HJ3 A;  2Y3H A;  2L81 A;  1JV7 A;  2H8A A;  1Z3I X;  1A41 A;  1ZHY A;  1BR1 A;  3L34 A;  4XLP F;  1NSG B;  4LER A;  1GUE A;  4MD2 A;  3GEE A;  2XLV A;  4WGZ A;  3Q7G A;  1R2N A;  2J0X A;  1M6T A;  2R03 A;  1OR2 A;  3NY8 A;  1SF8 A;  4HEA J;  5L0C A;  4U5H A;  4YWQ A;  4MVM A;  4LDO A;  1Z7Q c;  3G4Z A;  1KG9 A;  2J46 A;  4MS2 A;  4DXW A;  3JT1 A;  2VAS A;  4KBL A;  2QTV A;  3AG1 C;  5DHG A;  5JSL A;  1YYX A;  1JR8 A;  1FMW A;  3L8I A;  3GM1 A;  3EH4 B;  3GEH A;  3ABW A;  2IM8 A;  4RD9 A;  4DAJ A;  1V4A A;  1VYK A;  3N2Z B;  1A7V A;  1WOL A;  4N6C A;  1TWG A;  3QBI A;  4DVZ A;  3LUT B;  4CBE A;  3V5Z A;  1IXF A;  2J9V A;  2OOC A;  3L1M A;  1QHJ A;  3AG2 C;  1VYI A;  5COG A;  4HWL A;  5JP7 A;  2EPO A;  1TR2 A;  3QJQ B;  4XXJ A;  3SN6 R;  5GPG B;  3HJC A;  1GZM A;  2UUH A;  5AZD A;  4UDV A;  2ZFE A;  1LKX A;  2BE5 F;  3I5P A;  1ORS C;  4DRI B;  2WVO A;  2HMQ A;  4XEV A;  2KSB A;  1S52 A;  5JJJ A;  3E9V A;  2AWC A;  3CQZ A;  4XT1 A;  4JC7 A;  1WTY A;  1L3P A;  4G71 B;  2G87 A;  3LLK A;  3TQO A;  3C9M A;  3WOD F;  3V2Y A;  4GYT A;  2V26 A;  1S53 A;  3UTV A;  1TFO B;  3RW0 A;  2Q4F A;  4C3D A;  1EKY A;  2Y02 A;  5B1B C;  3UON A;  2YZS A;  2EIN C;  1IZM A;  1M0L A;  3T6J A;  4XPW A;  2G62 A;  2XS1 A;  2KC3 A;  1LIH A;  4MW3 A;  3QVZ A;  2ZXO A;  2XRH A;  256B A;  3SEO A;  3RFM A;  2QUP A;  5AHY A;  1XME B;  3SXK A;  3QMK A;  3TK0 A;  2QNL A;  4A2N B;  1LS4 A;  2B0J A;  2HFI A;  5L0G A;  1CGO A;  1FBK A;  1LS1 A;  1P8U A;  2CYD A;  4P9F A;  3W2W A;  3T45 A;  3JYH A;  2Z55 A;  3PBL A;  3ZQV A;  3HNK A;  4LDQ A;  3NG1 A;  3JRM O;  4GP5 B;  5L0J A;  5L3Q A;  5COF A;  2DI3 A;  2M4E A;  2PBE A;  1FBB A;  3QW0 A;  3HAQ A;  2W4M A;  1A7D A;  3ABL C;  2Z15 A;  1ZW3 A;  1G4W R;  1QZX A;  5G28 A;  2YCZ A;  4FX5 A;  2EPN A;  4BPM A;  3SYN A;  3QTH A;  2L6X A;  5DVW A;  3S27 A;  4OIP F;  1CPQ A;  3JRT A;  1PCX A;  1MQV A;  2Y3G A;  4KNV A;  4H4K C;  3O10 A;  4FPD A;  2PX3 A;  4B6I A;  3IQC A;  5BQG A;  2KQ9 A;  3OWT A;  3AQC A;  2P7V A;  2BC5 A;  1TWC A;  5ITC A;  3UMI A;  3WHN A;  3IQT A;  1PXR A;  3QW1 A;  3M4C A;  3KH2 A;  3NKD A;  5HV9 A;  5B6Z A;  2OJE D;  1X0I 1;  3UR3 C;  4IGG A;  1K05 A;  3W8I A;  4CDA A;  1Q0M A;  5EHH A;  1UAZ A;  3HAS A;  3S84 A;  1OCR C;  4WGY A;  2QLA A;  3C8G A;  4IWB A;  2H7V C;  1R4T A;  4D4X A;  1SZI A;  4CJG A;  4C3E A;  3QJS B;  4XTL A;  1NBB A;  1YA9 A;  5B3S C;  4JR8 A;  2C03 A;  3MBV A;  4BJ5 C;  4BEM J;  5DLJ A;  4CJO A;  4AE4 A;  4YL1 A;  3HAP A;  1GQA A;  2ZD9 A;  2R7X A;  2KSF A;  4JTA B;  1NFO A;  3KPH A;  5A6K A;  5KYW A;  5KYY A;  2BL2 A;  3HAR A;  4EKW A;  4Q7C A;  3QJR B;  1YZA A;  2GA0 A;  2A6E F;  2PED A;  5BQI A;  3RFY A;  3B0U X;  1TFK B;  2CCY A;  4G72 B;  3ZEV A;  4EWC A;  2LSE A;  1VLS A;  3U9M A;  3JCU Q;  4NTF A;  5A69 A;  1RCP A;  3DWW A;  1T9K A;  2LD6 A;  2Q9C A;  4W8P A;  4XEF A;  3H2V A;  1K40 A;  3U3F A;  1C8R A;  4Z9J A;  2Q00 A;  5BR2 A;  3RH3 A;  3FXH A;  3ZDL A;  5DHH A;  1Z6A A;  4HFF B;  2HPY A;  3W8H A;  2Y04 A;  5H2M A;  3EHN A;  3WG7 C;  2QY9 A;  3C8G D;  1M57 C;  3DM5 A;  4MQS A;  1D0Z A;  1RKC A;  2F93 A;  1U6H A;  2LK4 A;  3ZVR A;  2YLG A;  2IYL D;  3ZSU A;  5BUO A;  2R7R A;  4Z9H A;  4PK4 A;  2ZXW C;  1BBH A;  4PR9 A;  3OE8 A;  4CX9 A;  1ZU5 A;  2J7P D;  3C62 A;  1Z23 A;  2R7V A;  1YAR O;  1CGN A;  2CNW D;  4YN0 B;  1JOG A;  1D1A A;  4IJJ A;  4KNF A;  1AVO B;  4G78 A;  3HTK C;  2R7W A;  4JTD B;  1YZC A;  4RBN A;  4CS7 A;  1UFB A;  2Y39 A;  2Y00 A;  2NUT B;  5B3I A;  3UNG C;  1J8M F;  4WAV A;  2BRD A;  1A7E A;  4XPX A;  2L6H A;  1APC A;  4QRY A;  4BJ6 A;  5T1D B;  1VGO A;  3S9O A;  4MVQ A;  2ZXP A;  3OE0 A;  4P9T A;  1GM5 A;  3RQG A;  1JMW A;  2P61 A;  4N6H A;  3UTW A;  1LE2 A;  1I5N A;  5A45 A;  5H2P A;  2KYH A;  2E87 A;  5COM A;  4BWB A;  3U3B A;  3ZIB A;  2ZIY A;  3NKE A;  1GS9 A;  4MVO A;  2YHS A;  3C8G B;  1O5H A;  3ASN C;  1TWH A;  4BEY A;  4K7B A;  5E3C A;  4JCZ A;  1QVX A;  3L8J A;  4CDV A;  1LI7 A;  3B71 A;  1ZHZ A;  5KYU B;  4Z9I A;  3EH1 A;  1NZE A;  3X1O A;  1D0Y A;  3C7J A;  2A68 F;  3RQE A;  3OAX A;  4DS7 E;  4E7Z A;  3U9J A;  4CSA C;  3UG9 A;  4PFO A;  4EUK B;  3NS0 A;  3U0C A;  4L35 A;  3V2W A;  2AT9 A;  4GPO A;  2GDC A;  4MVZ A;  4BG0 A;  3K66 A;  3COD A;  3NYM A;  2R7O A;  3HNJ A;  1FR0 A;  2A1D D;  1KNY A;  5F28 E;  4EBK A;  5B0W A;  2HV6 A;  2JD3 A;  1S8L A;  5B34 A;  1RXQ A;  1YYJ A;  4N06 A;  4XQ1 A;  3LEO A;  2VT4 A;  1KU2 A;  1MMN A;  4AL0 A;  4PXK A;  1E12 A;  2XLM A;  3R7C A;  5F5H A;  2HZ8 A;  5EN0 A;  4ANJ A;  3GWL A;  4CS9 A;  1E86 A;  2PX0 A;  4Y9H A;  1H9G A;  1WAT A;  1XZQ A;  3U5S A;  1ORY A;  1TN5 A;  2JPU A;  4A4A A;  4IAO A;  2P6V A;  1TN0 A;  3DJU B;  3QJU B;  3EHM A;  4EJ4 A;  3SXZ A;  2YL0 A;  2R4R A;  3GOR A;  3TJ6 A;  2YLI A;  4JUR I;  1DZE A;  3JTL O;  1QKR A;  4UG2 A;  2NSG A;  1HY5 A;  2EIJ C;  1J8Y F;  1PD1 A;  5KYX B;  1H6G A;  3ABK C;  5D92 A;  5B6X A;  4JIO A;  4CDY A;  1JRA A;  3K1I A;  4X1H A;  5G54 A;  2JX0 A;  3BRJ A;  1T01 A;  1W2W A;  2WVN A;  3PQR A;  4ZLD A;  2F22 A;  4D4N A;  4JEA A;  2QPE B;  2VCA A;  3MBG A;  1YVI A;  1OKK A;  1P8I A;  3SXY A;  5L0F A;  4O6Y A;  2WZG A;  3ZPR A;  3FHD A;  5B6Y A;  1FTS A; 
#chains in the Genus database with same CATH homology
 2L6X A;  1S54 A;  1CPQ A;  1S51 A;  5G2D A;  1H68 A;  1MQV A;  3VW7 A;  1F88 A;  2YCW A;  4K5Y A;  4FPD A;  3QAP A;  5LWE A;  1S05 A;  1C3W A;  5TGZ A;  1PXS A;  3NMJ A;  3TOL A;  5H2J A;  2XL8 A;  4L6R A;  4LDL A;  2YKZ A;  5B35 A;  1IW6 A;  1M0M A;  3HAO A;  1LM3 B;  2XL6 A;  2BC5 A;  1BRD A;  3TOM A;  5ITC A;  5JUA A;  3U8P A;  5H2I A;  3X3C A;  1PXR A;  3QW1 A;  3M4C A;  3QDC A;  4OV0 A;  2J8W A;  5DYS A;  2YCY A;  3WQJ A;  5B6Z A;  1X0I 1;  2YL1 A;  2QPD B;  3EH5 B;  3VI0 A;  3X3B A;  4GRV A;  4CDA A;  5AX0 A;  4G7S B;  1KGB A;  1BM1 A;  1UAZ A;  3HAS A;  4J4Q A;  1CPR A;  4WGY A;  2QLA A;  4BVN A;  1IW9 A;  5G2C A;  3PWH A;  4D4X A;  4CJG A;  2KSA A;  3QBK A;  3QVY A;  3QJS B;  4XTL A;  1NBB A;  3PXO A;  4HYJ A;  4PXF A;  4MD1 A;  4JR8 A;  2YDO A;  3MBV A;  4IB4 A;  3OE9 A;  4LDE A;  5B2N A;  4CJO A;  2JAF A;  1U19 A;  4U9E A;  5AGF A;  3HAP A;  1GQA A;  2R4S A;  4GP4 B;  4CIP A;  1UCQ A;  3DDL A;  3DE9 A;  1PY6 A;  2I35 A;  3NMK A;  2YL3 A;  1JGJ A;  3HAR A;  3NMI A;  2YLD A;  3QJR B;  1YZA A;  1X0S A;  2PED A;  5JS5 A;  3ZQY A;  2CCY A;  4G72 B;  3ZEV A;  2XLO A;  2EI4 A;  3S8G B;  3HNL A;  4G70 B;  1L9H A;  1RCP A;  4HYX A;  2YDV A;  4N4W A;  2XLH A;  1AP9 A;  1R84 A;  3UTY A;  1BRR A;  1EHK B;  3P0G A;  3UZC A;  5A8E A;  1C8R A;  2XLD A;  3D4S A;  2J9B A;  5BR2 A;  4DKL A;  4KLY A;  3DE8 A;  3AM6 A;  5DHH A;  4NC3 A;  4FAA B;  2HPY A;  2Y03 A;  1E85 A;  3HNI A;  5JJN A;  3QBG A;  3UTX A;  1CWQ A;  4N4Y B;  5B6W A;  2Y04 A;  5H2M A;  2LNL A;  5ETZ A;  4QI1 A;  5G36 A;  3BVD B;  1S8J A;  2ZZL A;  3C63 A;  5F8U A;  3NYA A;  4MQS A;  4IAR A;  3ZTM A;  4X32 A;  2I1X A;  2JAG A;  2F93 A;  3IQ6 A;  3DQB A;  5J7A A;  3EH3 B;  3AYM A;  1AT9 A;  4JKV A;  2YLG A;  4G7R B;  5JLI A;  3FOP A;  3VRC A;  5JVE A;  4DJH A;  3EML A;  1F50 A;  4JEB A;  3ZTZ A;  4GP8 B;  2NTW A;  1L0M A;  1BBH A;  3OE8 A;  4CX9 A;  3C62 A;  3S3C B;  2YCX A;  1E84 A;  1CGN A;  2XM4 A;  3PDS A;  4BV0 A;  2M3G A;  4XT3 A;  4KNF A;  2KSY A;  1JV7 A;  2Z73 A;  4QID A;  4FA7 B;  1QPU A;  1YZC A;  1Q5I A;  4FBZ A;  1HZX A;  5JT4 A;  3M15 A;  1QKO A;  2Y00 A;  5B6V A;  5A44 A;  5ITE A;  2F95 A;  3C9L A;  4WW3 A;  5B3I A;  1GUE A;  4WAV A;  3QBL A;  4MD2 A;  2XLV A;  2BRD A;  3NY9 A;  4WGZ A;  1GU8 A;  5FJG A;  2J4Y A;  1APC A;  1R2N A;  4QRY A;  1M6T A;  2I21 A;  3COC A;  3QJT B;  2KS9 A;  3NY8 A;  1KG8 A;  1O0A A;  1VGO A;  3OE0 A;  4LDO A;  1MGY A;  4BUO A;  1BRX A;  1KG9 A;  5C1M A;  4ER9 A;  4N6H A;  3UTW A;  1QKP A;  5A45 A;  5H2P A;  5KKH A;  5DHG A;  3M4B A;  5JSL A;  4AMJ A;  4IAQ A;  1YYX A;  3FOO A;  3EH4 B;  3REY A;  3ABW A;  3A7K A;  4BWB A;  1XIO A;  5JJE A;  5AWZ A;  5BR5 A;  2ZIY A;  3CAP A;  4X31 A;  4DAJ A;  4MBS A;  4A4M A;  3VVK A;  3AYN A;  3OE6 A;  1XJI A;  1A7V A;  3QBI A;  3KJ6 A;  5H2N A;  2XLW A;  1IXF A;  1KME A;  4BEY A;  2WJK A;  1QQ3 A;  4CDV A;  1H2S A;  2NTU A;  3L1M A;  3QAK A;  1QHJ A;  1JAF A;  4HWL A;  1F4Z A;  1QM8 A;  3ZWI A;  5JP7 A;  3QJQ B;  3OAX A;  4DS7 E;  4XXJ A;  5AX1 A;  3SN6 R;  3UG9 A;  2YL7 A;  4EA3 A;  3ODU A;  2RH1 A;  1GZM A;  3NS0 A;  4JQ6 A;  4L35 A;  5AZD A;  2ZFE A;  3V2W A;  2AT9 A;  4GPO A;  4U9D A;  2KSB A;  1JFP A;  1S52 A;  5JJJ A;  1Q5J A;  4G7Q B;  3VHZ A;  3COD A;  3NSB A;  1JV6 A;  3IQ5 A;  4XT1 A;  3HNJ A;  4XTN A;  4JE9 A;  4G71 B;  3RZE A;  2G87 A;  4BEZ A;  3HAN A;  5B0W A;  1S8L A;  5B34 A;  3C9M A;  1YYJ A;  3V2Y A;  2VT4 A;  1S53 A;  3UTV A;  4PXK A;  1E12 A;  2XLM A;  3S8F B;  5H2H A;  1EKY A;  5EN0 A;  2Y02 A;  4TL3 A;  2XM0 A;  3UON A;  1E86 A;  1M0L A;  4Y9H A;  3QJV B;  3VGA A;  1TN5 A;  4UHR A;  3QVZ A;  1TN0 A;  2X72 A;  1E0P A;  2XLE A;  3QJU B;  256B A;  1VJM A;  4EJ4 A;  3RFM A;  5AHY A;  5AHZ A;  2YL0 A;  2R4R A;  1XME B;  2YLI A;  1DZE A;  5JRA A;  1E83 A;  5H2L A;  4UG2 A;  4AMI A;  1LN6 A;  3ZPQ A;  1CGO A;  1FBK A;  2I20 A;  1P8U A;  4EIY A;  3VG9 A;  5B6X A;  3T45 A;  4CDY A;  5H2O A;  2Z55 A;  3PBL A;  1M0K A;  4GYC A;  3ZQV A;  3HNK A;  3S3B B;  4X1H A;  5G54 A;  4XTO A;  4ULV A;  4GP5 B;  1P8H A;  4MQT A;  3PQR A;  4GBR A;  3S3D B;  1FBB A;  3QW0 A;  2WJL A;  4D4N A;  4JEA A;  3HAQ A;  2QPE B;  5G2A A;  5H2K A;  5G28 A;  1P8I A;  2YCZ A;  1C8S A;  3M79 A;  2Y01 A;  5G53 A;  1X0K 1;  3UZA A;  3ZPR A;  5B6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...