4N6HA

1.8 a structure of the human delta opioid 7tm receptor (psi community target)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
408
structure length
408
Chain Sequence
DLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular control of delta-opioid receptor signalling.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Soluble cytochrome b562, Delta-type opioid receptor chimeric
total genus 175
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2013-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n6hA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n6hA02
5LWEA 3PWHA 5JP7A 5AHYA 3FOOA 2QPDB 4CX9A 4G71B 1O0AA 4CIPA 3WQJA 2KS9A 3QBIA 4HYJA 1S54A 5C1MA 3PQRA 4LDOA 5H2PA 5G54A 3ZPRA 1AT9A 4EA3A 1S8JA 2J4YA 5JJNA 3HANA 3HNJA 2X72A 5AZDA 4GP4B 1E83A 2YL3A 4FAAB 1XJIA 5J7AA 1PXRA 3L1MA 3BVDB 2NTUA 1C8RA 1CGOA 4MD1A 1M0KA 1Q5JA 3ODUA 2XLWA 4CJOA 1PXSA 4DAJA 3M15A 1IW6A 3IQ6A 1JV6A 5JVEA 3NYAA 1YZAA 5JSLA 2ZZLA 4G7RB 2KSYA 2YL1A 3QVYA 2ZFEA 3AYNA 4XTOA 4A4MA 4JEAA 1R84A 1E84A 4X1HA 3HNIA 5AWZA 1S52A 1GQAA 2AT9A 3V2WA 3REYA 256BA 3UZCA 3P0GA 1EHKB 4GBRA 4UHRA 3NS0A 4G70B 5H2LA 2YCYA 4OV0A 3TOMA 5AX0A 4BVNA 2J9BA 1BM1A 4QIDA 1EKYA 3QJQB 2CCYA 1P8IA 2Y02A 2YL7A 1QKPA 2Y00A 3CAPA 2BRDA 5JT4A 2L6XA 4PXKA 2VT4A 5BR2A 4CDVA 4GYCA 3OE8A 5B34A 5H2KA 4XTLA 1C3WA 4TL3A 3QJVB 2KSAA 1E12A 1M0MA 4MQTA 5DHGA 3QJSB 1E0PA 5JJEA 4QRYA 3QBGA 2PEDA 1YYXA 4AMJA 1L9HA 3QVZA 3U8PA 2QLAA 3EMLA 3X3CA 5A44A 5DHHA 1U19A 2I20A 3V2YA 3DE8A 5B6WA 3C62A 4KLYA 3UTYA 5F8UA 1QQ3A 1PY6A 5DYSA 2YLDA 3NY8A 3S8FB 4J4QA 5H2OA 5ETZA 4BEZA 1YZCA 4GP8B 4QI1A 1LM3B 3TOLA 3DQBA 4U9DA 1S8LA 5B35A 4NC3A 5JS5A 4DKLA 2F95A 2Z55A 1XMEB 3T45A 1P8UA 1GU8A 5JUAA 3VHZA 3C63A 4WGYA 4BV0A 1E85A 2XLEA 4CDAA 1BRDA 2WJKA 4HYXA 1S51A 1QKOA 5G28A 1S53A 1A7VA 2I21A 2Y01A 1APCA 5H2NA 4CJGA 4PXFA 1M0LA 3EH3B 5G53A 2XLVA 2XLOA 2XLDA 5G2AA 5FJGA 3COCA 3VVKA 3RFMA 3FOPA 5A45A 3SN6R 3OAXA 2M3GA 2YCWA 3X3BA 3QJTB 5BR5A 4L6RA 1QHJA 1DZEA 4MQSA 3PDSA 2J8WA 1JFPA 4ULVA 3HAOA 4XXJA 3ZTZA 4KNFA 2YCXA 4Y9HA 1MGYA 3NSBA 4GRVA 4WGZA 1XIOA 3QW0A 1H68A 1AP9A 4JQ6A 4FPDA 3NY9A 3OE0A 4IARA 5H2MA 3UONA 2QPEB 4K5YA 3VW7A 5G36A 4BEYA 5B6YA 1FBBA 5B6VA 3QDCA 3EH5B 3UTWA 4XT1A 3AYMA 5H2HA 4G72B 1X0K1 4WAVA 4BWBA 2XLHA 4WW3A 3VI0A 1NBBA 2JAGA 2XM4A 3QBLA 3QJUB 3QW1A 5JRAA 4X31A 2R4SA 1QM8A 3S3CB 3UG9A 1H2SA 2Y04A 1C8SA 1HZXA 3HAPA 4XT3A 4GP5B 1KGBA 1IW9A 2XL6A 5EN0A 1R2NA 1UAZA 5B6ZA 5JLIA 2HPYA 3ZWIA 5H2IA 3MBVA 5G2CA 1F50A 4U9EA 1BRRA 3ABWA 1TN0A 3NMKA 4GPOA 3OE6A 2XLMA 4D4NA 2YLIA 4IAQA 2WJLA 1X0I1 3VG9A 2XL8A 3PBLA 5AHZA 1QPUA 3A7KA 3M4CA 5B3IA 2NTWA 4FBZA 4JEBA 1VJMA 3VGAA 2EI4A 3AM6A 4MBSA 2ZIYA 2JAFA 1GZMA 1FBKA 1CGNA 1BBHA 4D4XA 3UTXA 4BUOA 4DJHA 3NMJA 3C9MA 1RCPA 2Z73A 4LDEA 2F93A 1YYJA 4G7QB 3S3DB 5B0WA 3S8GB 1E86A 1X0SA 1UCQA 5ITCA 1S05A 4MD2A 4UG2A 1L0MA 4LDLA 4G7SB 4IB4A 1JV7A 5JJJA 2KSBA 4FA7B 4JE9A 3DDLA 4ER9A 1JAFA 4X32A 3HNLA 5H2JA 1CWQA 4AMIA 2YDOA 3NMIA 5G2DA 3D4SA 2Y03A 5KKHA 2R4RA 3KJ6A 3ZEVA 2YCZA 2YLGA 2I1XA 3UTVA 5AGFA 4N6HA 1Q5IA 1GUEA 3QBKA 3PXOA 1BRXA 2LNLA 3M79A 1F4ZA 3S3BB 1P8HA 4JKVA 1F88A 2BC5A 1MQVA 3DE9A 4HWLA 4EIYA 2YL0A 3IQ5A 3EH4B 3QJRB 1CPRA 3QAKA 3UZAA 5AX1A 2XM0A 2YDVA 4JR8A 3ZTMA 4N4YB 5TGZA 3QAPA 3ZQYA 3HAQA 1LN6A 3HARA 4L35A 3ZQVA 1TN5A 2G87A 3OE9A 5B2NA 4EJ4A 4XTNA 3C9LA 1KG9A 2RH1A 4N4WA 5A8EA 5ITEA 3VRCA 3CODA 2YKZA 1KMEA 3M4BA 1VGOA 1M6TA 1IXFA 2I35A 3RZEA 1KG8A 5B6XA 3ZPQA 3HASA 3HNKA 1CPQA 1JGJA 4CDYA
chains in the Genus database with same CATH superfamily
5JP7A 3FOOA 4CX9A 1FFHA 3QBIA 4BEJA 2P6VA 3C7JA 1S54A 2X51A 5C1MA 3PQRA 5B3SC 1S8JA 2J4YA 3RYLA 2YL3A 1OQCA 1OW7A 1KU2A 1VK5A 1OR2A 3NYMA 3AQCA 1RMVA 4IJJA 3LNRA 1D0YA 3GODA 4DAJA 3IQ6A 5JVEA 4U5EE 2L9JA 1RJ9B 5F28E 2WZFA 1YZAA 2IYLD 4EWCA 3AG2C 5D91A 4XTOA 4CSAC 4U5DE 1GQAA 4P6IC 1TWAA 2Q9CA 2AT9A 3V2WA 4MTGA 4RBNA 3REYA 256BA 1GS9A 3NS0A 4G70B 1BR2A 4BJ5C 2DB4A 3FXHA 3L0IA 4J32B 3LEVA 4U5GA 4BEMJ 2R7VA 4Q7CA 1ZHTA 1LE2A 2QNLA 4XPYA 2J46A 5JT4A 3A11A 3B0PA 1VB5A 4C3BA 1XZQA 1L3PA 2WVNA 5KYXA 1HW2A 5FZTA 4CDVA 1Y4CA 4GYCA 4CS8C 2KJGA 3SNHA 3QJVB 4MQTA 3QJSB 3S84A 2PEDA 3UNGC 1YYXA 4AMJA 4U5BE 1ZHWA 3QVZA 3U8PA 3Q7GA 2CW0F 3B71A 1U19A 2WB7A 1MMNA 4JIOA 3U8VA 2KK1A 1ZYRF 1C02A 1CGME 4PFPA 3EHNA 1LPEA 2IXNA 3ABMC 1H9TA 4AL0A 2R7TA 1K05A 1SF8A 2CYDA 2CDQA 2DYSC 2D4UA 3IHUA 5H2OA 5ETZA 3FDQA 1OCOC 3FMSA 1KNYA 4U9DA 4MVSA 1S8LA 4AL1A 4Z9JA 3EZHA 5L0JA 1PD0A 2F95A 2Z55A 1XMEB 4EBKA 3W4YA 2EPNA 4AE4A 1GU8A 3VHZA 3I5PA 3W2WA 4UDVA 3IPMO 1QKOA 2A6HF 5G28A 1S53A 2JPUA 1MMDA 3SP1A 3MFNA 4GEHA 3JCUQ 4PXFA 2HSBA 2KNHA 1NLXA 2Q00A 2XLVA 2XLOA 1SMYF 3COCA 3SXKA 3VVKA 2AVKA 4YWQA 4IGGA 4YL3A 3WHNA 1FMVA 3SN6R 4XEFA 2M3GA 1BR1A 3QJTB 1ZHXA 4O79A 2R7UA 3PDSA 3V5ZA 4ULVA 1WOLA 5L0GA 4KNFA 1XIOA 4JQ6A 3OE0A 4IARA 5A6JA 5H2MA 3JSZA 2QPEB 2L81A 3NYJA 4K5YA 3VW7A 4BEYA 1FBBA 2P61A 5B6VA 4XLPF 2IXOA 1V54C 3AYMA 5H2HA 1TFKB 3ZIBA 1K04A 4YT4A 3JRMO 1G8XA 2GAQA 3V5YA 1LKXA 2A69F 5JRAA 4DRJB 4RD9A 3JYYA 3EFOB 3HAPA 4XT3A 2YEVA 4AX2A 1KGBA 1IW9A 3AGUA 3MYIA 4DBQA 5B6ZA 3KKBA 2YHSA 2LIGA 2HZ8A 5DS6A 1BRRA 1FMWA 3ABWA 4KI2A 1TN0A 3OE6A 4D4NA 2VB6A 4IAQA 2WJLA 1X0I1 4BJTA 4OD5A 1ORSC 1S7ZA 3PBLA 2IBFA 5DQZA 3AM6A 1TQGA 4NTFA 3QZCA 4KNVA 2IXPA 3LAYA 3UTXA 1TKNA 1XWJA 2MWQA 4DJHA 3NMJA 2R9RB 3AG4C 3C9MA 2J45A 3AG3C 5L0IA 3C8ZA 4NTAA 1E86A 5A6AA 2RSEB 2B0JA 4BJ5A 4UG2A 4LDLA 1JRAA 4U5FE 5F5FA 1ZVZA 3POVA 5L0HA 4JE9A 4X32A 2PX0A 3DKAA 2ICWG 5H2JA 4Z9HA 3DAGA 3MLGA 3TULA 2R4RA 1ZW3A 3K33A 3CQZA 4YK5A 3UTVA 5AGFA 1G4WR 2OJED 2W4BA 2WVOA 4OD4A 2YL0A 3JYHA 4GYTA 3EH4B 4CBEA 3NKEA 4YJWA 3UZAA 1Z7Qc 2G3VA 3DD7A 4EBJA 3R2PA 4A2NB 4GQHA 3ZQYA 3HAQA 3WAQA 4YL0A 4L35A 4YN0B 2ZPAA 3AJMA 1NFOA 4C7OB 3C9LA 2OQMA 2RH1A 5A8EA 5ITEA 2YKZA 1KMEA 1VGOA 4XTKA 3RVYA 3CEXA 3LNMB 1ZW2A 1SZIA 3HNKA 1EQ1A 1CPQA 1JGJA 2EPMX 5CIVA 2GFHA 3RW0A 3LS0A 5AHYA 2QPDB 4LDQA 4CIPA 2NUTB 4PJLA 2KS9A 3WODF 5COFA 4LDOA 5KYWA 1OCCC 2XXAB 3GORA 1VYIA 4EA3A 3E70C 2X72A 1ZHZA 5DQTA 4MVUA 1OKKD 3L1MA 1RJ9A 3N2ZB 3I4UA 3BVDB 3G50A 1G5ZA 1CGOA 3EGDA 1T6UA 1D1AA 3NG1A 3RF3A 1TR2A 4CJOA 3FAJA 4QDLA 3CAXA 1E2XA 1QKRA 3CZ6A 1H7IA 1QZXA 5JSLA 2ZZLA 3B0UX 1T5OA 2L7AA 2L6FA 2KSYA 2YL1A 3MX3A 3AYNA 4JEAA 1R84A 4X1HA 2J7PD 1SR2A 3HNIA 3O10A 3RIPA 4DVZA 5HSWA 2RD9A 3UZCA 3P0GA 4GBRA 1O87A 5H2LA 3UMHA 2GDCA 4WJ0A 4CSAA 5AX0A 2J9VA 1BM1A 2WZGA 4U5HA 1RKCA 2WL8A 4PJNA 1EKYA 2HKVA 2CCYA 1T9KA 1QKPA 4XWJA 5BQIA 1YLMA 2CNWA 2TMVP 1OCRC 1U6HA 5T1DB 1PCXA 2BRDA 4IWBA 3EGXA 2W9YA 5IY5C 3NKDA 3IQCA 4LDRA 2VT4A 3EQLF 5DS4A 3ZDLA 5B34A 1A0BA 4XTLA 4DOZA 2Q9BA 3T6JA 4O7GA 2KSAA 1E12A 1M0MA 3EZIA 3H65A 1E0PA 2HV6A 4NCQA 3QBGA 2NG1A 1WGWA 3X1OA 1K40A 2P7VA 1AUEA 4DRHB 2KYHA 5A44A 2VCBA 5DHHA 4MVOA 5KYYB 4N06A 1NU7D 4JJGA 5F8UA 5B1AC 4PJJA 3S8FB 4C3EA 1O5HA 3CSKA 4BEZA 4QI1A 1LM3B 3TOLA 4I1OB 5COGA 5B35A 5JS5A 4C7OA 4DVYP 4HEAJ 2UUIA 1FFTC 4K0DA 5JUAA 3C63A 4WGYA 1WATA 3HKKA 2NUPA 2XLEA 2WJKA 1S51A 3O55A 5T3WA 1LS4A 2QTVA 3ASOC 2JX0A 1A7VA 4MTOA 5E3CA 5B1BC 3Q6NA 1TWHA 2LFFA 1NZEA 3OWTA 2YQYA 1OCZC 1G4US 5G53A 2I15A 3ECSA 5G2AA 3NYLA 5DS5A 1GGQA 1HW1A 1H9GA 1UFBA 5BR5A 4KC9A 1QHJA 2HJMA 4ONSA 1JFPA 1R4TA 3NSBA 2PNOA 4WGZA 2Y69C 5T3TA 3B29A 3K7DA 3UONA 3L34A 5G36A 4ZLCA 2HJ3A 1Q0FA 1ZU5A 2XSEA 3W8IA 3BRJA 4J7YA 3U3FA 1X0K1 3LLIA 4XQ1A 1MNEA 2XLHA 3VI0A 1NBBA 4E18A 2O9XA 2XM4A 1RKEA 3QBLA 3QW1A 2R4SA 1QM8A 3S3CB 1I5NA 1C8SA 3IQTA 4PACA 2NUPB 4GP5B 5KYYA 2XL6A 3SXZA 4OIPF 2HPYA 3SZRA 5H2IA 4DJ9A 3MBVA 3ASNC 3TJ6A 1M2VA 3FAPB 3EHMA 2LSEA 2EIJC 4GPOA 4E7SA 2YLIA 2YRFA 3VG9A 1O3UA 1LVKA 4MVMA 2XL8A 3RQEA 2M4EA 5AHZA 1QPUA 2LFDA 3DM5A 2XXAA 1D1CA 4FBZA 2J9UA 3O39A 3VGAA 1QSPA 3S0XA 2EI4A 4MBSA 2ZIYA 3SYNA 3T6GB 1Q0DA 2WZLA 2H7OA 1RCPA 3DZAA 2Z73A 2F93A 2JD3A 3S3DB 2ZXPA 5KYUB 3QTHA 2IOQA 1X0SA 5F5HA 5BQHA 5E2QA 1S05A 4QI0A 4P9FA 4IB4A 4RDAA 4O6MA 3F46A 3DDLA 2H7VC 4MW8A 1VLTA 3NMIA 3C18A 2C03A 3S90A 3FVYA 2OU6A 1VTMP 5KKHA 4Q5SF 2PX3A 1L7CA 4A4AA 2YWAA 4EKWA 1OXBA 4I3MA 4ANJA 3ATPA 4JURI 1GUEA 2LP4A 3PXOA 2NUTA 2LNLA 3M79A 1P8HA 4JTCB 3PHF2 2BC5A 4W8KA 3DE9A 2PBEA 3E9VA 2NPUA 3VAYA 3WG7C 1CPRA 2PFDA 2XRHA 3TQOA 5AX1A 2XM0A 2R7QA 4FESA 2AWYA 4XLNF 2XS1A 3S28A 3ZTMA 4N4YB 1LN6A 3DJNB 5E3AA 4WABA 3OE9A 1LS1A 3VYWA 4EJ4A 1KG9A 1Z23A 1MMGA 5KYUA 1A41A 2GA0A 1Q0KA 2L6HA 1IXFA 1KG8A 4JCHA 2R7WA 5LWEA 3UGPA 4LDKA 1JR8A 1OW8A 4CS9A 2C04A 3TJ5A 1TWCA 3K1IA 4PR9A 2D5RB 4HYJA 2Y3DA 2ETSA 2I8BA 2P1AA 5H2PA 5G54A 1DOVA 1JMWA 3JRTA 4H54A 5JJNA 5AZDA 1HE9A 4R32A 1E83A 3GWNA 4YL1A 2Y3GA 1XJIA 3U2LA 5J7AA 1UG7A 4X0RA 3IEEA 1QLEC 1C8RA 3DWWA 2FAPB 5KYXB 1Q5JA 3U3BA 3ODUA 4N6CA 3M15A 3EFOA 1Z5ZA 2MYSA 3R7CA 3ZSUA 3JTLO 1V4AA 1NFNA 3QVYA 2H8AA 3UMIA 1BZ4A 4A4MA 1VYKA 1LI5A 1E84A 2WVQA 1XZPA 5AWZA 1S52A 4NQFA 5K0IA 1EHKB 5FCLA 1EA8A 5TJ5E 3K66A 4UHRA 1ST6A 4XEVA 1OKKA 5D92A 2E87A 4QIDA 1ORYA 1JOGA 1ZU4A 1P8IA 2Y02A 2G3KA 2MHRA 1KTMA 3T9OA 3RKOF 2YL7A 1D0XA 2Y00A 2EINC 1IZMA 1D0ZA 4EBBA 3W8HA 1T01A 1WWPA 1Q0GA 2IM8A 3W2VA 5A6BD 4XPXA 3PMRA 2W45A 4PXKA 1I4ZA 5BR2A 1ORJA 3OE8A 4G78A 2QE9A 4CS7A 5H2KA 3U9MA 3SEOA 1JPNA 5DHGA 3KL4A 4MVZA 3LLKA 3N24A 1WTYA 2EPKX 2QLAA 3EMLA 3X3CA 3EG9B 3H2VA 2I20A 1Y6DA 5B6WA 1V74B 2EIMC 4IAOA 2OG2A 3Q6MA 3H2UA 4KLYA 5E33A 3AG1C 1U89A 2FGYA 2KGOA 1J8MF 2YLDA 2V26A 3UMKA 1YZCA 4GP8B 3DQBA 4YT8A 3EPVA 5BUOA 5CI8A 2HFIA 4DKLA 2CNWD 3JZ0A 1GM5A 1P8UA 1YA9A 3GM3A 5A6BA 4CDAA 2I21A 3AQBA 2Y01A 3HTKC 5H2NA 4CJGA 3N0TA 1M0LA 1PV3A 3TD7A 3DM9B 2XLDA 4O6NA 3GANA 3SXMA 3FOPA 2ZXOA 2YCWA 3EG9A 1DZEA 3MBGA 4MQSA 3G4XA 3HJCA 3HAOA 2YCXA 2LCHA 1MGYA 2KQ9A 3HLZA 1AP9A 1FAPB 2W4MA 3NY9A 1SYQA 1A7EA 2KSFA 2EPOA 3PDMP 3UTWA 1NG1A 4G72B 2R05A 4WAVA 4E0HA 5EHHA 2LQGA 2JAGA 4CS9C 2NSFA 3QJUB 1V55C 4X31A 1H2SA 2Y04A 2ASRA 1HZXA 1HMDA 2Y3HA 4YT2A 3EGDB 1UAZA 2HMZA 5JLIA 3ZWIA 4W8PA 5G2CA 5DLJA 4U9EA 4JC7A 4CS8A 3RQFA 4ULWA 3A7KA 3M4CA 2LK4A 4BJ1A 4JJFA 1BDJB 2A1DD 1LIHA 2R7OA 3LEOA 1AVOB 3U9JA 2JAFA 1CGNA 4D4XA 4DBRA 5HV9A 1J8YF 2R7XA 4MNDA 2ZXWC 1MNDA 1HE1A 1C17M 3ITFA 4P9TA 1UCQA 4LERA 4MD2A 4PFOA 4G7SB 5JJJA 3X2QC 3GEIA 2EPLX 4DRIB 4ER9A 1JAFA 3JT1A 1CWQA 3GEHA 4OIQF 3D4SA 3K6BA 3LUTB 4PK4A 3I5QA 3KJ6A 4HFFB 4MVRA 4JVSA 3ABKC 2YCZA 2I1XA 5AC5A 4N6HA 1Q5IA 4F4BA 1BR4A 1Z63A 1F4ZA 2BE5F 1F88A 4HWLA 5KYNA 1W2WA 4MVQA 1HMOA 3DAFA 3QAKA 1Q0MA 2YDVA 2QUPA 2Y3BA 3QAPA 3HARA 2G87A 2DI3A 5B2NA 5BQGA 3EGXB 3L8IA 3M1CB 4XTNA 2EILC 4EUKB 2GWWA 4JRZA 3CODA 3LJBA 3M4BA 4J7TA 3T4RA 2I35A 2R03A 3RZEA 5B6XA 3ZPQA 2HV7A 3BEHA 2PF4E 5A69A 4CDYA 3GM2A 3PWHA 1FNTc 2EIKC 2XS8A 4G71B 1O0AA 3WQJA 4Q4ZF 4NY3A 1OXKA 2A0UA 4OINF 1OR3A 2HUJA 3OA1A 3KH2A 3ZPRA 2OJQA 4KBLA 5A6KA 1AT9A 3HANA 3HNJA 1VMAA 3K1IC 1RXQA 3KMIA 4GP4B 4FAAB 2HS5A 4AE4B 4XEKA 3RQGA 1PXRA 1I4YA 3ABLC 2NTUA 2R02A 3U2MA 4MD1A 1M0KA 2R7SA 2XLWA 1PXSA 5EK0A 1IW6A 1EI7A 1VOMA 4JW1A 1JV6A 4E0IA 3NYAA 1MMAA 3GM1A 3DMDA 2IXMA 3ZC4A 1F1MA 4G7RB 2ZFEA 2AWCA 3FHDA 3C8GD 2Z15A 4FWVA 4QI2A 4I44A 2OKUA 4E7ZA 2YCYA 4OV0A 3TOMA 5L0CA 4BVNA 2J9BA 1D1BA 2Y39A 3VM6A 3QJQB 4MTFA 4DXWA 4MW3A 4BJ6A 1IW7F 3GWLA 5L3VA 1ZZPA 3CAPA 2OEXA 2L6XA 1Z3IX 4G0HA 1ZHYA 1HY5A 3LS1A 5L0DA 1H6GA 1TWGA 1C3WA 2AU5A 4TL3A 1OW6A 4K1OA 2OOCA 3KYJA 5JJEA 4QRYA 4XPWA 2AP3A 4BG0A 4G7OF 4CIHA 1L9HA 3C8GB 4FX5A 1M2VB 2A0BA 3S29A 5GPGB 1VLSA 4MS2A 4J30B 2R7RA 3V2YA 3DE8A 3C62A 4U5CE 1DOWA 4K7BA 3UTYA 1M2OA 1QQ3A 3AGTA 1PY6A 5DYSA 3OEOA 3NY8A 4H4KC 1YARO 4J4QA 3QMKA 1JPJA 3L8JA 1NSGB 4MQ9F 4NC3A 2J0XA 1TFOB 1A7DA 3U5SA 3AOUA 2G62A 2J9WA 3T45A 2KC3A 3C8GA 4OIOF 4BV0A 1E85A 4I1MA 1BRDA 4HYXA 4E17A 1YA7O 3F47A 1YDIA 1APCA 3G4ZA 4HFKB 1WN0A 2Q9AA 3EH3B 5FJGA 3EH1A 3Q7LA 3J06A 3RFMA 3LESA 4YT5A 5A45A 2UUHA 3OAXA 2Q4FA 3X3BA 5CI9A 3MYFA 2B0HA 3T6BA 4L6RA 3US6A 3DI5A 5AC4A 2J8WA 3GEEA 4XXJA 3ZTZA 4Y9HA 2Q3TA 3S27A 4GRVA 3QW0A 1H68A 2VCCA 3ZVRA 4FPDA 4O6YA 4FAPB 2Q7RA 3UR3C 5B6YA 4BPMA 3QDCA 3EH5B 4BJ6C 4XT1A 1PD1A 1M56C 1YJGA 2VCAA 3KYIA 4BWBA 5L3QA 4WW3A 1B68A 3RFYA 1M57C 2CGEA 2ZXRA 4NTBA 2HSQA 2DGJA 4JTDB 2YZSA 3B9QA 1NU9C 1RKEB 4JTAB 5DVWA 3UG9A 4M63A 1T6IA 2ZD9A 5EN0A 2XL4A 1R2NA 3NRHA 3O6XA 3KPHA 1F50A 3DXJF 1AEPA 3V5XA 2YVKA 4DS7E 3NMKA 4G7HF 2XLMA 2VH3A 4PJMA 2R25A 2HMQA 5KYWB 3JSEO 1QVXA 5B3IA 2NTWA 4JCZA 1C03A 4JEBA 5L0FA 1VJMA 1U0BB 5COMA 1R5ID 4HE8D 1GZMA 1FBKA 1BBHA 2OEVA 3DJUB 5EGYA 2M64A 4BUOA 2VC9A 1YYJA 4LDEA 4AK9A 4LLEA 4G7QB 4Z9IA 5B0WA 3S8GB 3UGOA 1Z6AA 2VASA 2QY9A 2BL2A 2H7BA 3NDBB 1FR0A 5ITCA 4JZAA 1L0MA 4C3DA 1JV7A 2KSBA 4FA7B 2J0WA 1WASA 3HNLA 4AMIA 2YDOA 3A9CA 2V3CC 2NSGA 5G2DA 2Y03A 4LACB 3K1HA 3ZEVA 2YLGA 2PP4A 3QBKA 2A6EF 1BRXA 3VF0A 3S3BB 4OIRF 4JKVA 2A68F 3EJNA 1T6QA 1MQVA 4EIYA 1N1CA 2P0NA 1FTSA 3IQ5A 2L6GA 3QJRB 3PCVA 2J7PA 1LE4A 4KNWA 4JR8A 2FFHA 3RH3A 3SXYA 4IRUA 4ZLDA 5TGZA 2KW3C 2DYRC 4LLCA 2X0CA 2F22A 3RVZA 3ZG1A 3ZQVA 1TN5A 1LI7A 2OCCC 2LD6A 4B6IA 4N4WA 3S9OA 3VRCA 3TK0A 3V7OA 1M6TA 3U0CA 1YVIA 4G7ZF 3HASA 1YAUO 4EHPA 3EH2A 3B0VC
chains in the Genus database with same CATH topology
5LWEA 3PWHA 5JP7A 5AHYA 3FOOA 2QPDB 4CX9A 4G71B 1O0AA 4CIPA 3WQJA 2KS9A 3QBIA 4HYJA 1S54A 5C1MA 3PQRA 4LDOA 5H2PA 5G54A 3ZPRA 1AT9A 4EA3A 1S8JA 2J4YA 5JJNA 3HANA 3HNJA 2X72A 5AZDA 4GP4B 1E83A 2YL3A 4FAAB 1XJIA 5J7AA 1PXRA 3L1MA 3BVDB 2NTUA 1C8RA 1CGOA 4MD1A 1M0KA 1Q5JA 3ODUA 2XLWA 4CJOA 1PXSA 4DAJA 3M15A 1IW6A 3IQ6A 1JV6A 5JVEA 3NYAA 1YZAA 5JSLA 2ZZLA 4G7RB 2KSYA 2YL1A 3QVYA 2ZFEA 3AYNA 4XTOA 4A4MA 4JEAA 1R84A 1E84A 4X1HA 3HNIA 5AWZA 1S52A 1GQAA 2AT9A 3V2WA 3REYA 256BA 3UZCA 3P0GA 1EHKB 4GBRA 4UHRA 3NS0A 4G70B 5H2LA 2YCYA 4OV0A 3TOMA 5AX0A 4BVNA 2J9BA 1BM1A 4QIDA 1EKYA 3QJQB 2CCYA 1P8IA 2Y02A 2YL7A 1QKPA 2Y00A 3CAPA 2BRDA 5JT4A 2L6XA 4PXKA 2VT4A 5BR2A 4CDVA 4GYCA 3OE8A 5B34A 5H2KA 4XTLA 1C3WA 4TL3A 3QJVB 2KSAA 1E12A 1M0MA 4MQTA 5DHGA 3QJSB 1E0PA 5JJEA 4QRYA 3QBGA 2PEDA 1YYXA 4AMJA 1L9HA 3QVZA 3U8PA 2QLAA 3EMLA 3X3CA 5A44A 5DHHA 1U19A 2I20A 3V2YA 3DE8A 5B6WA 3C62A 4KLYA 3UTYA 5F8UA 1QQ3A 1PY6A 5DYSA 2YLDA 3NY8A 3S8FB 4J4QA 5H2OA 5ETZA 4BEZA 1YZCA 4GP8B 4QI1A 1LM3B 3TOLA 3DQBA 4U9DA 1S8LA 5B35A 4NC3A 5JS5A 4DKLA 2F95A 2Z55A 1XMEB 3T45A 1P8UA 1GU8A 5JUAA 3VHZA 3C63A 4WGYA 4BV0A 1E85A 2XLEA 4CDAA 1BRDA 2WJKA 4HYXA 1S51A 1QKOA 5G28A 1S53A 1A7VA 2I21A 2Y01A 1APCA 5H2NA 4CJGA 4PXFA 1M0LA 3EH3B 5G53A 2XLVA 2XLOA 2XLDA 5G2AA 5FJGA 3COCA 3VVKA 3RFMA 3FOPA 5A45A 3SN6R 3OAXA 2M3GA 2YCWA 3X3BA 3QJTB 5BR5A 4L6RA 1QHJA 1DZEA 4MQSA 3PDSA 2J8WA 1JFPA 4ULVA 3HAOA 4XXJA 3ZTZA 4KNFA 2YCXA 4Y9HA 1MGYA 3NSBA 4GRVA 4WGZA 1XIOA 3QW0A 1H68A 1AP9A 4JQ6A 4FPDA 3NY9A 3OE0A 4IARA 5H2MA 3UONA 2QPEB 4K5YA 3VW7A 5G36A 4BEYA 5B6YA 1FBBA 5B6VA 3QDCA 3EH5B 3UTWA 4XT1A 3AYMA 5H2HA 4G72B 1X0K1 4WAVA 4BWBA 2XLHA 4WW3A 3VI0A 1NBBA 2JAGA 2XM4A 3QBLA 3QJUB 3QW1A 5JRAA 4X31A 2R4SA 1QM8A 3S3CB 3UG9A 1H2SA 2Y04A 1C8SA 1HZXA 3HAPA 4XT3A 4GP5B 1KGBA 1IW9A 2XL6A 5EN0A 1R2NA 1UAZA 5B6ZA 5JLIA 2HPYA 3ZWIA 5H2IA 3MBVA 5G2CA 1F50A 4U9EA 1BRRA 3ABWA 4DS7E 1TN0A 3NMKA 4GPOA 3OE6A 2XLMA 4D4NA 2YLIA 4IAQA 2WJLA 1X0I1 3VG9A 2XL8A 3PBLA 5AHZA 1QPUA 3A7KA 3M4CA 5B3IA 2NTWA 4FBZA 4JEBA 1VJMA 3VGAA 2EI4A 3AM6A 4MBSA 2ZIYA 2JAFA 1GZMA 1FBKA 1CGNA 1BBHA 4D4XA 3UTXA 4BUOA 4DJHA 3NMJA 3C9MA 1RCPA 2Z73A 4LDEA 2F93A 1YYJA 4G7QB 3S3DB 5B0WA 3S8GB 1E86A 1X0SA 1UCQA 5ITCA 1S05A 4MD2A 4UG2A 1L0MA 4LDLA 4G7SB 4IB4A 1JV7A 5JJJA 2KSBA 4FA7B 4JE9A 3DDLA 4ER9A 1JAFA 4X32A 3HNLA 5H2JA 1CWQA 4AMIA 2YDOA 3NMIA 5G2DA 3D4SA 2Y03A 5KKHA 2R4RA 3KJ6A 3ZEVA 2YCZA 2YLGA 2I1XA 3UTVA 5AGFA 4N6HA 1Q5IA 1GUEA 3QBKA 3PXOA 1BRXA 2LNLA 3M79A 1F4ZA 3S3BB 1P8HA 4JKVA 1F88A 2BC5A 1MQVA 3DE9A 4HWLA 4EIYA 2YL0A 3IQ5A 3EH4B 3QJRB 1CPRA 3QAKA 3UZAA 5AX1A 2XM0A 2YDVA 4JR8A 3ZTMA 4N4YB 5TGZA 3QAPA 3ZQYA 3HAQA 1LN6A 3HARA 4L35A 3ZQVA 1TN5A 2G87A 3OE9A 5B2NA 4EJ4A 4XTNA 3C9LA 1KG9A 2RH1A 4N4WA 5A8EA 5ITEA 3VRCA 3CODA 2YKZA 1KMEA 3M4BA 1VGOA 1M6TA 1IXFA 2I35A 3RZEA 1KG8A 5B6XA 3ZPQA 3HASA 3HNKA 1CPQA 1JGJA 4CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LWE A;  3PWH A;  5JP7 A;  5AHY A;  3FOO A;  2QPD B;  4CX9 A;  4G71 B;  1O0A A;  4CIP A;  3WQJ A;  2KS9 A;  3QBI A;  4HYJ A;  1S54 A;  5C1M A;  3PQR A;  4LDO A;  5H2P A;  5G54 A;  3ZPR A;  1AT9 A;  4EA3 A;  1S8J A;  2J4Y A;  5JJN A;  3HAN A;  3HNJ A;  2X72 A;  5AZD A;  4GP4 B;  1E83 A;  2YL3 A;  4FAA B;  1XJI A;  5J7A A;  1PXR A;  3L1M A;  3BVD B;  2NTU A;  1C8R A;  1CGO A;  4MD1 A;  1M0K A;  1Q5J A;  3ODU A;  2XLW A;  4CJO A;  1PXS A;  4DAJ A;  3M15 A;  1IW6 A;  3IQ6 A;  1JV6 A;  5JVE A;  3NYA A;  1YZA A;  5JSL A;  2ZZL A;  4G7R B;  2KSY A;  2YL1 A;  3QVY A;  2ZFE A;  3AYN A;  4XTO A;  4A4M A;  4JEA A;  1R84 A;  1E84 A;  4X1H A;  3HNI A;  5AWZ A;  1S52 A;  1GQA A;  2AT9 A;  3V2W A;  3REY A;  256B A;  3UZC A;  3P0G A;  1EHK B;  4GBR A;  4UHR A;  3NS0 A;  4G70 B;  5H2L A;  2YCY A;  4OV0 A;  3TOM A;  5AX0 A;  4BVN A;  2J9B A;  1BM1 A;  4QID A;  1EKY A;  3QJQ B;  2CCY A;  1P8I A;  2Y02 A;  2YL7 A;  1QKP A;  2Y00 A;  3CAP A;  2BRD A;  5JT4 A;  2L6X A;  4PXK A;  2VT4 A;  5BR2 A;  4CDV A;  4GYC A;  3OE8 A;  5B34 A;  5H2K A;  4XTL A;  1C3W A;  4TL3 A;  3QJV B;  2KSA A;  1E12 A;  1M0M A;  4MQT A;  5DHG A;  3QJS B;  1E0P A;  5JJE A;  4QRY A;  3QBG A;  2PED A;  1YYX A;  4AMJ A;  1L9H A;  3QVZ A;  3U8P A;  2QLA A;  3EML A;  3X3C A;  5A44 A;  5DHH A;  1U19 A;  2I20 A;  3V2Y A;  3DE8 A;  5B6W A;  3C62 A;  4KLY A;  3UTY A;  5F8U A;  1QQ3 A;  1PY6 A;  5DYS A;  2YLD A;  3NY8 A;  3S8F B;  4J4Q A;  5H2O A;  5ETZ A;  4BEZ A;  1YZC A;  4GP8 B;  4QI1 A;  1LM3 B;  3TOL A;  3DQB A;  4U9D A;  1S8L A;  5B35 A;  4NC3 A;  5JS5 A;  4DKL A;  2F95 A;  2Z55 A;  1XME B;  3T45 A;  1P8U A;  1GU8 A;  5JUA A;  3VHZ A;  3C63 A;  4WGY A;  4BV0 A;  1E85 A;  2XLE A;  4CDA A;  1BRD A;  2WJK A;  4HYX A;  1S51 A;  1QKO A;  5G28 A;  1S53 A;  1A7V A;  2I21 A;  2Y01 A;  1APC A;  5H2N A;  4CJG A;  4PXF A;  1M0L A;  3EH3 B;  5G53 A;  2XLV A;  2XLO A;  2XLD A;  5G2A A;  5FJG A;  3COC A;  3VVK A;  3RFM A;  3FOP A;  5A45 A;  3SN6 R;  3OAX A;  2M3G A;  2YCW A;  3X3B A;  3QJT B;  5BR5 A;  4L6R A;  1QHJ A;  1DZE A;  4MQS A;  3PDS A;  2J8W A;  1JFP A;  4ULV A;  3HAO A;  4XXJ A;  3ZTZ A;  4KNF A;  2YCX A;  4Y9H A;  1MGY A;  3NSB A;  4GRV A;  4WGZ A;  1XIO A;  3QW0 A;  1H68 A;  1AP9 A;  4JQ6 A;  4FPD A;  3NY9 A;  3OE0 A;  4IAR A;  5H2M A;  3UON A;  2QPE B;  4K5Y A;  3VW7 A;  5G36 A;  4BEY A;  5B6Y A;  1FBB A;  5B6V A;  3QDC A;  3EH5 B;  3UTW A;  4XT1 A;  3AYM A;  5H2H A;  4G72 B;  1X0K 1;  4WAV A;  4BWB A;  2XLH A;  4WW3 A;  3VI0 A;  1NBB A;  2JAG A;  2XM4 A;  3QBL A;  3QJU B;  3QW1 A;  5JRA A;  4X31 A;  2R4S A;  1QM8 A;  3S3C B;  3UG9 A;  1H2S A;  2Y04 A;  1C8S A;  1HZX A;  3HAP A;  4XT3 A;  4GP5 B;  1KGB A;  1IW9 A;  2XL6 A;  5EN0 A;  1R2N A;  1UAZ A;  5B6Z A;  5JLI A;  2HPY A;  3ZWI A;  5H2I A;  3MBV A;  5G2C A;  1F50 A;  4U9E A;  1BRR A;  3ABW A;  1TN0 A;  3NMK A;  4GPO A;  3OE6 A;  2XLM A;  4D4N A;  2YLI A;  4IAQ A;  2WJL A;  1X0I 1;  3VG9 A;  2XL8 A;  3PBL A;  5AHZ A;  1QPU A;  3A7K A;  3M4C A;  5B3I A;  2NTW A;  4FBZ A;  4JEB A;  1VJM A;  3VGA A;  2EI4 A;  3AM6 A;  4MBS A;  2ZIY A;  2JAF A;  1GZM A;  1FBK A;  1CGN A;  1BBH A;  4D4X A;  3UTX A;  4BUO A;  4DJH A;  3NMJ A;  3C9M A;  1RCP A;  2Z73 A;  4LDE A;  2F93 A;  1YYJ A;  4G7Q B;  3S3D B;  5B0W A;  3S8G B;  1E86 A;  1X0S A;  1UCQ A;  5ITC A;  1S05 A;  4MD2 A;  4UG2 A;  1L0M A;  4LDL A;  4G7S B;  4IB4 A;  1JV7 A;  5JJJ A;  2KSB A;  4FA7 B;  4JE9 A;  3DDL A;  4ER9 A;  1JAF A;  4X32 A;  3HNL A;  5H2J A;  1CWQ A;  4AMI A;  2YDO A;  3NMI A;  5G2D A;  3D4S A;  2Y03 A;  5KKH A;  2R4R A;  3KJ6 A;  3ZEV A;  2YCZ A;  2YLG A;  2I1X A;  3UTV A;  5AGF A;  4N6H A;  1Q5I A;  1GUE A;  3QBK A;  3PXO A;  1BRX A;  2LNL A;  3M79 A;  1F4Z A;  3S3B B;  1P8H A;  4JKV A;  1F88 A;  2BC5 A;  1MQV A;  3DE9 A;  4HWL A;  4EIY A;  2YL0 A;  3IQ5 A;  3EH4 B;  3QJR B;  1CPR A;  3QAK A;  3UZA A;  5AX1 A;  2XM0 A;  2YDV A;  4JR8 A;  3ZTM A;  4N4Y B;  5TGZ A;  3QAP A;  3ZQY A;  3HAQ A;  1LN6 A;  3HAR A;  4L35 A;  3ZQV A;  1TN5 A;  2G87 A;  3OE9 A;  5B2N A;  4EJ4 A;  4XTN A;  3C9L A;  1KG9 A;  2RH1 A;  4N4W A;  5A8E A;  5ITE A;  3VRC A;  3COD A;  2YKZ A;  1KME A;  3M4B A;  1VGO A;  1M6T A;  1IXF A;  2I35 A;  3RZE A;  1KG8 A;  5B6X A;  3ZPQ A;  3HAS A;  3HNK A;  1CPQ A;  1JGJ A;  4CDY A; 
#chains in the Genus database with same CATH topology
 5JP7 A;  3FOO A;  4CX9 A;  1FFH A;  3QBI A;  4BEJ A;  2P6V A;  3C7J A;  1S54 A;  2X51 A;  5C1M A;  3PQR A;  5B3S C;  1S8J A;  2J4Y A;  3RYL A;  2YL3 A;  1OQC A;  1OW7 A;  1KU2 A;  1VK5 A;  1OR2 A;  3NYM A;  3AQC A;  1RMV A;  4IJJ A;  3LNR A;  1D0Y A;  3GOD A;  4DAJ A;  3IQ6 A;  5JVE A;  4U5E E;  2L9J A;  1RJ9 B;  5F28 E;  2WZF A;  1YZA A;  2IYL D;  4EWC A;  3AG2 C;  5D91 A;  4XTO A;  4CSA C;  4U5D E;  1GQA A;  4P6I C;  1TWA A;  2Q9C A;  2AT9 A;  3V2W A;  4MTG A;  4RBN A;  3REY A;  256B A;  1GS9 A;  3NS0 A;  4G70 B;  1BR2 A;  4BJ5 C;  2DB4 A;  3FXH A;  3L0I A;  4J32 B;  3LEV A;  4U5G A;  4BEM J;  2R7V A;  4Q7C A;  1ZHT A;  1LE2 A;  2QNL A;  4XPY A;  2J46 A;  5JT4 A;  3A11 A;  3B0P A;  1VB5 A;  4C3B A;  1XZQ A;  1L3P A;  2WVN A;  5KYX A;  1HW2 A;  5FZT A;  4CDV A;  1Y4C A;  4GYC A;  4CS8 C;  2KJG A;  3SNH A;  3QJV B;  4MQT A;  3QJS B;  3S84 A;  2PED A;  3UNG C;  1YYX A;  4AMJ A;  4U5B E;  1ZHW A;  3QVZ A;  3U8P A;  3Q7G A;  2CW0 F;  3B71 A;  1U19 A;  2WB7 A;  1MMN A;  4JIO A;  3U8V A;  2KK1 A;  1ZYR F;  1C02 A;  1CGM E;  4PFP A;  3EHN A;  1LPE A;  2IXN A;  3ABM C;  1H9T A;  4AL0 A;  2R7T A;  1K05 A;  1SF8 A;  2CYD A;  2CDQ A;  2DYS C;  2D4U A;  3IHU A;  5H2O A;  5ETZ A;  3FDQ A;  1OCO C;  3FMS A;  1KNY A;  4U9D A;  4MVS A;  1S8L A;  4AL1 A;  4Z9J A;  3EZH A;  5L0J A;  1PD0 A;  2F95 A;  2Z55 A;  1XME B;  4EBK A;  3W4Y A;  2EPN A;  4AE4 A;  1GU8 A;  3VHZ A;  3I5P A;  3W2W A;  4UDV A;  3IPM O;  1QKO A;  2A6H F;  5G28 A;  1S53 A;  2JPU A;  1MMD A;  3SP1 A;  3MFN A;  4GEH A;  3JCU Q;  4PXF A;  2HSB A;  2KNH A;  1NLX A;  2Q00 A;  2XLV A;  2XLO A;  1SMY F;  3COC A;  3SXK A;  3VVK A;  2AVK A;  4YWQ A;  4IGG A;  4YL3 A;  3WHN A;  1FMV A;  3SN6 R;  4XEF A;  2M3G A;  1BR1 A;  3QJT B;  1ZHX A;  4O79 A;  2R7U A;  3PDS A;  3V5Z A;  4ULV A;  1WOL A;  5L0G A;  4KNF A;  1XIO A;  4JQ6 A;  3OE0 A;  4IAR A;  5A6J A;  5H2M A;  3JSZ A;  2QPE B;  2L81 A;  3NYJ A;  4K5Y A;  3VW7 A;  4BEY A;  1FBB A;  2P61 A;  5B6V A;  4XLP F;  2IXO A;  1V54 C;  3AYM A;  5H2H A;  1TFK B;  3ZIB A;  1K04 A;  4YT4 A;  3JRM O;  1G8X A;  2GAQ A;  3V5Y A;  1LKX A;  2A69 F;  5JRA A;  4DRJ B;  4RD9 A;  3JYY A;  3EFO B;  3HAP A;  4XT3 A;  2YEV A;  4AX2 A;  1KGB A;  1IW9 A;  3AGU A;  3MYI A;  4DBQ A;  5B6Z A;  3KKB A;  2YHS A;  2LIG A;  2HZ8 A;  5DS6 A;  1BRR A;  1FMW A;  3ABW A;  4KI2 A;  1TN0 A;  3OE6 A;  4D4N A;  2VB6 A;  4IAQ A;  2WJL A;  1X0I 1;  4BJT A;  4OD5 A;  1ORS C;  1S7Z A;  3PBL A;  2IBF A;  5DQZ A;  3AM6 A;  1TQG A;  4NTF A;  3QZC A;  4KNV A;  2IXP A;  3LAY A;  3UTX A;  1TKN A;  1XWJ A;  2MWQ A;  4DJH A;  3NMJ A;  2R9R B;  3AG4 C;  3C9M A;  2J45 A;  3AG3 C;  5L0I A;  3C8Z A;  4NTA A;  1E86 A;  5A6A A;  2RSE B;  2B0J A;  4BJ5 A;  4UG2 A;  4LDL A;  1JRA A;  4U5F E;  5F5F A;  1ZVZ A;  3POV A;  5L0H A;  4JE9 A;  4X32 A;  2PX0 A;  3DKA A;  2ICW G;  5H2J A;  4Z9H A;  3DAG A;  3MLG A;  3TUL A;  2R4R A;  1ZW3 A;  3K33 A;  3CQZ A;  4YK5 A;  3UTV A;  5AGF A;  1G4W R;  2OJE D;  2W4B A;  2WVO A;  4OD4 A;  2YL0 A;  3JYH A;  4GYT A;  3EH4 B;  4CBE A;  3NKE A;  4YJW A;  3UZA A;  1Z7Q c;  2G3V A;  3DD7 A;  4EBJ A;  3R2P A;  4A2N B;  4GQH A;  3ZQY A;  3HAQ A;  3WAQ A;  4YL0 A;  4L35 A;  4YN0 B;  2ZPA A;  3AJM A;  1NFO A;  4C7O B;  3C9L A;  2OQM A;  2RH1 A;  5A8E A;  5ITE A;  2YKZ A;  1KME A;  1VGO A;  4XTK A;  3RVY A;  3CEX A;  3LNM B;  1ZW2 A;  1SZI A;  3HNK A;  1EQ1 A;  1CPQ A;  1JGJ A;  2EPM X;  5CIV A;  2GFH A;  3RW0 A;  3LS0 A;  5AHY A;  2QPD B;  4LDQ A;  4CIP A;  2NUT B;  4PJL A;  2KS9 A;  3WOD F;  5COF A;  4LDO A;  5KYW A;  1OCC C;  2XXA B;  3GOR A;  1VYI A;  4EA3 A;  3E70 C;  2X72 A;  1ZHZ A;  5DQT A;  4MVU A;  1OKK D;  3L1M A;  1RJ9 A;  3N2Z B;  3I4U A;  3BVD B;  3G50 A;  1G5Z A;  1CGO A;  3EGD A;  1T6U A;  1D1A A;  3NG1 A;  3RF3 A;  1TR2 A;  4CJO A;  3FAJ A;  4QDL A;  3CAX A;  1E2X A;  1QKR A;  3CZ6 A;  1H7I A;  1QZX A;  5JSL A;  2ZZL A;  3B0U X;  1T5O A;  2L7A A;  2L6F A;  2KSY A;  2YL1 A;  3MX3 A;  3AYN A;  4JEA A;  1R84 A;  4X1H A;  2J7P D;  1SR2 A;  3HNI A;  3O10 A;  3RIP A;  4DVZ A;  5HSW A;  2RD9 A;  3UZC A;  3P0G A;  4GBR A;  1O87 A;  5H2L A;  3UMH A;  2GDC A;  4WJ0 A;  4CSA A;  5AX0 A;  2J9V A;  1BM1 A;  2WZG A;  4U5H A;  1RKC A;  2WL8 A;  4PJN A;  1EKY A;  2HKV A;  2CCY A;  1T9K A;  1QKP A;  4XWJ A;  5BQI A;  1YLM A;  2CNW A;  2TMV P;  1OCR C;  1U6H A;  5T1D B;  1PCX A;  2BRD A;  4IWB A;  3EGX A;  2W9Y A;  5IY5 C;  3NKD A;  3IQC A;  4LDR A;  2VT4 A;  3EQL F;  5DS4 A;  3ZDL A;  5B34 A;  1A0B A;  4XTL A;  4DOZ A;  2Q9B A;  3T6J A;  4O7G A;  2KSA A;  1E12 A;  1M0M A;  3EZI A;  3H65 A;  1E0P A;  2HV6 A;  4NCQ A;  3QBG A;  2NG1 A;  1WGW A;  3X1O A;  1K40 A;  2P7V A;  1AUE A;  4DRH B;  2KYH A;  5A44 A;  2VCB A;  5DHH A;  4MVO A;  5KYY B;  4N06 A;  1NU7 D;  4JJG A;  5F8U A;  5B1A C;  4PJJ A;  3S8F B;  4C3E A;  1O5H A;  3CSK A;  4BEZ A;  4QI1 A;  1LM3 B;  3TOL A;  4I1O B;  5COG A;  5B35 A;  5JS5 A;  4C7O A;  4DVY P;  4HEA J;  2UUI A;  1FFT C;  4K0D A;  5JUA A;  3C63 A;  4WGY A;  1WAT A;  3HKK A;  2NUP A;  2XLE A;  2WJK A;  1S51 A;  3O55 A;  5T3W A;  1LS4 A;  2QTV A;  3ASO C;  2JX0 A;  1A7V A;  4MTO A;  5E3C A;  5B1B C;  3Q6N A;  1TWH A;  2LFF A;  1NZE A;  3OWT A;  2YQY A;  1OCZ C;  1G4U S;  5G53 A;  2I15 A;  3ECS A;  5G2A A;  3NYL A;  5DS5 A;  1GGQ A;  1HW1 A;  1H9G A;  1UFB A;  5BR5 A;  4KC9 A;  1QHJ A;  2HJM A;  4ONS A;  1JFP A;  1R4T A;  3NSB A;  2PNO A;  4WGZ A;  2Y69 C;  5T3T A;  3B29 A;  3K7D A;  3UON A;  3L34 A;  5G36 A;  4ZLC A;  2HJ3 A;  1Q0F A;  1ZU5 A;  2XSE A;  3W8I A;  3BRJ A;  4J7Y A;  3U3F A;  1X0K 1;  3LLI A;  4XQ1 A;  1MNE A;  2XLH A;  3VI0 A;  1NBB A;  4E18 A;  2O9X A;  2XM4 A;  1RKE A;  3QBL A;  3QW1 A;  2R4S A;  1QM8 A;  3S3C B;  1I5N A;  1C8S A;  3IQT A;  4PAC A;  2NUP B;  4GP5 B;  5KYY A;  2XL6 A;  3SXZ A;  4OIP F;  2HPY A;  3SZR A;  5H2I A;  4DJ9 A;  3MBV A;  3ASN C;  3TJ6 A;  1M2V A;  3FAP B;  3EHM A;  2LSE A;  2EIJ C;  4GPO A;  4E7S A;  2YLI A;  2YRF A;  3VG9 A;  1O3U A;  1LVK A;  4MVM A;  2XL8 A;  3RQE A;  2M4E A;  5AHZ A;  1QPU A;  2LFD A;  3DM5 A;  2XXA A;  1D1C A;  4FBZ A;  2J9U A;  3O39 A;  3VGA A;  1QSP A;  3S0X A;  2EI4 A;  4MBS A;  2ZIY A;  3SYN A;  3T6G B;  1Q0D A;  2WZL A;  2H7O A;  1RCP A;  3DZA A;  2Z73 A;  2F93 A;  2JD3 A;  3S3D B;  2ZXP A;  5KYU B;  3QTH A;  2IOQ A;  1X0S A;  5F5H A;  5BQH A;  5E2Q A;  1S05 A;  4QI0 A;  4P9F A;  4IB4 A;  4RDA A;  4O6M A;  3F46 A;  3DDL A;  2H7V C;  4MW8 A;  1VLT A;  3NMI A;  3C18 A;  2C03 A;  3S90 A;  3FVY A;  2OU6 A;  1VTM P;  5KKH A;  4Q5S F;  2PX3 A;  1L7C A;  4A4A A;  2YWA A;  4EKW A;  1OXB A;  4I3M A;  4ANJ A;  3ATP A;  4JUR I;  1GUE A;  2LP4 A;  3PXO A;  2NUT A;  2LNL A;  3M79 A;  1P8H A;  4JTC B;  3PHF 2;  2BC5 A;  4W8K A;  3DE9 A;  2PBE A;  3E9V A;  2NPU A;  3VAY A;  3WG7 C;  1CPR A;  2PFD A;  2XRH A;  3TQO A;  5AX1 A;  2XM0 A;  2R7Q A;  4FES A;  2AWY A;  4XLN F;  2XS1 A;  3S28 A;  3ZTM A;  4N4Y B;  1LN6 A;  3DJN B;  5E3A A;  4WAB A;  3OE9 A;  1LS1 A;  3VYW A;  4EJ4 A;  1KG9 A;  1Z23 A;  1MMG A;  5KYU A;  1A41 A;  2GA0 A;  1Q0K A;  2L6H A;  1IXF A;  1KG8 A;  4JCH A;  2R7W A;  5LWE A;  3UGP A;  4LDK A;  1JR8 A;  1OW8 A;  4CS9 A;  2C04 A;  3TJ5 A;  1TWC A;  3K1I A;  4PR9 A;  2D5R B;  4HYJ A;  2Y3D A;  2ETS A;  2I8B A;  2P1A A;  5H2P A;  5G54 A;  1DOV A;  1JMW A;  3JRT A;  4H54 A;  5JJN A;  5AZD A;  1HE9 A;  4R32 A;  1E83 A;  3GWN A;  4YL1 A;  2Y3G A;  1XJI A;  3U2L A;  5J7A A;  1UG7 A;  4X0R A;  3IEE A;  1QLE C;  1C8R A;  3DWW A;  2FAP B;  5KYX B;  1Q5J A;  3U3B A;  3ODU A;  4N6C A;  3M15 A;  3EFO A;  1Z5Z A;  2MYS A;  3R7C A;  3ZSU A;  3JTL O;  1V4A A;  1NFN A;  3QVY A;  2H8A A;  3UMI A;  1BZ4 A;  4A4M A;  1VYK A;  1LI5 A;  1E84 A;  2WVQ A;  1XZP A;  5AWZ A;  1S52 A;  4NQF A;  5K0I A;  1EHK B;  5FCL A;  1EA8 A;  5TJ5 E;  3K66 A;  4UHR A;  1ST6 A;  4XEV A;  1OKK A;  5D92 A;  2E87 A;  4QID A;  1ORY A;  1JOG A;  1ZU4 A;  1P8I A;  2Y02 A;  2G3K A;  2MHR A;  1KTM A;  3T9O A;  3RKO F;  2YL7 A;  1D0X A;  2Y00 A;  2EIN C;  1IZM A;  1D0Z A;  4EBB A;  3W8H A;  1T01 A;  1WWP A;  1Q0G A;  2IM8 A;  3W2V A;  5A6B D;  4XPX A;  3PMR A;  2W45 A;  4PXK A;  1I4Z A;  5BR2 A;  1ORJ A;  3OE8 A;  4G78 A;  2QE9 A;  4CS7 A;  5H2K A;  3U9M A;  3SEO A;  1JPN A;  5DHG A;  3KL4 A;  4MVZ A;  3LLK A;  3N24 A;  1WTY A;  2EPK X;  2QLA A;  3EML A;  3X3C A;  3EG9 B;  3H2V A;  2I20 A;  1Y6D A;  5B6W A;  1V74 B;  2EIM C;  4IAO A;  2OG2 A;  3Q6M A;  3H2U A;  4KLY A;  5E33 A;  3AG1 C;  1U89 A;  2FGY A;  2KGO A;  1J8M F;  2YLD A;  2V26 A;  3UMK A;  1YZC A;  4GP8 B;  3DQB A;  4YT8 A;  3EPV A;  5BUO A;  5CI8 A;  2HFI A;  4DKL A;  2CNW D;  3JZ0 A;  1GM5 A;  1P8U A;  1YA9 A;  3GM3 A;  5A6B A;  4CDA A;  2I21 A;  3AQB A;  2Y01 A;  3HTK C;  5H2N A;  4CJG A;  3N0T A;  1M0L A;  1PV3 A;  3TD7 A;  3DM9 B;  2XLD A;  4O6N A;  3GAN A;  3SXM A;  3FOP A;  2ZXO A;  2YCW A;  3EG9 A;  1DZE A;  3MBG A;  4MQS A;  3G4X A;  3HJC A;  3HAO A;  2YCX A;  2LCH A;  1MGY A;  2KQ9 A;  3HLZ A;  1AP9 A;  1FAP B;  2W4M A;  3NY9 A;  1SYQ A;  1A7E A;  2KSF A;  2EPO A;  3PDM P;  3UTW A;  1NG1 A;  4G72 B;  2R05 A;  4WAV A;  4E0H A;  5EHH A;  2LQG A;  2JAG A;  4CS9 C;  2NSF A;  3QJU B;  1V55 C;  4X31 A;  1H2S A;  2Y04 A;  2ASR A;  1HZX A;  1HMD A;  2Y3H A;  4YT2 A;  3EGD B;  1UAZ A;  2HMZ A;  5JLI A;  3ZWI A;  4W8P A;  5G2C A;  5DLJ A;  4U9E A;  4JC7 A;  4CS8 A;  3RQF A;  4ULW A;  3A7K A;  3M4C A;  2LK4 A;  4BJ1 A;  4JJF A;  1BDJ B;  2A1D D;  1LIH A;  2R7O A;  3LEO A;  1AVO B;  3U9J A;  2JAF A;  1CGN A;  4D4X A;  4DBR A;  5HV9 A;  1J8Y F;  2R7X A;  4MND A;  2ZXW C;  1MND A;  1HE1 A;  1C17 M;  3ITF A;  4P9T A;  1UCQ A;  4LER A;  4MD2 A;  4PFO A;  4G7S B;  5JJJ A;  3X2Q C;  3GEI A;  2EPL X;  4DRI B;  4ER9 A;  1JAF A;  3JT1 A;  1CWQ A;  3GEH A;  4OIQ F;  3D4S A;  3K6B A;  3LUT B;  4PK4 A;  3I5Q A;  3KJ6 A;  4HFF B;  4MVR A;  4JVS A;  3ABK C;  2YCZ A;  2I1X A;  5AC5 A;  4N6H A;  1Q5I A;  4F4B A;  1BR4 A;  1Z63 A;  1F4Z A;  2BE5 F;  1F88 A;  4HWL A;  5KYN A;  1W2W A;  4MVQ A;  1HMO A;  3DAF A;  3QAK A;  1Q0M A;  2YDV A;  2QUP A;  2Y3B A;  3QAP A;  3HAR A;  2G87 A;  2DI3 A;  5B2N A;  5BQG A;  3EGX B;  3L8I A;  3M1C B;  4XTN A;  2EIL C;  4EUK B;  2GWW A;  4JRZ A;  3COD A;  3LJB A;  3M4B A;  4J7T A;  3T4R A;  2I35 A;  2R03 A;  3RZE A;  5B6X A;  3ZPQ A;  2HV7 A;  3BEH A;  2PF4 E;  5A69 A;  4CDY A;  3GM2 A;  3PWH A;  1FNT c;  2EIK C;  2XS8 A;  4G71 B;  1O0A A;  3WQJ A;  4Q4Z F;  4NY3 A;  1OXK A;  2A0U A;  4OIN F;  1OR3 A;  2HUJ A;  3OA1 A;  3KH2 A;  3ZPR A;  2OJQ A;  4KBL A;  5A6K A;  1AT9 A;  3HAN A;  3HNJ A;  1VMA A;  3K1I C;  1RXQ A;  3KMI A;  4GP4 B;  4FAA B;  2HS5 A;  4AE4 B;  4XEK A;  3RQG A;  1PXR A;  1I4Y A;  3ABL C;  2NTU A;  2R02 A;  3U2M A;  4MD1 A;  1M0K A;  2R7S A;  2XLW A;  1PXS A;  5EK0 A;  1IW6 A;  1EI7 A;  1VOM A;  4JW1 A;  1JV6 A;  4E0I A;  3NYA A;  1MMA A;  3GM1 A;  3DMD A;  2IXM A;  3ZC4 A;  1F1M A;  4G7R B;  2ZFE A;  2AWC A;  3FHD A;  3C8G D;  2Z15 A;  4FWV A;  4QI2 A;  4I44 A;  2OKU A;  4E7Z A;  2YCY A;  4OV0 A;  3TOM A;  5L0C A;  4BVN A;  2J9B A;  1D1B A;  2Y39 A;  3VM6 A;  3QJQ B;  4MTF A;  4DXW A;  4MW3 A;  4BJ6 A;  1IW7 F;  3GWL A;  5L3V A;  1ZZP A;  3CAP A;  2OEX A;  2L6X A;  1Z3I X;  4G0H A;  1ZHY A;  1HY5 A;  3LS1 A;  5L0D A;  1H6G A;  1TWG A;  1C3W A;  2AU5 A;  4TL3 A;  1OW6 A;  4K1O A;  2OOC A;  3KYJ A;  5JJE A;  4QRY A;  4XPW A;  2AP3 A;  4BG0 A;  4G7O F;  4CIH A;  1L9H A;  3C8G B;  4FX5 A;  1M2V B;  2A0B A;  3S29 A;  5GPG B;  1VLS A;  4MS2 A;  4J30 B;  2R7R A;  3V2Y A;  3DE8 A;  3C62 A;  4U5C E;  1DOW A;  4K7B A;  3UTY A;  1M2O A;  1QQ3 A;  3AGT A;  1PY6 A;  5DYS A;  3OEO A;  3NY8 A;  4H4K C;  1YAR O;  4J4Q A;  3QMK A;  1JPJ A;  3L8J A;  1NSG B;  4MQ9 F;  4NC3 A;  2J0X A;  1TFO B;  1A7D A;  3U5S A;  3AOU A;  2G62 A;  2J9W A;  3T45 A;  2KC3 A;  3C8G A;  4OIO F;  4BV0 A;  1E85 A;  4I1M A;  1BRD A;  4HYX A;  4E17 A;  1YA7 O;  3F47 A;  1YDI A;  1APC A;  3G4Z A;  4HFK B;  1WN0 A;  2Q9A A;  3EH3 B;  5FJG A;  3EH1 A;  3Q7L A;  3J06 A;  3RFM A;  3LES A;  4YT5 A;  5A45 A;  2UUH A;  3OAX A;  2Q4F A;  3X3B A;  5CI9 A;  3MYF A;  2B0H A;  3T6B A;  4L6R A;  3US6 A;  3DI5 A;  5AC4 A;  2J8W A;  3GEE A;  4XXJ A;  3ZTZ A;  4Y9H A;  2Q3T A;  3S27 A;  4GRV A;  3QW0 A;  1H68 A;  2VCC A;  3ZVR A;  4FPD A;  4O6Y A;  4FAP B;  2Q7R A;  3UR3 C;  5B6Y A;  4BPM A;  3QDC A;  3EH5 B;  4BJ6 C;  4XT1 A;  1PD1 A;  1M56 C;  1YJG A;  2VCA A;  3KYI A;  4BWB A;  5L3Q A;  4WW3 A;  1B68 A;  3RFY A;  1M57 C;  2CGE A;  2ZXR A;  4NTB A;  2HSQ A;  2DGJ A;  4JTD B;  2YZS A;  3B9Q A;  1NU9 C;  1RKE B;  4JTA B;  5DVW A;  3UG9 A;  4M63 A;  1T6I A;  2ZD9 A;  5EN0 A;  2XL4 A;  1R2N A;  3NRH A;  3O6X A;  3KPH A;  1F50 A;  3DXJ F;  1AEP A;  3V5X A;  2YVK A;  4DS7 E;  3NMK A;  4G7H F;  2XLM A;  2VH3 A;  4PJM A;  2R25 A;  2HMQ A;  5KYW B;  3JSE O;  1QVX A;  5B3I A;  2NTW A;  4JCZ A;  1C03 A;  4JEB A;  5L0F A;  1VJM A;  1U0B B;  5COM A;  1R5I D;  4HE8 D;  1GZM A;  1FBK A;  1BBH A;  2OEV A;  3DJU B;  5EGY A;  2M64 A;  4BUO A;  2VC9 A;  1YYJ A;  4LDE A;  4AK9 A;  4LLE A;  4G7Q B;  4Z9I A;  5B0W A;  3S8G B;  3UGO A;  1Z6A A;  2VAS A;  2QY9 A;  2BL2 A;  2H7B A;  3NDB B;  1FR0 A;  5ITC A;  4JZA A;  1L0M A;  4C3D A;  1JV7 A;  2KSB A;  4FA7 B;  2J0W A;  1WAS A;  3HNL A;  4AMI A;  2YDO A;  3A9C A;  2V3C C;  2NSG A;  5G2D A;  2Y03 A;  4LAC B;  3K1H A;  3ZEV A;  2YLG A;  2PP4 A;  3QBK A;  2A6E F;  1BRX A;  3VF0 A;  3S3B B;  4OIR F;  4JKV A;  2A68 F;  3EJN A;  1T6Q A;  1MQV A;  4EIY A;  1N1C A;  2P0N A;  1FTS A;  3IQ5 A;  2L6G A;  3QJR B;  3PCV A;  2J7P A;  1LE4 A;  4KNW A;  4JR8 A;  2FFH A;  3RH3 A;  3SXY A;  4IRU A;  4ZLD A;  5TGZ A;  2KW3 C;  2DYR C;  4LLC A;  2X0C A;  2F22 A;  3RVZ A;  3ZG1 A;  3ZQV A;  1TN5 A;  1LI7 A;  2OCC C;  2LD6 A;  4B6I A;  4N4W A;  3S9O A;  3VRC A;  3TK0 A;  3V7O A;  1M6T A;  3U0C A;  1YVI A;  4G7Z F;  3HAS A;  1YAU O;  4EHP A;  3EH2 A;  3B0V C; 
#chains in the Genus database with same CATH homology
 5LWE A;  3PWH A;  5JP7 A;  5AHY A;  3FOO A;  2QPD B;  4CX9 A;  4G71 B;  1O0A A;  4CIP A;  3WQJ A;  2KS9 A;  3QBI A;  4HYJ A;  1S54 A;  5C1M A;  3PQR A;  4LDO A;  5H2P A;  5G54 A;  3ZPR A;  1AT9 A;  4EA3 A;  1S8J A;  2J4Y A;  5JJN A;  3HAN A;  3HNJ A;  2X72 A;  5AZD A;  4GP4 B;  1E83 A;  2YL3 A;  4FAA B;  1XJI A;  5J7A A;  1PXR A;  3L1M A;  3BVD B;  2NTU A;  1C8R A;  1CGO A;  4MD1 A;  1M0K A;  1Q5J A;  3ODU A;  2XLW A;  4CJO A;  1PXS A;  4DAJ A;  3M15 A;  1IW6 A;  3IQ6 A;  1JV6 A;  5JVE A;  3NYA A;  1YZA A;  5JSL A;  2ZZL A;  4G7R B;  2KSY A;  2YL1 A;  3QVY A;  2ZFE A;  3AYN A;  4XTO A;  4A4M A;  4JEA A;  1R84 A;  1E84 A;  4X1H A;  3HNI A;  5AWZ A;  1S52 A;  1GQA A;  2AT9 A;  3V2W A;  3REY A;  256B A;  3UZC A;  3P0G A;  1EHK B;  4GBR A;  4UHR A;  3NS0 A;  4G70 B;  5H2L A;  2YCY A;  4OV0 A;  3TOM A;  5AX0 A;  4BVN A;  2J9B A;  1BM1 A;  4QID A;  1EKY A;  3QJQ B;  2CCY A;  1P8I A;  2Y02 A;  2YL7 A;  1QKP A;  2Y00 A;  3CAP A;  2BRD A;  5JT4 A;  2L6X A;  4PXK A;  2VT4 A;  5BR2 A;  4CDV A;  4GYC A;  3OE8 A;  5B34 A;  5H2K A;  4XTL A;  1C3W A;  4TL3 A;  3QJV B;  2KSA A;  1E12 A;  1M0M A;  4MQT A;  5DHG A;  3QJS B;  1E0P A;  5JJE A;  4QRY A;  3QBG A;  2PED A;  1YYX A;  4AMJ A;  1L9H A;  3QVZ A;  3U8P A;  2QLA A;  3EML A;  3X3C A;  5A44 A;  5DHH A;  1U19 A;  2I20 A;  3V2Y A;  3DE8 A;  5B6W A;  3C62 A;  4KLY A;  3UTY A;  5F8U A;  1QQ3 A;  1PY6 A;  5DYS A;  2YLD A;  3NY8 A;  3S8F B;  4J4Q A;  5H2O A;  5ETZ A;  4BEZ A;  1YZC A;  4GP8 B;  4QI1 A;  1LM3 B;  3TOL A;  3DQB A;  4U9D A;  1S8L A;  5B35 A;  4NC3 A;  5JS5 A;  4DKL A;  2F95 A;  2Z55 A;  1XME B;  3T45 A;  1P8U A;  1GU8 A;  5JUA A;  3VHZ A;  3C63 A;  4WGY A;  4BV0 A;  1E85 A;  2XLE A;  4CDA A;  1BRD A;  2WJK A;  4HYX A;  1S51 A;  1QKO A;  5G28 A;  1S53 A;  1A7V A;  2I21 A;  2Y01 A;  1APC A;  5H2N A;  4CJG A;  4PXF A;  1M0L A;  3EH3 B;  5G53 A;  2XLV A;  2XLO A;  2XLD A;  5G2A A;  5FJG A;  3COC A;  3VVK A;  3RFM A;  3FOP A;  5A45 A;  3SN6 R;  3OAX A;  2M3G A;  2YCW A;  3X3B A;  3QJT B;  5BR5 A;  4L6R A;  1QHJ A;  1DZE A;  4MQS A;  3PDS A;  2J8W A;  1JFP A;  4ULV A;  3HAO A;  4XXJ A;  3ZTZ A;  4KNF A;  2YCX A;  4Y9H A;  1MGY A;  3NSB A;  4GRV A;  4WGZ A;  1XIO A;  3QW0 A;  1H68 A;  1AP9 A;  4JQ6 A;  4FPD A;  3NY9 A;  3OE0 A;  4IAR A;  5H2M A;  3UON A;  2QPE B;  4K5Y A;  3VW7 A;  5G36 A;  4BEY A;  5B6Y A;  1FBB A;  5B6V A;  3QDC A;  3EH5 B;  3UTW A;  4XT1 A;  3AYM A;  5H2H A;  4G72 B;  1X0K 1;  4WAV A;  4BWB A;  2XLH A;  4WW3 A;  3VI0 A;  1NBB A;  2JAG A;  2XM4 A;  3QBL A;  3QJU B;  3QW1 A;  5JRA A;  4X31 A;  2R4S A;  1QM8 A;  3S3C B;  3UG9 A;  1H2S A;  2Y04 A;  1C8S A;  1HZX A;  3HAP A;  4XT3 A;  4GP5 B;  1KGB A;  1IW9 A;  2XL6 A;  5EN0 A;  1R2N A;  1UAZ A;  5B6Z A;  5JLI A;  2HPY A;  3ZWI A;  5H2I A;  3MBV A;  5G2C A;  1F50 A;  4U9E A;  1BRR A;  3ABW A;  4DS7 E;  1TN0 A;  3NMK A;  4GPO A;  3OE6 A;  2XLM A;  4D4N A;  2YLI A;  4IAQ A;  2WJL A;  1X0I 1;  3VG9 A;  2XL8 A;  3PBL A;  5AHZ A;  1QPU A;  3A7K A;  3M4C A;  5B3I A;  2NTW A;  4FBZ A;  4JEB A;  1VJM A;  3VGA A;  2EI4 A;  3AM6 A;  4MBS A;  2ZIY A;  2JAF A;  1GZM A;  1FBK A;  1CGN A;  1BBH A;  4D4X A;  3UTX A;  4BUO A;  4DJH A;  3NMJ A;  3C9M A;  1RCP A;  2Z73 A;  4LDE A;  2F93 A;  1YYJ A;  4G7Q B;  3S3D B;  5B0W A;  3S8G B;  1E86 A;  1X0S A;  1UCQ A;  5ITC A;  1S05 A;  4MD2 A;  4UG2 A;  1L0M A;  4LDL A;  4G7S B;  4IB4 A;  1JV7 A;  5JJJ A;  2KSB A;  4FA7 B;  4JE9 A;  3DDL A;  4ER9 A;  1JAF A;  4X32 A;  3HNL A;  5H2J A;  1CWQ A;  4AMI A;  2YDO A;  3NMI A;  5G2D A;  3D4S A;  2Y03 A;  5KKH A;  2R4R A;  3KJ6 A;  3ZEV A;  2YCZ A;  2YLG A;  2I1X A;  3UTV A;  5AGF A;  4N6H A;  1Q5I A;  1GUE A;  3QBK A;  3PXO A;  1BRX A;  2LNL A;  3M79 A;  1F4Z A;  3S3B B;  1P8H A;  4JKV A;  1F88 A;  2BC5 A;  1MQV A;  3DE9 A;  4HWL A;  4EIY A;  2YL0 A;  3IQ5 A;  3EH4 B;  3QJR B;  1CPR A;  3QAK A;  3UZA A;  5AX1 A;  2XM0 A;  2YDV A;  4JR8 A;  3ZTM A;  4N4Y B;  5TGZ A;  3QAP A;  3ZQY A;  3HAQ A;  1LN6 A;  3HAR A;  4L35 A;  3ZQV A;  1TN5 A;  2G87 A;  3OE9 A;  5B2N A;  4EJ4 A;  4XTN A;  3C9L A;  1KG9 A;  2RH1 A;  4N4W A;  5A8E A;  5ITE A;  3VRC A;  3COD A;  2YKZ A;  1KME A;  3M4B A;  1VGO A;  1M6T A;  1IXF A;  2I35 A;  3RZE A;  1KG8 A;  5B6X A;  3ZPQ A;  3HAS A;  3HNK A;  1CPQ A;  1JGJ A;  4CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...