4N6HA

1.8 a structure of the human delta opioid 7tm receptor (psi community target)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
408
structure length
408
Chain Sequence
b'DLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562, Delta-type opioid receptor chimeric
molecule tags Signaling protein
source organism Escherichia coli
publication title Molecular control of delta-opioid receptor signalling.
pubmed doi rcsb
total genus 175
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2013-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n6hA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n6hA02
3BVDB 4MD2A 3U8PA 2YDVA 4DAJA 4PXFA 4CDVA 1JGJA 1BRRA 2G87A 1S51A 1UAZA 3M15A 3QDCA 4X31A 1XJIA 5EN0A 1YZCA 2XM0A 2YKZA 1GU8A 1JV6A 4GRVA 3ZEVA 3EH3B 4WW3A 3NMKA 3QW1A 1GQAA 3ABWA 4QRYA 1YYXA 1E85A 1P8HA 3AM6A 1E84A 4GP5B 1BBHA 4G7RB 4G71B 5H2MA 2PEDA 3C9LA 4TL3A 4FBZA 2YL7A 3IQ5A 3HAOA 3QBGA 4G70B 5H2PA 4G7QB 5F8UA 2XLDA 3NYAA 1JV7A 2I20A 1UCQA 4ER9A 1FBBA 3NMIA 4WAVA 3QJUB 1MQVA 4J4QA 2YCXA 1C8SA 4AMJA 3QJRB 4CDYA 4QIDA 4XT1A 4CJGA 2WJLA 3ZQVA 5B6ZA 5G2AA 2EI4A 2WJKA 4BEYA 5B34A 1P8UA 5B3IA 5ETZA 1XIOA 1KMEA 4UG2A 5DHHA 4ULVA 4BVNA 4JEAA 4G7SB 2XLMA 3DQBA 3QJVB 1FBKA 1KG9A 3PBLA 5AHZA 4CDAA 3NS0A 1E86A 3NMJA 5G2DA 5ITEA 1QQ3A 5KKHA 1QM8A 4GPOA 3CAPA 5AWZA 2L6XA 1QHJA 1R84A 4LDOA 4N4WA 5FJGA 2JAFA 3AYNA 3T45A 3QBIA 4MQTA 3X3BA 3HNJA 3OE0A 4KNFA 2Y00A 3UTVA 5JLIA 3UONA 2HPYA 3QJQB 5B6XA 1RCPA 2YLGA 5JSLA 2YCWA 2XLHA 1VGOA 1LN6A 3HNIA 3QJSB 2XM4A 1JFPA 2R4RA 2BRDA 1F4ZA 1S53A 3C63A 1L9HA 3VI0A 3UG9A 5JT4A 5B2NA 3QAPA 2RH1A 1H68A 1C3WA 1S54A 3VVKA 1IXFA 1VJMA 5H2JA 1APCA 5AX1A 3A7KA 3ODUA 3PDSA 4PXKA 3UZAA 5JJJA 2BC5A 5JUAA 4G72B 4LDLA 4FAAB 1E12A 3P0GA 5JVEA 4XTOA 2F93A 5B35A 1GUEA 1M0LA 3X3CA 2ZZLA 1R2NA 4D4XA 2QPEB 3HARA 3VRCA 1TN5A 1P8IA 2XL6A 1MGYA 2YL1A 5JJEA 3M4BA 3UZCA 3REYA 3QAKA 2YDOA 5B6VA 4X1HA 5JJNA 1PY6A 1QPUA 3HAPA 4QI1A 4XTNA 3CODA 1E0PA 1CPQA 2JAGA 5AX0A 4N6HA 1CGNA 5H2KA 3QBKA 4UHRA 4BV0A 4K5YA 3UTXA 3DDLA 5H2HA 4EJ4A 3HNKA 5ITCA 3NSBA 3QW0A 3PQRA 4HYXA 4IAQA 5B6YA 1IW9A 2YCYA 2X72A 1EKYA 1XMEB 4NC3A 2KSYA 1F88A 1IW6A 5G28A 3S3CB 2NTUA 1S8JA 2XLVA 2M3GA 3COCA 4HWLA 2YLDA 3D4SA 5JS5A 4JKVA 1DZEA 4JE9A 2Y02A 4MBSA 2QLAA 5AGFA 4BWBA 4X32A 2F95A 1X0SA 4MQSA 3KJ6A 3NY9A 5DYSA 2KSBA 3FOPA 2I35A 5G53A 5H2LA 3ZQYA 1GZMA 3QBLA 4LDEA 4U9DA 3V2WA 2I21A 5H2IA 4IB4A 3HNLA 4N4YB 3EMLA 3RFMA 3S3BB 5AHYA 3PWHA 1QKOA 3UTWA 5J7AA 1H2SA 3OE9A 1CGOA 3M79A 2I1XA 3VW7A 4JR8A 3RZEA 4CIPA 2YLIA 2CCYA 5G2CA 1C8RA 2QPDB 1S52A 4BEZA 3EH5B 1EHKB 3AYMA 2Y03A 4FA7B 3ZTZA 2YL0A 3S8GB 3OE8A 1NBBA 3PXOA 5B6WA 4GP8B 5A45A 2XL8A 2NTWA 4XTLA 4AMIA 5BR2A 2XLEA 2J9BA 4KLYA 3TOMA 2Y04A 5H2NA 3DE8A 1KGBA 2ZIYA 5G36A 3OE6A 1A7VA 1CPRA 1S8LA 5H2OA 1PXSA 1X0I1 1M0MA 1PXRA 1TN0A 5TGZA 4FPDA 2J8WA 3VG9A 2AT9A 1U19A 1YYJA 1YZAA 3M4CA 4D4NA 4L6RA 5G54A 3S8FB 3ZWIA 2R4SA 2ZFEA 4DJHA 5JP7A 3V2YA 3HASA 4A4MA 3QVZA 3ZPRA 4XXJA 2J4YA 5DHGA 1BRXA 3FOOA 4U9EA 4IARA 5LWEA 1QKPA 2XLOA 3NY8A 3VHZA 1JAFA 5A44A 1F50A 4JQ6A 4CJOA 3UTYA 5JRAA 4L35A 3OAXA 5A8EA 4OV0A 2Z73A 4BUOA 3VGAA 4GBRA 4CX9A 3DE9A 2XLWA 5AZDA 1BM1A 1L0MA 3QJTB 1LM3B 3QVYA 1AT9A 4GYCA 3HANA 4WGYA 5B0WA 3C62A 3ZPQA 1CWQA 2LNLA 4GP4B 3EH4B 4Y9HA 3S3DB 1O0AA 1BRDA 4EA3A 4DKLA 3ZTMA 3C9MA 1X0K1 1Q5JA 2Z55A 4XT3A 5BR5A 3IQ6A 1Q5IA 4HYJA 3SN6R 1HZXA 4MD1A 1AP9A 2Y01A 2KSAA 2YL3A 3TOLA 3L1MA 2KS9A 4EIYA 5C1MA 3HAQA 3WQJA 1M6TA 1M0KA 2VT4A 3MBVA 1S05A 1E83A 256BA 4WGZA 1KG8A 4JEBA 2YCZA
chains in the Genus database with same CATH superfamily
2IM8A 2OEVA 4MD2A 4O6MA 2YDVA 2RSEB 2EIMC 2G87A 1S51A 3M15A 3QDCA 5EN0A 3LS1A 3SXMA 4BJ5A 2Y39A 3EH3B 4JIOA 4FWVA 4G7RB 2VC9A 2L6HA 2PEDA 3L34A 3IQ5A 2UUIA 3IPMO 2Q7RA 3QBGA 3ZDLA 2XS8A 5H2PA 5GPGB 5A6KA 2WVNA 2OJQA 3NYAA 4DRHB 5CIVA 3S90A 2ICWG 1UCQA 4ER9A 2NUTA 1M2OA 2R03A 2NG1A 3C8GB 4NTFA 1C8SA 4XT1A 3ASOC 1R4TA 5B6ZA 2EI4A 2PX0A 3LESA 1XIOA 1D1BA 1QLEC 2R02A 4EHPA 4BVNA 2XLMA 4IJJA 3PMRA 3DQBA 1MMAA 4YL0A 3TJ5A 3V5ZA 4MVUA 5G2DA 5E33A 3O6XA 1QQ3A 3ABLC 4GPOA 3M1CB 3FDQA 1HW1A 2EIKC 3VAYA 5AWZA 1I4YA 3RFYA 3OA1A 5KYUB 2HMZA 5FJGA 2JAFA 3AYNA 3QBIA 1YA9A 4KNFA 3QJQB 1RCPA 1LE4A 3RYLA 3H2VA 2YCWA 1VGOA 3QJSB 2XM4A 2R4RA 1S53A 3C63A 2PNOA 3K1IC 4LERA 3QAPA 1T9KA 2RH1A 1C3WA 1VYKA 1VJMA 1APCA 3ODUA 3UZAA 3R7CA 5B1AC 2NSGA 4LDLA 1V4AA 2KQ9A 1G4WR 4DJ9A 1I5NA 2AU5A 1GM5A 4ULWA 4AE4B 3HARA 1P8IA 2Q9BA 2WZFA 2YL1A 3DM5A 4J7TA 4KC9A 3UZCA 1KNYA 3REYA 2YDOA 2HJ3A 3HAPA 4QI1A 3C8GA 4B6IA 1CPQA 4N6HA 3S84A 5E3AA 2PBEA 5H2KA 4BV0A 2NUPB 1G8XA 2D4UA 3C7JA 5ITCA 3C8ZA 2R7SA 3KPHA 3NG1A 2YCYA 3GODA 1G5ZA 1EKYA 2DYSC 4N6CA 3Q7GA 2KSYA 3GM1A 3VYWA 2NTUA 1S8JA 2P1AA 1Y6DA 4OD5A 2HFIA 3LLKA 5KYXB 1OCCC 2WZGA 5JS5A 1WATA 4MBSA 2HKVA 4LACB 4LDRA 4FX5A 4O79A 2YQYA 2R05A 3FOPA 3G4XA 2I35A 5G53A 2YEVA 3DKAA 1PV3A 1TWAA 3LNMB 3QBLA 1NFOA 4MVSA 3JYHA 3GEHA 2ASRA 1WWPA 1NG1A 3J06A 4NTAA 4IB4A 1DOVA 3HNLA 5KYUA 3RFMA 3K6BA 2R7RA 1HE9A 3X1OA 1OCZC 5AHYA 4NCQA 2W4MA 4JJFA 4GQHA 4JRZA 4XEFA 3EG9A 1YDIA 1MMGA 2CCYA 1JMWA 4HE8D 5L3QA 3ZTZA 2LFDA 2YL0A 3S8GB 4P9FA 4XTKA 3PXOA 4GP8B 3ASNC 2XL8A 3K1HA 2J0XA 1U0BB 4XTLA 5AC4A 2XLEA 5H2NA 2WZLA 1SF8A 4K1OA 1H6GA 5H2OA 3O39A 3GORA 3GWLA 3I4UA 4I3MA 1TKNA 3CQZA 1PXRA 1TN0A 2YHSA 3EG9B 1BDJB 3S0XA 1KU2A 4WABA 2AT9A 1U19A 1OR3A 2VCCA 3S8FB 3C8GD 3KKBA 2R4SA 1J8YF 2V26A 4DOZA 2W9YA 4PJJA 2M4EA 3JRTA 1J8MF 3W2VA 4BJ6A 1BRXA 3G4ZA 1VMAA 3S29A 1RJ9A 5HSWA 2VB6A 2XRHA 4WJ0A 1UG7A 2WVQA 3WG7C 4CJOA 1YJGA 2B0HA 3GEEA 4MVOA 4BUOA 2QY9A 3VGAA 4I1MA 2HZ8A 3U3FA 3AOUA 3QVYA 1AT9A 5DQTA 3B0PA 3MX3A 3SP1A 2OG2A 3AG3C 2A68F 4OD4A 3UMIA 5BQGA 1OW8A 3GM2A 4PK4A 4GP4B 4MQ9F 1I4ZA 2EPOA 2HV6A 2KC3A 4FESA 4EKWA 4MTOA 2HMQA 2R7VA 1X0K1 1EA8A 4YWQA 5AC5A 1V74B 5B3SC 1HZXA 3CSKA 3U2MA 4E7ZA 1K05A 5IY5C 3U8VA 2XL4A 3MLGA 2H7OA 2LFFA 1M0KA 1TWGA 4JJGA 5A6AA 4JEBA 3HANA 3B9QA 4JZAA 2MYSA 3JZ0A 2A1DD 4PXFA 3WAQA 4PACA 3TQOA 1UAZA 2J7PD 1XJIA 4X31A 2IBFA 4CBEA 3BEHA 2YKZA 1JOGA 3GM3A 3MBGA 4YT5A 1T01A 5KYXA 4GEHA 4MTGA 1O87A 2NUPA 4QRYA 1ZHXA 3SEOA 4G7OF 1ZW2A 4PJLA 4K0DA 3C9LA 4TL3A 4NTBA 2YL7A 3E70C 5L0JA 3HAOA 4P6IC 4G70B 1ZHYA 4XLPF 1A7EA 2I20A 3EH1A 1MQVA 3UNGC 4AMJA 4QIDA 3DZAA 4JURI 3ZQVA 2FAPB 5L0HA 5B3IA 5ETZA 1C17M 3RVZA 3JYYA 3HJCA 4U5GA 4UG2A 3AG4C 5DHHA 3AQBA 4ULVA 4JEAA 4G7SB 4RDAA 2AVKA 3QJVB 1LS1A 1LS4A 3LS0A 4JTCB 4JCZA 4G7HF 5ITEA 2CNWA 2PFDA 2E87A 3H65A 1WOLA 5DS4A 4CS9C 1T6UA 2QNLA 2P0NA 3X3BA 3HNJA 4CS8A 3UONA 4OIPF 1UFBA 5B6XA 2YLGA 2R7QA 4BEJA 2XLHA 2OQMA 4BJ6C 1ZU4A 1EI7A 1F4ZA 3RKOF 3NYMA 4ANJA 1VTMP 4C7OA 5JT4A 2HUJA 5B2NA 4OINF 1H68A 3VVKA 5H2JA 2EIJC 5T3WA 3PDSA 3RQGA 1GGQA 4YT2A 2HV7A 1AUEA 3P0GA 5JVEA 3S9OA 1QVXA 4NY3A 5B35A 3X3CA 2LIGA 3PDMP 5FCLA 1TN5A 3EZIA 2XL6A 1DOWA 1MGYA 4RBNA 1VLSA 5COGA 3QAKA 4X1HA 2BE5F 2D5RB 1QPUA 2PP4A 4R32A 5F28E 4IWBA 3CODA 1T6QA 2GDCA 2Y69C 4K5YA 3UTXA 4EJ4A 2P7VA 5D91A 4HYXA 1IW9A 2KJGA 2J46A 3C18A 4Z9IA 4NC3A 2YZSA 3ABKC 1IW6A 3S3CB 5KYYA 2XLVA 2M3GA 1OKKA 4DRJB 2YLDA 2IXPA 2Q4FA 4QI2A 4JKVA 2KNHA 2Y02A 2QLAA 1Q0GA 4X0RA 4J30B 4G0HA 3FVYA 4E7SA 4YL1A 4XPXA 2EPKX 2JD3A 5KYWB 5H2LA 5HV9A 1K40A 1JPJA 1ZHZA 2EINC 1FTSA 1Z7Qc 5A6BA 1W2WA 2XXAB 5H2IA 2CYDA 1O3UA 1IZMA 3S3BB 4XWJA 2J45A 3KMIA 5COFA 1ZHWA 2EPNA 1CGOA 3EHNA 4BJ5C 2R7XA 2Y3GA 3HLZA 2I1XA 4YL3A 3RZEA 2YLIA 3DAGA 5G2CA 1C8RA 1S52A 4BEZA 1EHKB 2GFHA 3PCVA 2Y03A 5L0CA 4Q7CA 3O10A 3OE8A 1NBBA 3GWNA 5TJ5E 4PR9A 1Q0DA 2G3VA 1WGWA 2NTWA 1VK5A 4AMIA 2X0CA 3TOMA 1LPEA 2Y04A 3DE8A 1KGBA 2UUHA 5G36A 1A7VA 1AEPA 1S8LA 2H7VC 3L8JA 3R2PA 4IRUA 3U0CA 5L0GA 4Z9JA 3U9JA 1N1CA 4MTFA 2NSFA 1X0I1 3BRJA 2DGJA 4U5EE 5D92A 3RQEA 3DM9B 3AG1C 2EPLX 1S7ZA 1YZAA 4O7GA 2R7OA 5DQZA 1M56C 4ONSA 2ZFEA 4AX2A 3V2YA 2KSFA 3Q7LA 3HASA 1OCOC 3DXJF 4A4MA 3QVZA 1K04A 5EK0A 3AJMA 5DHGA 4DRIB 2CW0F 1PD1A 4IARA 1BR2A 3NRHA 2ZD9A 3VHZA 1HMOA 1F50A 4JQ6A 2ZXPA 3EGXA 3S28A 3U5SA 2Y3HA 5JRAA 1HW2A 3OAXA 2LCHA 2CDQA 4MVZA 3DE9A 2A6EF 4QI0A 1L0MA 2XS1A 3K1IA 3LEVA 2LP4A 3SNHA 3W8HA 3T6BA 2LD6A 3ZPQA 2AWYA 3EFOA 4JW1A 3JRMO 3IQCA 3S3DB 1O0AA 4G78A 2FGYA 1Q5JA 2TMVP 1CGME 3RVYA 3IQ6A 4HYJA 2DI3A 1XZQA 3DJUB 2KSAA 3JSEO 3ZVRA 1TWCA 4H4KC 3HAQA 1NLXA 3TD7A 1M2VB 3EGXB 4XPWA 2L6GA 1M2VA 5A69A 3U8PA 4CDVA 3QMKA 1GU8A 1JV6A 2OCCC 4GRVA 4G7ZF 3WHNA 3EZHA 3K33A 3QW1A 3TJ6A 5EHHA 1E85A 1P8HA 1E84A 4GP5B 1Q0MA 3EFOB 1OW7A 3ZC4A 4G7QB 2XLDA 3EH2A 1JV7A 1ZYRF 3AQCA 4AE4A 1YVIA 4J4QA 2YRFA 3DMDA 4LDQA 5DLJA 3AGTA 5CI9A 3QJRB 3LLIA 4C3EA 5K0IA 2WJKA 3SXKA 1P8UA 1OQCA 3ECSA 5B1BC 1MNEA 3RF3A 3NYLA 4DS7E 1FBKA 1KG9A 1ST6A 4CDAA 3GEIA 3NS0A 1E86A 5DS5A 5KKHA 1QM8A 2CNWD 4U5CE 1LI7A 2AWCA 2C03A 3H2UA 1QHJA 4LDOA 4JTDB 3W2WA 1F1MA 3V5XA 3AG2C 4E0IA 3T45A 4MQTA 2Q9AA 4P9TA 3IHUA 4A4AA 3TULA 2OKUA 1R5ID 1FFHA 2L81A 5JSLA 1ZHTA 4U5BE 1NZEA 1L7CA 1LN6A 1WASA 3HNIA 3K7DA 1JFPA 2VH3A 2BRDA 5BQIA 3EPVA 3RQFA 3VI0A 3W4YA 1OCRC 3EGDB 1S54A 3FAJA 1IXFA 3A9CA 3A7KA 5JJJA 2J9VA 2BC5A 3S27A 2JPUA 5JUAA 1YLMA 4MVMA 1KTMA 4FAAB 3EQLF 4XTOA 2HJMA 4C3BA 2A69F 1GUEA 1A41A 2ZPAA 3LNRA 1V54C 4YT8A 1R2NA 2ZZLA 5KYYB 2QPEB 2QE9A 2NUTB 3VRCA 5DVWA 4PFPA 5B6VA 3KH2A 2GA0A 4NQFA 4XEKA 1OXBA 2MHRA 1E0PA 3DWWA 4LLEA 4AK9A 1CGNA 2YVKA 1B68A 3DDLA 3F47A 5L0FA 2ZXWC 1NU7D 3NSBA 1FMVA 4IGGA 3PQRA 3NKDA 5CI8A 2I15A 1XMEB 1T6IA 4F4BA 1F88A 5G28A 1PCXA 1E2XA 1LKXA 3K66A 1RKEB 2WL8A 3D4SA 4KNVA 2M64A 1DZEA 4JE9A 3UGOA 2PF4E 5T1DB 4BWBA 4X32A 1G4US 2F95A 1Z6AA 4MNDA 3KJ6A 3NY9A 5DYSA 5T3TA 5KYWA 3ZQYA 1D0ZA 1GZMA 1NFNA 3DJNB 3L0IA 4U9DA 2FFHA 3V2WA 1ORYA 2I21A 4GYTA 1SR2A 4M63A 4N4YB 3EMLA 4XPYA 2RD9A 4CS7A 3PWHA 3RIPA 1QKOA 2ZXRA 1H2SA 1D0YA 1TFKB 1ORJA 3VW7A 4JR8A 2C04A 4CIPA 1VYIA 3SXYA 3NDBB 4JCHA 2Q9CA 3AYMA 3LEOA 4FA7B 1WN0A 2PX3A 2MWQA 2LK4A 4W8KA 3I5PA 3G50A 5A45A 3SXZA 1JRAA 5BR2A 2VCBA 2G3KA 2J9BA 4KLYA 2VCAA 3LAYA 1IW7F 2ZIYA 1AVOB 1CPRA 2HS5A 3UMHA 2Q3TA 2KW3C 2G62A 3UMKA 1M0MA 4C7OB 1L3PA 2IXNA 2R9RB 2DB4A 1XWJA 2J8WA 3DD7A 3T4RA 1NU9C 1RXQA 4PFOA 1FMWA 3ZWIA 3CEXA 5JP7A 1RMVA 2GAQA 3N24A 3SZRA 3HKKA 3QTHA 3GANA 1TFOB 1OKKD 1LIHA 2L6FA 5LWEA 1QKPA 2Q00A 3NY8A 2LQGA 5A44A 2OJED 3ITFA 4EWCA 3B71A 1LI5A 3DI5A 4OV0A 4MVRA 1SMYF 4CS9A 4CX9A 2QTVA 2EILC 3OWTA 4MS2A 3T6GB 4CS8C 5B0WA 1C02A 2LNLA 2Y3DA 3EH4B 3E9VA 4Y9HA 1Z3IX 1LE2A 4BPMA 5EGYA 4EA3A 5BQHA 3C9MA 2A6HF 3AGUA 2BL2A 3SN6R 3VF0A 2GWWA 4DBQA 3NYJA 1AP9A 5L0IA 2YL3A 4EUKB 3L1MA 4EIYA 3I5QA 4PJNA 1SYQA 3MBVA 4Z9HA 2VT4A 1S05A 2W4BA 2HSQA 256BA 4WGZA 2YCZA 4OIQF 4J7YA 3BVDB 1RKEA 4J32B 3MYFA 4DAJA 1JGJA 1BRRA 1YZCA 2XM0A 4Q5SF 2IOQA 5BUOA 3U2LA 1Q0FA 2KYHA 3ZEVA 4WW3A 1HY5A 3NMKA 4ZLDA 5L3VA 1GQAA 3ABWA 3JT1A 1MNDA 1YYXA 1OXKA 4JVSA 1YAUO 4KI2A 4CSAA 4CSAC 3AM6A 1BBHA 4G71B 5H2MA 2OU6A 2JX0A 1D0XA 2OOCA 5KYNA 1Z23A 3U3BA 4FBZA 4HFKB 2B0JA 1Y4CA 5F8UA 1SZIA 2H7BA 4DXWA 3UR3C 2AP3A 1H9TA 1FBBA 3NMIA 4WAVA 4LLCA 3QJUB 2YCXA 4CDYA 1HE1A 4CJGA 2WJLA 5G2AA 4BEYA 2IXOA 5B34A 1Q0KA 4PJMA 3MYIA 3CZ6A 2R7TA 3FXHA 1TWHA 1KMEA 5E3CA 4YN0B 3O55A 3LUTB 3RH3A 3PBLA 5AHZA 3FHDA 2L9JA 2ETSA 2QUPA 4I1OB 3NMJA 4YT4A 3RW0A 4AL1A 3CAPA 1RJ9B 2O9XA 2L6XA 1R84A 4O6YA 3B0UX 4N4WA 4U5FE 4XEVA 2R25A 4EBJA 3TK0A 2J9WA 3B0VC 4YJWA 3X2QC 3NKEA 3FAPB 3OE0A 1T5OA 4E0HA 2Y00A 4XLNF 2Y3BA 3UTVA 5JLIA 1XZPA 2HPYA 1H7IA 3IEEA 4UDVA 1QKRA 4QDLA 2DYRC 1HMDA 1L9HA 3KYJA 1A7DA 2P61A 3UG9A 3US6A 5AX1A 4Q4ZF 4PXKA 4W8PA 3A11A 3F46A 3N0TA 1O5HA 4G72B 1E12A 2F93A 1TR2A 2L7AA 1M0LA 4U5HA 4D4XA 4IAOA 1VLTA 1JPNA 2X51A 5JJEA 3ZG1A 3M4BA 2CGEA 1ZVZA 3QZCA 4MW3A 1PY6A 5JJNA 2J0WA 4XTNA 1NSGB 1ORSC 2JAGA 5AX0A 2KGOA 1FNTc 3QBKA 4JC7A 4UHRA 1OW6A 3JSZA 4HEAJ 5H2HA 3V5YA 2HSBA 3HNKA 3V7OA 1VB5A 3QW0A 4IAQA 5B6YA 4YK5A 2X72A 1FR0A 4HFFB 2LSEA 2ZXOA 3Q6NA 3ATPA 3COCA 4HWLA 4A2NB 2R7WA 4BG0A 1EQ1A 4H54A 3MFNA 3VM6A 1Z63A 5AGFA 3IQTA 1X0SA 4MQSA 1ZW3A 4BJTA 2KSBA 4LDEA 4E17A 2H8AA 1FAPB 5E2QA 3DAFA 3LJBA 1BZ4A 4MW8A 3JCUQ 2NPUA 3JTLO 2KK1A 3T6JA 1BR1A 3FMSA 1D1CA 3UTWA 5J7AA 3KL4A 2V3CC 3N2ZB 3OE9A 4DVYP 3M79A 1BR4A 4I44A 3T9OA 3ZIBA 3POVA 3SYNA 4FAPB 4OIRF 2QPDB 3EHMA 3EH5B 4MVQA 4CIHA 5A6JA 2J9UA 3KYIA 2IYLD 5B6WA 3WODF 2W45A 1Z5ZA 3Q6MA 5F5HA 4E18A 3B29A 4BJ1A 3CAXA 4JTAB 1QSPA 3OE6A 1WTYA 5F5FA 1PXSA 3ZSUA 4AL0A 1TQGA 5TGZA 1M57C 2YWAA 2XSEA 1LVKA 4FPDA 3U9MA 1H9GA 2A0UA 4OIOF 5A6BD 3VG9A 1YYJA 1PD0A 3M4CA 4XQ1A 4D4NA 4L6RA 2IXMA 5G54A 4KNWA 1A0BA 4BEMJ 3OEOA 4DJHA 2A0BA 4EBKA 2R7UA 4K7BA 1YARO 1FFTC 3PHF2 3UGPA 3ZPRA 4XXJA 2J4YA 4DVZA 3FOOA 4U9EA 1MMDA 2XLOA 1U89A 1JAFA 4EBBA 4U5DE 1ZU5A 1RKCA 4RD9A 1U6HA 3UTYA 4L35A 1OR2A 5A8EA 2Z73A 1V55C 1QZXA 1GS9A 4GBRA 1D1AA 5L0DA 2XLWA 5AZDA 1BM1A 2J7PA 3L8IA 3EJNA 3QJTB 2P6VA 1LM3B 1VOMA 3HTKC 2OEXA 4GYCA 5DS6A 4WGYA 3C62A 1CWQA 2Z15A 1MMNA 2WB7A 4N06A 5FZTA 1ZZPA 5COMA 2EPMX 3W8IA 4DBRA 1BRDA 4DKLA 1C03A 3ZTMA 2XXAA 4KBLA 2Z55A 4XT3A 5BR5A 2WVOA 4O6NA 3ABMC 2VASA 1Q5IA 4MD1A 1YA7O 4ZLCA 2Y01A 4LDKA 3TOLA 2KS9A 2I8BA 2F22A 5C1MA 3WQJA 3EGDA 1M6TA 4C3DA 1E83A 1KG8A 1JR8A
chains in the Genus database with same CATH topology
3BVDB 4MD2A 3U8PA 2YDVA 4DAJA 4PXFA 4CDVA 1JGJA 1BRRA 2G87A 1S51A 1UAZA 3M15A 3QDCA 4X31A 1XJIA 5EN0A 1YZCA 2XM0A 2YKZA 1GU8A 1JV6A 4GRVA 3ZEVA 3EH3B 4WW3A 3NMKA 3QW1A 1GQAA 3ABWA 4QRYA 1YYXA 1E85A 1P8HA 3AM6A 1E84A 4GP5B 1BBHA 4G7RB 4G71B 5H2MA 2PEDA 3C9LA 4TL3A 4FBZA 2YL7A 3IQ5A 3HAOA 3QBGA 4G70B 5H2PA 4G7QB 5F8UA 2XLDA 3NYAA 1JV7A 2I20A 1UCQA 4ER9A 1FBBA 3NMIA 4WAVA 3QJUB 1MQVA 4J4QA 2YCXA 1C8SA 4AMJA 3QJRB 4CDYA 4QIDA 4XT1A 4CJGA 2WJLA 3ZQVA 5B6ZA 5G2AA 2EI4A 2WJKA 4BEYA 5B34A 1P8UA 5B3IA 5ETZA 1XIOA 1KMEA 4UG2A 5DHHA 4ULVA 4BVNA 4JEAA 4G7SB 2XLMA 3DQBA 4DS7E 3QJVB 1FBKA 1KG9A 3PBLA 5AHZA 4CDAA 3NS0A 1E86A 3NMJA 5G2DA 5ITEA 1QQ3A 5KKHA 1QM8A 4GPOA 3CAPA 5AWZA 2L6XA 1QHJA 1R84A 4LDOA 4N4WA 5FJGA 2JAFA 3AYNA 3T45A 3QBIA 4MQTA 3X3BA 3HNJA 3OE0A 4KNFA 2Y00A 3UTVA 5JLIA 3UONA 2HPYA 3QJQB 5B6XA 1RCPA 2YLGA 5JSLA 2YCWA 2XLHA 1VGOA 1LN6A 3HNIA 3QJSB 2XM4A 1JFPA 2R4RA 2BRDA 1F4ZA 1S53A 3C63A 1L9HA 3VI0A 3UG9A 5JT4A 5B2NA 3QAPA 2RH1A 1H68A 1C3WA 1S54A 3VVKA 1IXFA 1VJMA 5H2JA 1APCA 5AX1A 3A7KA 3ODUA 3PDSA 4PXKA 3UZAA 5JJJA 2BC5A 5JUAA 4G72B 4LDLA 4FAAB 1E12A 3P0GA 5JVEA 4XTOA 2F93A 5B35A 1GUEA 1M0LA 3X3CA 2ZZLA 1R2NA 4D4XA 2QPEB 3HARA 3VRCA 1TN5A 1P8IA 2XL6A 1MGYA 2YL1A 5JJEA 3M4BA 3UZCA 3REYA 3QAKA 2YDOA 5B6VA 4X1HA 5JJNA 1PY6A 1QPUA 3HAPA 4QI1A 4XTNA 3CODA 1E0PA 1CPQA 2JAGA 5AX0A 4N6HA 1CGNA 5H2KA 3QBKA 4UHRA 4BV0A 4K5YA 3UTXA 3DDLA 5H2HA 4EJ4A 3HNKA 5ITCA 3NSBA 3QW0A 3PQRA 4HYXA 4IAQA 5B6YA 1IW9A 2YCYA 2X72A 1EKYA 1XMEB 4NC3A 2KSYA 1F88A 1IW6A 5G28A 3S3CB 2NTUA 1S8JA 2XLVA 2M3GA 3COCA 4HWLA 2YLDA 3D4SA 5JS5A 4JKVA 1DZEA 4JE9A 2Y02A 4MBSA 2QLAA 5AGFA 4BWBA 4X32A 2F95A 1X0SA 4MQSA 3KJ6A 3NY9A 5DYSA 2KSBA 3FOPA 2I35A 5G53A 5H2LA 3ZQYA 1GZMA 3QBLA 4LDEA 4U9DA 3V2WA 2I21A 5H2IA 4IB4A 3HNLA 4N4YB 3EMLA 3RFMA 3S3BB 5AHYA 3PWHA 1QKOA 3UTWA 5J7AA 1H2SA 3OE9A 1CGOA 3M79A 2I1XA 3VW7A 4JR8A 3RZEA 4CIPA 2YLIA 2CCYA 5G2CA 1C8RA 2QPDB 1S52A 4BEZA 3EH5B 1EHKB 3AYMA 2Y03A 4FA7B 3ZTZA 2YL0A 3S8GB 3OE8A 1NBBA 3PXOA 5B6WA 4GP8B 5A45A 2XL8A 2NTWA 4XTLA 4AMIA 5BR2A 2XLEA 2J9BA 4KLYA 3TOMA 2Y04A 5H2NA 3DE8A 1KGBA 2ZIYA 5G36A 3OE6A 1A7VA 1CPRA 1S8LA 5H2OA 1PXSA 1X0I1 1M0MA 1PXRA 1TN0A 5TGZA 4FPDA 2J8WA 3VG9A 2AT9A 1U19A 1YYJA 1YZAA 3M4CA 4D4NA 4L6RA 5G54A 3S8FB 3ZWIA 2R4SA 2ZFEA 4DJHA 5JP7A 3V2YA 3HASA 4A4MA 3QVZA 3ZPRA 4XXJA 2J4YA 5DHGA 1BRXA 3FOOA 4U9EA 4IARA 5LWEA 1QKPA 2XLOA 3NY8A 3VHZA 1JAFA 5A44A 1F50A 4JQ6A 4CJOA 3UTYA 5JRAA 4L35A 3OAXA 5A8EA 4OV0A 2Z73A 4BUOA 3VGAA 4GBRA 4CX9A 3DE9A 2XLWA 5AZDA 1BM1A 1L0MA 3QJTB 1LM3B 3QVYA 1AT9A 4GYCA 3HANA 4WGYA 5B0WA 3C62A 3ZPQA 1CWQA 2LNLA 4GP4B 3EH4B 4Y9HA 3S3DB 1O0AA 1BRDA 4EA3A 4DKLA 3ZTMA 3C9MA 1X0K1 1Q5JA 2Z55A 4XT3A 5BR5A 3IQ6A 1Q5IA 4HYJA 3SN6R 1HZXA 4MD1A 1AP9A 2Y01A 2KSAA 2YL3A 3TOLA 3L1MA 2KS9A 4EIYA 5C1MA 3HAQA 3WQJA 1M6TA 1M0KA 2VT4A 3MBVA 1S05A 1E83A 256BA 4WGZA 1KG8A 4JEBA 2YCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BVD B;  4MD2 A;  3U8P A;  2YDV A;  4DAJ A;  4PXF A;  4CDV A;  1JGJ A;  1BRR A;  2G87 A;  1S51 A;  1UAZ A;  3M15 A;  3QDC A;  4X31 A;  1XJI A;  5EN0 A;  1YZC A;  2XM0 A;  2YKZ A;  1GU8 A;  1JV6 A;  4GRV A;  3ZEV A;  3EH3 B;  4WW3 A;  3NMK A;  3QW1 A;  1GQA A;  3ABW A;  4QRY A;  1YYX A;  1E85 A;  1P8H A;  3AM6 A;  1E84 A;  4GP5 B;  1BBH A;  4G7R B;  4G71 B;  5H2M A;  2PED A;  3C9L A;  4TL3 A;  4FBZ A;  2YL7 A;  3IQ5 A;  3HAO A;  3QBG A;  4G70 B;  5H2P A;  4G7Q B;  5F8U A;  2XLD A;  3NYA A;  1JV7 A;  2I20 A;  1UCQ A;  4ER9 A;  1FBB A;  3NMI A;  4WAV A;  3QJU B;  1MQV A;  4J4Q A;  2YCX A;  1C8S A;  4AMJ A;  3QJR B;  4CDY A;  4QID A;  4XT1 A;  4CJG A;  2WJL A;  3ZQV A;  5B6Z A;  5G2A A;  2EI4 A;  2WJK A;  4BEY A;  5B34 A;  1P8U A;  5B3I A;  5ETZ A;  1XIO A;  1KME A;  4UG2 A;  5DHH A;  4ULV A;  4BVN A;  4JEA A;  4G7S B;  2XLM A;  3DQB A;  3QJV B;  1FBK A;  1KG9 A;  3PBL A;  5AHZ A;  4CDA A;  3NS0 A;  1E86 A;  3NMJ A;  5G2D A;  5ITE A;  1QQ3 A;  5KKH A;  1QM8 A;  4GPO A;  3CAP A;  5AWZ A;  2L6X A;  1QHJ A;  1R84 A;  4LDO A;  4N4W A;  5FJG A;  2JAF A;  3AYN A;  3T45 A;  3QBI A;  4MQT A;  3X3B A;  3HNJ A;  3OE0 A;  4KNF A;  2Y00 A;  3UTV A;  5JLI A;  3UON A;  2HPY A;  3QJQ B;  5B6X A;  1RCP A;  2YLG A;  5JSL A;  2YCW A;  2XLH A;  1VGO A;  1LN6 A;  3HNI A;  3QJS B;  2XM4 A;  1JFP A;  2R4R A;  2BRD A;  1F4Z A;  1S53 A;  3C63 A;  1L9H A;  3VI0 A;  3UG9 A;  5JT4 A;  5B2N A;  3QAP A;  2RH1 A;  1H68 A;  1C3W A;  1S54 A;  3VVK A;  1IXF A;  1VJM A;  5H2J A;  1APC A;  5AX1 A;  3A7K A;  3ODU A;  3PDS A;  4PXK A;  3UZA A;  5JJJ A;  2BC5 A;  5JUA A;  4G72 B;  4LDL A;  4FAA B;  1E12 A;  3P0G A;  5JVE A;  4XTO A;  2F93 A;  5B35 A;  1GUE A;  1M0L A;  3X3C A;  2ZZL A;  1R2N A;  4D4X A;  2QPE B;  3HAR A;  3VRC A;  1TN5 A;  1P8I A;  2XL6 A;  1MGY A;  2YL1 A;  5JJE A;  3M4B A;  3UZC A;  3REY A;  3QAK A;  2YDO A;  5B6V A;  4X1H A;  5JJN A;  1PY6 A;  1QPU A;  3HAP A;  4QI1 A;  4XTN A;  3COD A;  1E0P A;  1CPQ A;  2JAG A;  5AX0 A;  4N6H A;  1CGN A;  5H2K A;  3QBK A;  4UHR A;  4BV0 A;  4K5Y A;  3UTX A;  3DDL A;  5H2H A;  4EJ4 A;  3HNK A;  5ITC A;  3NSB A;  3QW0 A;  3PQR A;  4HYX A;  4IAQ A;  5B6Y A;  1IW9 A;  2YCY A;  2X72 A;  1EKY A;  1XME B;  4NC3 A;  2KSY A;  1F88 A;  1IW6 A;  5G28 A;  3S3C B;  2NTU A;  1S8J A;  2XLV A;  2M3G A;  3COC A;  4HWL A;  2YLD A;  3D4S A;  5JS5 A;  4JKV A;  1DZE A;  4JE9 A;  2Y02 A;  4MBS A;  2QLA A;  5AGF A;  4BWB A;  4X32 A;  2F95 A;  1X0S A;  4MQS A;  3KJ6 A;  3NY9 A;  5DYS A;  2KSB A;  3FOP A;  2I35 A;  5G53 A;  5H2L A;  3ZQY A;  1GZM A;  3QBL A;  4LDE A;  4U9D A;  3V2W A;  2I21 A;  5H2I A;  4IB4 A;  3HNL A;  4N4Y B;  3EML A;  3RFM A;  3S3B B;  5AHY A;  3PWH A;  1QKO A;  3UTW A;  5J7A A;  1H2S A;  3OE9 A;  1CGO A;  3M79 A;  2I1X A;  3VW7 A;  4JR8 A;  3RZE A;  4CIP A;  2YLI A;  2CCY A;  5G2C A;  1C8R A;  2QPD B;  1S52 A;  4BEZ A;  3EH5 B;  1EHK B;  3AYM A;  2Y03 A;  4FA7 B;  3ZTZ A;  2YL0 A;  3S8G B;  3OE8 A;  1NBB A;  3PXO A;  5B6W A;  4GP8 B;  5A45 A;  2XL8 A;  2NTW A;  4XTL A;  4AMI A;  5BR2 A;  2XLE A;  2J9B A;  4KLY A;  3TOM A;  2Y04 A;  5H2N A;  3DE8 A;  1KGB A;  2ZIY A;  5G36 A;  3OE6 A;  1A7V A;  1CPR A;  1S8L A;  5H2O A;  1PXS A;  1X0I 1;  1M0M A;  1PXR A;  1TN0 A;  5TGZ A;  4FPD A;  2J8W A;  3VG9 A;  2AT9 A;  1U19 A;  1YYJ A;  1YZA A;  3M4C A;  4D4N A;  4L6R A;  5G54 A;  3S8F B;  3ZWI A;  2R4S A;  2ZFE A;  4DJH A;  5JP7 A;  3V2Y A;  3HAS A;  4A4M A;  3QVZ A;  3ZPR A;  4XXJ A;  2J4Y A;  5DHG A;  1BRX A;  3FOO A;  4U9E A;  4IAR A;  5LWE A;  1QKP A;  2XLO A;  3NY8 A;  3VHZ A;  1JAF A;  5A44 A;  1F50 A;  4JQ6 A;  4CJO A;  3UTY A;  5JRA A;  4L35 A;  3OAX A;  5A8E A;  4OV0 A;  2Z73 A;  4BUO A;  3VGA A;  4GBR A;  4CX9 A;  3DE9 A;  2XLW A;  5AZD A;  1BM1 A;  1L0M A;  3QJT B;  1LM3 B;  3QVY A;  1AT9 A;  4GYC A;  3HAN A;  4WGY A;  5B0W A;  3C62 A;  3ZPQ A;  1CWQ A;  2LNL A;  4GP4 B;  3EH4 B;  4Y9H A;  3S3D B;  1O0A A;  1BRD A;  4EA3 A;  4DKL A;  3ZTM A;  3C9M A;  1X0K 1;  1Q5J A;  2Z55 A;  4XT3 A;  5BR5 A;  3IQ6 A;  1Q5I A;  4HYJ A;  3SN6 R;  1HZX A;  4MD1 A;  1AP9 A;  2Y01 A;  2KSA A;  2YL3 A;  3TOL A;  3L1M A;  2KS9 A;  4EIY A;  5C1M A;  3HAQ A;  3WQJ A;  1M6T A;  1M0K A;  2VT4 A;  3MBV A;  1S05 A;  1E83 A;  256B A;  4WGZ A;  1KG8 A;  4JEB A;  2YCZ A; 
#chains in the Genus database with same CATH topology
 2IM8 A;  2OEV A;  4MD2 A;  4O6M A;  2YDV A;  2RSE B;  2EIM C;  2G87 A;  1S51 A;  3M15 A;  3QDC A;  5EN0 A;  3LS1 A;  3SXM A;  4BJ5 A;  2Y39 A;  3EH3 B;  4JIO A;  4FWV A;  4G7R B;  2VC9 A;  2L6H A;  2PED A;  3L34 A;  3IQ5 A;  2UUI A;  3IPM O;  2Q7R A;  3QBG A;  3ZDL A;  2XS8 A;  5H2P A;  5GPG B;  5A6K A;  2WVN A;  2OJQ A;  3NYA A;  4DRH B;  5CIV A;  3S90 A;  2ICW G;  1UCQ A;  4ER9 A;  2NUT A;  1M2O A;  2R03 A;  2NG1 A;  3C8G B;  4NTF A;  1C8S A;  4XT1 A;  3ASO C;  1R4T A;  5B6Z A;  2EI4 A;  2PX0 A;  3LES A;  1XIO A;  1D1B A;  1QLE C;  2R02 A;  4EHP A;  4BVN A;  2XLM A;  4IJJ A;  3PMR A;  3DQB A;  1MMA A;  4YL0 A;  3TJ5 A;  3V5Z A;  4MVU A;  5G2D A;  5E33 A;  3O6X A;  1QQ3 A;  3ABL C;  4GPO A;  3M1C B;  3FDQ A;  1HW1 A;  2EIK C;  3VAY A;  5AWZ A;  1I4Y A;  3RFY A;  3OA1 A;  5KYU B;  2HMZ A;  5FJG A;  2JAF A;  3AYN A;  3QBI A;  1YA9 A;  4KNF A;  3QJQ B;  1RCP A;  1LE4 A;  3RYL A;  3H2V A;  2YCW A;  1VGO A;  3QJS B;  2XM4 A;  2R4R A;  1S53 A;  3C63 A;  2PNO A;  3K1I C;  4LER A;  3QAP A;  1T9K A;  2RH1 A;  1C3W A;  1VYK A;  1VJM A;  1APC A;  3ODU A;  3UZA A;  3R7C A;  5B1A C;  2NSG A;  4LDL A;  1V4A A;  2KQ9 A;  1G4W R;  4DJ9 A;  1I5N A;  2AU5 A;  1GM5 A;  4ULW A;  4AE4 B;  3HAR A;  1P8I A;  2Q9B A;  2WZF A;  2YL1 A;  3DM5 A;  4J7T A;  4KC9 A;  3UZC A;  1KNY A;  3REY A;  2YDO A;  2HJ3 A;  3HAP A;  4QI1 A;  3C8G A;  4B6I A;  1CPQ A;  4N6H A;  3S84 A;  5E3A A;  2PBE A;  5H2K A;  4BV0 A;  2NUP B;  1G8X A;  2D4U A;  3C7J A;  5ITC A;  3C8Z A;  2R7S A;  3KPH A;  3NG1 A;  2YCY A;  3GOD A;  1G5Z A;  1EKY A;  2DYS C;  4N6C A;  3Q7G A;  2KSY A;  3GM1 A;  3VYW A;  2NTU A;  1S8J A;  2P1A A;  1Y6D A;  4OD5 A;  2HFI A;  3LLK A;  5KYX B;  1OCC C;  2WZG A;  5JS5 A;  1WAT A;  4MBS A;  2HKV A;  4LAC B;  4LDR A;  4FX5 A;  4O79 A;  2YQY A;  2R05 A;  3FOP A;  3G4X A;  2I35 A;  5G53 A;  2YEV A;  3DKA A;  1PV3 A;  1TWA A;  3LNM B;  3QBL A;  1NFO A;  4MVS A;  3JYH A;  3GEH A;  2ASR A;  1WWP A;  1NG1 A;  3J06 A;  4NTA A;  4IB4 A;  1DOV A;  3HNL A;  5KYU A;  3RFM A;  3K6B A;  2R7R A;  1HE9 A;  3X1O A;  1OCZ C;  5AHY A;  4NCQ A;  2W4M A;  4JJF A;  4GQH A;  4JRZ A;  4XEF A;  3EG9 A;  1YDI A;  1MMG A;  2CCY A;  1JMW A;  4HE8 D;  5L3Q A;  3ZTZ A;  2LFD A;  2YL0 A;  3S8G B;  4P9F A;  4XTK A;  3PXO A;  4GP8 B;  3ASN C;  2XL8 A;  3K1H A;  2J0X A;  1U0B B;  4XTL A;  5AC4 A;  2XLE A;  5H2N A;  2WZL A;  1SF8 A;  4K1O A;  1H6G A;  5H2O A;  3O39 A;  3GOR A;  3GWL A;  3I4U A;  4I3M A;  1TKN A;  3CQZ A;  1PXR A;  1TN0 A;  2YHS A;  3EG9 B;  1BDJ B;  3S0X A;  1KU2 A;  4WAB A;  2AT9 A;  1U19 A;  1OR3 A;  2VCC A;  3S8F B;  3C8G D;  3KKB A;  2R4S A;  1J8Y F;  2V26 A;  4DOZ A;  2W9Y A;  4PJJ A;  2M4E A;  3JRT A;  1J8M F;  3W2V A;  4BJ6 A;  1BRX A;  3G4Z A;  1VMA A;  3S29 A;  1RJ9 A;  5HSW A;  2VB6 A;  2XRH A;  4WJ0 A;  1UG7 A;  2WVQ A;  3WG7 C;  4CJO A;  1YJG A;  2B0H A;  3GEE A;  4MVO A;  4BUO A;  2QY9 A;  3VGA A;  4I1M A;  2HZ8 A;  3U3F A;  3AOU A;  3QVY A;  1AT9 A;  5DQT A;  3B0P A;  3MX3 A;  3SP1 A;  2OG2 A;  3AG3 C;  2A68 F;  4OD4 A;  3UMI A;  5BQG A;  1OW8 A;  3GM2 A;  4PK4 A;  4GP4 B;  4MQ9 F;  1I4Z A;  2EPO A;  2HV6 A;  2KC3 A;  4FES A;  4EKW A;  4MTO A;  2HMQ A;  2R7V A;  1X0K 1;  1EA8 A;  4YWQ A;  5AC5 A;  1V74 B;  5B3S C;  1HZX A;  3CSK A;  3U2M A;  4E7Z A;  1K05 A;  5IY5 C;  3U8V A;  2XL4 A;  3MLG A;  2H7O A;  2LFF A;  1M0K A;  1TWG A;  4JJG A;  5A6A A;  4JEB A;  3HAN A;  3B9Q A;  4JZA A;  2MYS A;  3JZ0 A;  2A1D D;  4PXF A;  3WAQ A;  4PAC A;  3TQO A;  1UAZ A;  2J7P D;  1XJI A;  4X31 A;  2IBF A;  4CBE A;  3BEH A;  2YKZ A;  1JOG A;  3GM3 A;  3MBG A;  4YT5 A;  1T01 A;  5KYX A;  4GEH A;  4MTG A;  1O87 A;  2NUP A;  4QRY A;  1ZHX A;  3SEO A;  4G7O F;  1ZW2 A;  4PJL A;  4K0D A;  3C9L A;  4TL3 A;  4NTB A;  2YL7 A;  3E70 C;  5L0J A;  3HAO A;  4P6I C;  4G70 B;  1ZHY A;  4XLP F;  1A7E A;  2I20 A;  3EH1 A;  1MQV A;  3UNG C;  4AMJ A;  4QID A;  3DZA A;  4JUR I;  3ZQV A;  2FAP B;  5L0H A;  5B3I A;  5ETZ A;  1C17 M;  3RVZ A;  3JYY A;  3HJC A;  4U5G A;  4UG2 A;  3AG4 C;  5DHH A;  3AQB A;  4ULV A;  4JEA A;  4G7S B;  4RDA A;  2AVK A;  3QJV B;  1LS1 A;  1LS4 A;  3LS0 A;  4JTC B;  4JCZ A;  4G7H F;  5ITE A;  2CNW A;  2PFD A;  2E87 A;  3H65 A;  1WOL A;  5DS4 A;  4CS9 C;  1T6U A;  2QNL A;  2P0N A;  3X3B A;  3HNJ A;  4CS8 A;  3UON A;  4OIP F;  1UFB A;  5B6X A;  2YLG A;  2R7Q A;  4BEJ A;  2XLH A;  2OQM A;  4BJ6 C;  1ZU4 A;  1EI7 A;  1F4Z A;  3RKO F;  3NYM A;  4ANJ A;  1VTM P;  4C7O A;  5JT4 A;  2HUJ A;  5B2N A;  4OIN F;  1H68 A;  3VVK A;  5H2J A;  2EIJ C;  5T3W A;  3PDS A;  3RQG A;  1GGQ A;  4YT2 A;  2HV7 A;  1AUE A;  3P0G A;  5JVE A;  3S9O A;  1QVX A;  4NY3 A;  5B35 A;  3X3C A;  2LIG A;  3PDM P;  5FCL A;  1TN5 A;  3EZI A;  2XL6 A;  1DOW A;  1MGY A;  4RBN A;  1VLS A;  5COG A;  3QAK A;  4X1H A;  2BE5 F;  2D5R B;  1QPU A;  2PP4 A;  4R32 A;  5F28 E;  4IWB A;  3COD A;  1T6Q A;  2GDC A;  2Y69 C;  4K5Y A;  3UTX A;  4EJ4 A;  2P7V A;  5D91 A;  4HYX A;  1IW9 A;  2KJG A;  2J46 A;  3C18 A;  4Z9I A;  4NC3 A;  2YZS A;  3ABK C;  1IW6 A;  3S3C B;  5KYY A;  2XLV A;  2M3G A;  1OKK A;  4DRJ B;  2YLD A;  2IXP A;  2Q4F A;  4QI2 A;  4JKV A;  2KNH A;  2Y02 A;  2QLA A;  1Q0G A;  4X0R A;  4J30 B;  4G0H A;  3FVY A;  4E7S A;  4YL1 A;  4XPX A;  2EPK X;  2JD3 A;  5KYW B;  5H2L A;  5HV9 A;  1K40 A;  1JPJ A;  1ZHZ A;  2EIN C;  1FTS A;  1Z7Q c;  5A6B A;  1W2W A;  2XXA B;  5H2I A;  2CYD A;  1O3U A;  1IZM A;  3S3B B;  4XWJ A;  2J45 A;  3KMI A;  5COF A;  1ZHW A;  2EPN A;  1CGO A;  3EHN A;  4BJ5 C;  2R7X A;  2Y3G A;  3HLZ A;  2I1X A;  4YL3 A;  3RZE A;  2YLI A;  3DAG A;  5G2C A;  1C8R A;  1S52 A;  4BEZ A;  1EHK B;  2GFH A;  3PCV A;  2Y03 A;  5L0C A;  4Q7C A;  3O10 A;  3OE8 A;  1NBB A;  3GWN A;  5TJ5 E;  4PR9 A;  1Q0D A;  2G3V A;  1WGW A;  2NTW A;  1VK5 A;  4AMI A;  2X0C A;  3TOM A;  1LPE A;  2Y04 A;  3DE8 A;  1KGB A;  2UUH A;  5G36 A;  1A7V A;  1AEP A;  1S8L A;  2H7V C;  3L8J A;  3R2P A;  4IRU A;  3U0C A;  5L0G A;  4Z9J A;  3U9J A;  1N1C A;  4MTF A;  2NSF A;  1X0I 1;  3BRJ A;  2DGJ A;  4U5E E;  5D92 A;  3RQE A;  3DM9 B;  3AG1 C;  2EPL X;  1S7Z A;  1YZA A;  4O7G A;  2R7O A;  5DQZ A;  1M56 C;  4ONS A;  2ZFE A;  4AX2 A;  3V2Y A;  2KSF A;  3Q7L A;  3HAS A;  1OCO C;  3DXJ F;  4A4M A;  3QVZ A;  1K04 A;  5EK0 A;  3AJM A;  5DHG A;  4DRI B;  2CW0 F;  1PD1 A;  4IAR A;  1BR2 A;  3NRH A;  2ZD9 A;  3VHZ A;  1HMO A;  1F50 A;  4JQ6 A;  2ZXP A;  3EGX A;  3S28 A;  3U5S A;  2Y3H A;  5JRA A;  1HW2 A;  3OAX A;  2LCH A;  2CDQ A;  4MVZ A;  3DE9 A;  2A6E F;  4QI0 A;  1L0M A;  2XS1 A;  3K1I A;  3LEV A;  2LP4 A;  3SNH A;  3W8H A;  3T6B A;  2LD6 A;  3ZPQ A;  2AWY A;  3EFO A;  4JW1 A;  3JRM O;  3IQC A;  3S3D B;  1O0A A;  4G78 A;  2FGY A;  1Q5J A;  2TMV P;  1CGM E;  3RVY A;  3IQ6 A;  4HYJ A;  2DI3 A;  1XZQ A;  3DJU B;  2KSA A;  3JSE O;  3ZVR A;  1TWC A;  4H4K C;  3HAQ A;  1NLX A;  3TD7 A;  1M2V B;  3EGX B;  4XPW A;  2L6G A;  1M2V A;  5A69 A;  3U8P A;  4CDV A;  3QMK A;  1GU8 A;  1JV6 A;  2OCC C;  4GRV A;  4G7Z F;  3WHN A;  3EZH A;  3K33 A;  3QW1 A;  3TJ6 A;  5EHH A;  1E85 A;  1P8H A;  1E84 A;  4GP5 B;  1Q0M A;  3EFO B;  1OW7 A;  3ZC4 A;  4G7Q B;  2XLD A;  3EH2 A;  1JV7 A;  1ZYR F;  3AQC A;  4AE4 A;  1YVI A;  4J4Q A;  2YRF A;  3DMD A;  4LDQ A;  5DLJ A;  3AGT A;  5CI9 A;  3QJR B;  3LLI A;  4C3E A;  5K0I A;  2WJK A;  3SXK A;  1P8U A;  1OQC A;  3ECS A;  5B1B C;  1MNE A;  3RF3 A;  3NYL A;  4DS7 E;  1FBK A;  1KG9 A;  1ST6 A;  4CDA A;  3GEI A;  3NS0 A;  1E86 A;  5DS5 A;  5KKH A;  1QM8 A;  2CNW D;  4U5C E;  1LI7 A;  2AWC A;  2C03 A;  3H2U A;  1QHJ A;  4LDO A;  4JTD B;  3W2W A;  1F1M A;  3V5X A;  3AG2 C;  4E0I A;  3T45 A;  4MQT A;  2Q9A A;  4P9T A;  3IHU A;  4A4A A;  3TUL A;  2OKU A;  1R5I D;  1FFH A;  2L81 A;  5JSL A;  1ZHT A;  4U5B E;  1NZE A;  1L7C A;  1LN6 A;  1WAS A;  3HNI A;  3K7D A;  1JFP A;  2VH3 A;  2BRD A;  5BQI A;  3EPV A;  3RQF A;  3VI0 A;  3W4Y A;  1OCR C;  3EGD B;  1S54 A;  3FAJ A;  1IXF A;  3A9C A;  3A7K A;  5JJJ A;  2J9V A;  2BC5 A;  3S27 A;  2JPU A;  5JUA A;  1YLM A;  4MVM A;  1KTM A;  4FAA B;  3EQL F;  4XTO A;  2HJM A;  4C3B A;  2A69 F;  1GUE A;  1A41 A;  2ZPA A;  3LNR A;  1V54 C;  4YT8 A;  1R2N A;  2ZZL A;  5KYY B;  2QPE B;  2QE9 A;  2NUT B;  3VRC A;  5DVW A;  4PFP A;  5B6V A;  3KH2 A;  2GA0 A;  4NQF A;  4XEK A;  1OXB A;  2MHR A;  1E0P A;  3DWW A;  4LLE A;  4AK9 A;  1CGN A;  2YVK A;  1B68 A;  3DDL A;  3F47 A;  5L0F A;  2ZXW C;  1NU7 D;  3NSB A;  1FMV A;  4IGG A;  3PQR A;  3NKD A;  5CI8 A;  2I15 A;  1XME B;  1T6I A;  4F4B A;  1F88 A;  5G28 A;  1PCX A;  1E2X A;  1LKX A;  3K66 A;  1RKE B;  2WL8 A;  3D4S A;  4KNV A;  2M64 A;  1DZE A;  4JE9 A;  3UGO A;  2PF4 E;  5T1D B;  4BWB A;  4X32 A;  1G4U S;  2F95 A;  1Z6A A;  4MND A;  3KJ6 A;  3NY9 A;  5DYS A;  5T3T A;  5KYW A;  3ZQY A;  1D0Z A;  1GZM A;  1NFN A;  3DJN B;  3L0I A;  4U9D A;  2FFH A;  3V2W A;  1ORY A;  2I21 A;  4GYT A;  1SR2 A;  4M63 A;  4N4Y B;  3EML A;  4XPY A;  2RD9 A;  4CS7 A;  3PWH A;  3RIP A;  1QKO A;  2ZXR A;  1H2S A;  1D0Y A;  1TFK B;  1ORJ A;  3VW7 A;  4JR8 A;  2C04 A;  4CIP A;  1VYI A;  3SXY A;  3NDB B;  4JCH A;  2Q9C A;  3AYM A;  3LEO A;  4FA7 B;  1WN0 A;  2PX3 A;  2MWQ A;  2LK4 A;  4W8K A;  3I5P A;  3G50 A;  5A45 A;  3SXZ A;  1JRA A;  5BR2 A;  2VCB A;  2G3K A;  2J9B A;  4KLY A;  2VCA A;  3LAY A;  1IW7 F;  2ZIY A;  1AVO B;  1CPR A;  2HS5 A;  3UMH A;  2Q3T A;  2KW3 C;  2G62 A;  3UMK A;  1M0M A;  4C7O B;  1L3P A;  2IXN A;  2R9R B;  2DB4 A;  1XWJ A;  2J8W A;  3DD7 A;  3T4R A;  1NU9 C;  1RXQ A;  4PFO A;  1FMW A;  3ZWI A;  3CEX A;  5JP7 A;  1RMV A;  2GAQ A;  3N24 A;  3SZR A;  3HKK A;  3QTH A;  3GAN A;  1TFO B;  1OKK D;  1LIH A;  2L6F A;  5LWE A;  1QKP A;  2Q00 A;  3NY8 A;  2LQG A;  5A44 A;  2OJE D;  3ITF A;  4EWC A;  3B71 A;  1LI5 A;  3DI5 A;  4OV0 A;  4MVR A;  1SMY F;  4CS9 A;  4CX9 A;  2QTV A;  2EIL C;  3OWT A;  4MS2 A;  3T6G B;  4CS8 C;  5B0W A;  1C02 A;  2LNL A;  2Y3D A;  3EH4 B;  3E9V A;  4Y9H A;  1Z3I X;  1LE2 A;  4BPM A;  5EGY A;  4EA3 A;  5BQH A;  3C9M A;  2A6H F;  3AGU A;  2BL2 A;  3SN6 R;  3VF0 A;  2GWW A;  4DBQ A;  3NYJ A;  1AP9 A;  5L0I A;  2YL3 A;  4EUK B;  3L1M A;  4EIY A;  3I5Q A;  4PJN A;  1SYQ A;  3MBV A;  4Z9H A;  2VT4 A;  1S05 A;  2W4B A;  2HSQ A;  256B A;  4WGZ A;  2YCZ A;  4OIQ F;  4J7Y A;  3BVD B;  1RKE A;  4J32 B;  3MYF A;  4DAJ A;  1JGJ A;  1BRR A;  1YZC A;  2XM0 A;  4Q5S F;  2IOQ A;  5BUO A;  3U2L A;  1Q0F A;  2KYH A;  3ZEV A;  4WW3 A;  1HY5 A;  3NMK A;  4ZLD A;  5L3V A;  1GQA A;  3ABW A;  3JT1 A;  1MND A;  1YYX A;  1OXK A;  4JVS A;  1YAU O;  4KI2 A;  4CSA A;  4CSA C;  3AM6 A;  1BBH A;  4G71 B;  5H2M A;  2OU6 A;  2JX0 A;  1D0X A;  2OOC A;  5KYN A;  1Z23 A;  3U3B A;  4FBZ A;  4HFK B;  2B0J A;  1Y4C A;  5F8U A;  1SZI A;  2H7B A;  4DXW A;  3UR3 C;  2AP3 A;  1H9T A;  1FBB A;  3NMI A;  4WAV A;  4LLC A;  3QJU B;  2YCX A;  4CDY A;  1HE1 A;  4CJG A;  2WJL A;  5G2A A;  4BEY A;  2IXO A;  5B34 A;  1Q0K A;  4PJM A;  3MYI A;  3CZ6 A;  2R7T A;  3FXH A;  1TWH A;  1KME A;  5E3C A;  4YN0 B;  3O55 A;  3LUT B;  3RH3 A;  3PBL A;  5AHZ A;  3FHD A;  2L9J A;  2ETS A;  2QUP A;  4I1O B;  3NMJ A;  4YT4 A;  3RW0 A;  4AL1 A;  3CAP A;  1RJ9 B;  2O9X A;  2L6X A;  1R84 A;  4O6Y A;  3B0U X;  4N4W A;  4U5F E;  4XEV A;  2R25 A;  4EBJ A;  3TK0 A;  2J9W A;  3B0V C;  4YJW A;  3X2Q C;  3NKE A;  3FAP B;  3OE0 A;  1T5O A;  4E0H A;  2Y00 A;  4XLN F;  2Y3B A;  3UTV A;  5JLI A;  1XZP A;  2HPY A;  1H7I A;  3IEE A;  4UDV A;  1QKR A;  4QDL A;  2DYR C;  1HMD A;  1L9H A;  3KYJ A;  1A7D A;  2P61 A;  3UG9 A;  3US6 A;  5AX1 A;  4Q4Z F;  4PXK A;  4W8P A;  3A11 A;  3F46 A;  3N0T A;  1O5H A;  4G72 B;  1E12 A;  2F93 A;  1TR2 A;  2L7A A;  1M0L A;  4U5H A;  4D4X A;  4IAO A;  1VLT A;  1JPN A;  2X51 A;  5JJE A;  3ZG1 A;  3M4B A;  2CGE A;  1ZVZ A;  3QZC A;  4MW3 A;  1PY6 A;  5JJN A;  2J0W A;  4XTN A;  1NSG B;  1ORS C;  2JAG A;  5AX0 A;  2KGO A;  1FNT c;  3QBK A;  4JC7 A;  4UHR A;  1OW6 A;  3JSZ A;  4HEA J;  5H2H A;  3V5Y A;  2HSB A;  3HNK A;  3V7O A;  1VB5 A;  3QW0 A;  4IAQ A;  5B6Y A;  4YK5 A;  2X72 A;  1FR0 A;  4HFF B;  2LSE A;  2ZXO A;  3Q6N A;  3ATP A;  3COC A;  4HWL A;  4A2N B;  2R7W A;  4BG0 A;  1EQ1 A;  4H54 A;  3MFN A;  3VM6 A;  1Z63 A;  5AGF A;  3IQT A;  1X0S A;  4MQS A;  1ZW3 A;  4BJT A;  2KSB A;  4LDE A;  4E17 A;  2H8A A;  1FAP B;  5E2Q A;  3DAF A;  3LJB A;  1BZ4 A;  4MW8 A;  3JCU Q;  2NPU A;  3JTL O;  2KK1 A;  3T6J A;  1BR1 A;  3FMS A;  1D1C A;  3UTW A;  5J7A A;  3KL4 A;  2V3C C;  3N2Z B;  3OE9 A;  4DVY P;  3M79 A;  1BR4 A;  4I44 A;  3T9O A;  3ZIB A;  3POV A;  3SYN A;  4FAP B;  4OIR F;  2QPD B;  3EHM A;  3EH5 B;  4MVQ A;  4CIH A;  5A6J A;  2J9U A;  3KYI A;  2IYL D;  5B6W A;  3WOD F;  2W45 A;  1Z5Z A;  3Q6M A;  5F5H A;  4E18 A;  3B29 A;  4BJ1 A;  3CAX A;  4JTA B;  1QSP A;  3OE6 A;  1WTY A;  5F5F A;  1PXS A;  3ZSU A;  4AL0 A;  1TQG A;  5TGZ A;  1M57 C;  2YWA A;  2XSE A;  1LVK A;  4FPD A;  3U9M A;  1H9G A;  2A0U A;  4OIO F;  5A6B D;  3VG9 A;  1YYJ A;  1PD0 A;  3M4C A;  4XQ1 A;  4D4N A;  4L6R A;  2IXM A;  5G54 A;  4KNW A;  1A0B A;  4BEM J;  3OEO A;  4DJH A;  2A0B A;  4EBK A;  2R7U A;  4K7B A;  1YAR O;  1FFT C;  3PHF 2;  3UGP A;  3ZPR A;  4XXJ A;  2J4Y A;  4DVZ A;  3FOO A;  4U9E A;  1MMD A;  2XLO A;  1U89 A;  1JAF A;  4EBB A;  4U5D E;  1ZU5 A;  1RKC A;  4RD9 A;  1U6H A;  3UTY A;  4L35 A;  1OR2 A;  5A8E A;  2Z73 A;  1V55 C;  1QZX A;  1GS9 A;  4GBR A;  1D1A A;  5L0D A;  2XLW A;  5AZD A;  1BM1 A;  2J7P A;  3L8I A;  3EJN A;  3QJT B;  2P6V A;  1LM3 B;  1VOM A;  3HTK C;  2OEX A;  4GYC A;  5DS6 A;  4WGY A;  3C62 A;  1CWQ A;  2Z15 A;  1MMN A;  2WB7 A;  4N06 A;  5FZT A;  1ZZP A;  5COM A;  2EPM X;  3W8I A;  4DBR A;  1BRD A;  4DKL A;  1C03 A;  3ZTM A;  2XXA A;  4KBL A;  2Z55 A;  4XT3 A;  5BR5 A;  2WVO A;  4O6N A;  3ABM C;  2VAS A;  1Q5I A;  4MD1 A;  1YA7 O;  4ZLC A;  2Y01 A;  4LDK A;  3TOL A;  2KS9 A;  2I8B A;  2F22 A;  5C1M A;  3WQJ A;  3EGD A;  1M6T A;  4C3D A;  1E83 A;  1KG8 A;  1JR8 A; 
#chains in the Genus database with same CATH homology
 3BVD B;  4MD2 A;  3U8P A;  2YDV A;  4DAJ A;  4PXF A;  4CDV A;  1JGJ A;  1BRR A;  2G87 A;  1S51 A;  1UAZ A;  3M15 A;  3QDC A;  4X31 A;  1XJI A;  5EN0 A;  1YZC A;  2XM0 A;  2YKZ A;  1GU8 A;  1JV6 A;  4GRV A;  3ZEV A;  3EH3 B;  4WW3 A;  3NMK A;  3QW1 A;  1GQA A;  3ABW A;  4QRY A;  1YYX A;  1E85 A;  1P8H A;  3AM6 A;  1E84 A;  4GP5 B;  1BBH A;  4G7R B;  4G71 B;  5H2M A;  2PED A;  3C9L A;  4TL3 A;  4FBZ A;  2YL7 A;  3IQ5 A;  3HAO A;  3QBG A;  4G70 B;  5H2P A;  4G7Q B;  5F8U A;  2XLD A;  3NYA A;  1JV7 A;  2I20 A;  1UCQ A;  4ER9 A;  1FBB A;  3NMI A;  4WAV A;  3QJU B;  1MQV A;  4J4Q A;  2YCX A;  1C8S A;  4AMJ A;  3QJR B;  4CDY A;  4QID A;  4XT1 A;  4CJG A;  2WJL A;  3ZQV A;  5B6Z A;  5G2A A;  2EI4 A;  2WJK A;  4BEY A;  5B34 A;  1P8U A;  5B3I A;  5ETZ A;  1XIO A;  1KME A;  4UG2 A;  5DHH A;  4ULV A;  4BVN A;  4JEA A;  4G7S B;  2XLM A;  3DQB A;  4DS7 E;  3QJV B;  1FBK A;  1KG9 A;  3PBL A;  5AHZ A;  4CDA A;  3NS0 A;  1E86 A;  3NMJ A;  5G2D A;  5ITE A;  1QQ3 A;  5KKH A;  1QM8 A;  4GPO A;  3CAP A;  5AWZ A;  2L6X A;  1QHJ A;  1R84 A;  4LDO A;  4N4W A;  5FJG A;  2JAF A;  3AYN A;  3T45 A;  3QBI A;  4MQT A;  3X3B A;  3HNJ A;  3OE0 A;  4KNF A;  2Y00 A;  3UTV A;  5JLI A;  3UON A;  2HPY A;  3QJQ B;  5B6X A;  1RCP A;  2YLG A;  5JSL A;  2YCW A;  2XLH A;  1VGO A;  1LN6 A;  3HNI A;  3QJS B;  2XM4 A;  1JFP A;  2R4R A;  2BRD A;  1F4Z A;  1S53 A;  3C63 A;  1L9H A;  3VI0 A;  3UG9 A;  5JT4 A;  5B2N A;  3QAP A;  2RH1 A;  1H68 A;  1C3W A;  1S54 A;  3VVK A;  1IXF A;  1VJM A;  5H2J A;  1APC A;  5AX1 A;  3A7K A;  3ODU A;  3PDS A;  4PXK A;  3UZA A;  5JJJ A;  2BC5 A;  5JUA A;  4G72 B;  4LDL A;  4FAA B;  1E12 A;  3P0G A;  5JVE A;  4XTO A;  2F93 A;  5B35 A;  1GUE A;  1M0L A;  3X3C A;  2ZZL A;  1R2N A;  4D4X A;  2QPE B;  3HAR A;  3VRC A;  1TN5 A;  1P8I A;  2XL6 A;  1MGY A;  2YL1 A;  5JJE A;  3M4B A;  3UZC A;  3REY A;  3QAK A;  2YDO A;  5B6V A;  4X1H A;  5JJN A;  1PY6 A;  1QPU A;  3HAP A;  4QI1 A;  4XTN A;  3COD A;  1E0P A;  1CPQ A;  2JAG A;  5AX0 A;  4N6H A;  1CGN A;  5H2K A;  3QBK A;  4UHR A;  4BV0 A;  4K5Y A;  3UTX A;  3DDL A;  5H2H A;  4EJ4 A;  3HNK A;  5ITC A;  3NSB A;  3QW0 A;  3PQR A;  4HYX A;  4IAQ A;  5B6Y A;  1IW9 A;  2YCY A;  2X72 A;  1EKY A;  1XME B;  4NC3 A;  2KSY A;  1F88 A;  1IW6 A;  5G28 A;  3S3C B;  2NTU A;  1S8J A;  2XLV A;  2M3G A;  3COC A;  4HWL A;  2YLD A;  3D4S A;  5JS5 A;  4JKV A;  1DZE A;  4JE9 A;  2Y02 A;  4MBS A;  2QLA A;  5AGF A;  4BWB A;  4X32 A;  2F95 A;  1X0S A;  4MQS A;  3KJ6 A;  3NY9 A;  5DYS A;  2KSB A;  3FOP A;  2I35 A;  5G53 A;  5H2L A;  3ZQY A;  1GZM A;  3QBL A;  4LDE A;  4U9D A;  3V2W A;  2I21 A;  5H2I A;  4IB4 A;  3HNL A;  4N4Y B;  3EML A;  3RFM A;  3S3B B;  5AHY A;  3PWH A;  1QKO A;  3UTW A;  5J7A A;  1H2S A;  3OE9 A;  1CGO A;  3M79 A;  2I1X A;  3VW7 A;  4JR8 A;  3RZE A;  4CIP A;  2YLI A;  2CCY A;  5G2C A;  1C8R A;  2QPD B;  1S52 A;  4BEZ A;  3EH5 B;  1EHK B;  3AYM A;  2Y03 A;  4FA7 B;  3ZTZ A;  2YL0 A;  3S8G B;  3OE8 A;  1NBB A;  3PXO A;  5B6W A;  4GP8 B;  5A45 A;  2XL8 A;  2NTW A;  4XTL A;  4AMI A;  5BR2 A;  2XLE A;  2J9B A;  4KLY A;  3TOM A;  2Y04 A;  5H2N A;  3DE8 A;  1KGB A;  2ZIY A;  5G36 A;  3OE6 A;  1A7V A;  1CPR A;  1S8L A;  5H2O A;  1PXS A;  1X0I 1;  1M0M A;  1PXR A;  1TN0 A;  5TGZ A;  4FPD A;  2J8W A;  3VG9 A;  2AT9 A;  1U19 A;  1YYJ A;  1YZA A;  3M4C A;  4D4N A;  4L6R A;  5G54 A;  3S8F B;  3ZWI A;  2R4S A;  2ZFE A;  4DJH A;  5JP7 A;  3V2Y A;  3HAS A;  4A4M A;  3QVZ A;  3ZPR A;  4XXJ A;  2J4Y A;  5DHG A;  1BRX A;  3FOO A;  4U9E A;  4IAR A;  5LWE A;  1QKP A;  2XLO A;  3NY8 A;  3VHZ A;  1JAF A;  5A44 A;  1F50 A;  4JQ6 A;  4CJO A;  3UTY A;  5JRA A;  4L35 A;  3OAX A;  5A8E A;  4OV0 A;  2Z73 A;  4BUO A;  3VGA A;  4GBR A;  4CX9 A;  3DE9 A;  2XLW A;  5AZD A;  1BM1 A;  1L0M A;  3QJT B;  1LM3 B;  3QVY A;  1AT9 A;  4GYC A;  3HAN A;  4WGY A;  5B0W A;  3C62 A;  3ZPQ A;  1CWQ A;  2LNL A;  4GP4 B;  3EH4 B;  4Y9H A;  3S3D B;  1O0A A;  1BRD A;  4EA3 A;  4DKL A;  3ZTM A;  3C9M A;  1X0K 1;  1Q5J A;  2Z55 A;  4XT3 A;  5BR5 A;  3IQ6 A;  1Q5I A;  4HYJ A;  3SN6 R;  1HZX A;  4MD1 A;  1AP9 A;  2Y01 A;  2KSA A;  2YL3 A;  3TOL A;  3L1M A;  2KS9 A;  4EIY A;  5C1M A;  3HAQ A;  3WQJ A;  1M6T A;  1M0K A;  2VT4 A;  3MBV A;  1S05 A;  1E83 A;  256B A;  4WGZ A;  1KG8 A;  4JEB A;  2YCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...