4L6RA

Structure of the class b human glucagon g protein coupled receptor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
413
structure length
398
Chain Sequence
b'ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562 and Glucagon receptor chimera
molecule tags Membrane protein
source organism Escherichia coli
publication title Structure of the human glucagon class B G-protein-coupled receptor.
pubmed doi rcsb
total genus 138
structure length 398
sequence length 413
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00002 7tm_2 7 transmembrane receptor (Secretin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4l6rA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4l6rA02
1M0MA 4AMJA 4XTOA 3HASA 3UTYA 5DHGA 3RFMA 1S54A 4U9DA 1F88A 2J4YA 5JLIA 5DHHA 4FAAB 1HZXA 5H2NA 4JKVA 2YLDA 4KNFA 3TOLA 3NSBA 5ITCA 1JAFA 3C9MA 2NTWA 5BR5A 1M6TA 4FBZA 1XMEB 1FBBA 5B6VA 3MBVA 5EN0A 2Y04A 4CJOA 4K5YA 2KSBA 4GP8B 2ZIYA 2Y02A 5JVEA 2QLAA 1X0I1 2JAGA 2I21A 3QVZA 3UTXA 4MQTA 5JJNA 5B0WA 5H2JA 1KG9A 4G72B 1M0LA 2Y01A 2YCWA 1KGBA 5JT4A 1R2NA 5AX1A 3T45A 3L1MA 5FJGA 4TL3A 4FA7B 2R4SA 3WQJA 1P8IA 1UAZA 3OE8A 3HAOA 1E84A 2F95A 5G36A 3EH3B 3NMKA 1CWQA 3C63A 5G2AA 1BRXA 2ZFEA 3V2WA 3FOOA 2KSYA 1MGYA 1TN5A 5H2KA 2R4RA 3ABWA 5B3IA 1BRDA 3QW0A 1DZEA 3ZEVA 1E0PA 4HYJA 2J8WA 3M15A 2XLVA 4IB4A 4ER9A 5AHZA 3AM6A 5B34A 3S8FB 3ZPRA 2JAFA 1M0KA 2VT4A 3HAPA 3VRCA 3ODUA 1A7VA 5KKHA 4BEYA 1GU8A 3UONA 3V2YA 3QBIA 4MBSA 5AZDA 2KS9A 1YYXA 5G53A 2WJKA 5A44A 5JSLA 2XL6A 3QJTB 3QAKA 4GP5B 3VGAA 5B6YA 1H68A 4CX9A 1YZCA 4CDYA 5A8EA 3NY8A 3PDSA 1BM1A 2XM4A 3X3CA 5JJEA 4L35A 1S8JA 3UG9A 1QKPA 3P0GA 4Y9HA 4WAVA 4EA3A 1IW9A 3ZWIA 4OV0A 5H2OA 3OAXA 1U19A 3QBLA 4BV0A 5J7AA 3QBGA 2F93A 3DQBA 4G71B 2I1XA 5G2DA 2XL8A 2LNLA 2XLHA 4IAQA 3C62A 2XM0A 2CCYA 1Q5IA 1VJMA 3DE8A 3S3CB 1L9HA 4QRYA 4CDVA 3UTVA 3C9LA 1GUEA 5DYSA 3PQRA 3EH5B 1YZAA 1PXRA 5F8UA 3NMIA 1LM3B 1PY6A 1UCQA 3QAPA 3QJSB 4HWLA 3S3DB 1AP9A 5G54A 2YCXA 3VI0A 3QJVB 4JEAA 3CODA 2AT9A 4U9EA 4AMIA 1CGNA 3AYNA 1EHKB 3PWHA 4WGYA 2YCYA 1BRRA 4N4YB 5JP7A 2YCZA 3A7KA 3REYA 4JQ6A 5B6ZA 3KJ6A 1L0MA 2M3GA 3QJQB 4XXJA 2G87A 5ETZA 4BWBA 4XT1A 1X0SA 4MD2A 3FOPA 3ZQVA 4XT3A 5C1MA 1CGOA 2Z73A 1IXFA 3DDLA 3UZCA 4PXFA 2I35A 3VW7A 4XTLA 5AHYA 2XLMA 3NMJA 2NTUA 3HNIA 4JR8A 1C3WA 1JV7A 1S52A 2Y00A 5ITEA 1CPQA 4NC3A 5JS5A 5A45A 1GQAA 5G2CA 3QDCA 4BUOA 3PBLA 4QI1A 1E83A 1KG8A 3TOMA 3S8GB 4XTNA 1QHJA 4G7SB 5AGFA 1YYJA 3IQ6A 4HYXA 4N4WA 4FPDA 1EKYA 1S53A 1IW6A 3QW1A 2XLWA 1APCA 3D4SA 4G7RB 4X1HA 2KSAA 1KMEA 4L6RA 1JFPA 5H2LA 4X32A 2EI4A 4DKLA 5JJJA 1PXSA 5B6WA 3HNLA 5AWZA 1CPRA 1X0K1 3COCA 1E86A 3ZPQA 4CJGA 4BEZA 2YKZA 5BR2A 2YL0A 2Y03A 4LDEA 3QVYA 1S51A 1QQ3A 3NY9A 3OE6A 4N6HA 2YL3A 2HPYA 4MD1A 3ZQYA 1XIOA 4D4XA 3HAQA 4CIPA 4JEBA 5H2MA 5H2IA 4GP4B 2YDVA 4DJHA 4GYCA 4JE9A 3QJRB 3VVKA 1QKOA 3HNJA 3EH4B 2YL7A 256BA 4IARA 1NBBA 3PXOA 4KLYA 3UZAA 4CDAA 4G70B 1AT9A 2YL1A 2YDOA 5JUAA 3BVDB 3EMLA 4EIYA 4MQSA 4GBRA 3RZEA 2X72A 4G7QB 3NYAA 1S05A 4DAJA 3DE9A 4D4NA 4EJ4A 5LWEA 2XLDA 3UTWA 3IQ5A 2Z55A 1E85A 2L6XA 4ULVA 4X31A 2QPDB 2BC5A 2J9BA 4A4MA 3M4CA 1JV6A 4WGZA 1TN0A 1LN6A 5TGZA 4LDOA 2XLEA 1P8HA 3HNKA 1P8UA 1XJIA 1GZMA 3HANA 1C8RA 4BVNA 3ZTZA 3ZTMA 3VG9A 4UG2A 3S3BB 2WJLA 1BBHA 3QBKA 2QPEB 3HARA 4J4QA 4GRVA 1C8SA 4UHRA 1JGJA 3VHZA 1FBKA 2ZZLA 2BRDA 4LDLA 5B2NA 1H2SA 3SN6R 2YLGA 1Q5JA 2YLIA 1RCPA 3QJUB 4GPOA 3OE9A 5AX0A 3OE0A 4PXKA 5H2HA 1F4ZA 4QIDA 5G28A 1E12A 3AYMA 3M4BA 1R84A 2I20A 1QM8A 5JRAA 1F50A 1VGOA 3CAPA 3X3BA 3M79A 3U8PA 5B35A 5H2PA 2RH1A 1MQVA 2PEDA 5B6XA 1O0AA 3NS0A 4WW3A 1QPUA 1S8LA 2XLOA
chains in the Genus database with same CATH superfamily
3SXZA 1Z23A 5AC4A 5DHGA 1ZU4A 5T1DB 4U9DA 3GM3A 2J4YA 5JLIA 2NUPB 4N6CA 4MVMA 1LI7A 3L0IA 1T9KA 2YLDA 2PF4E 1VK5A 4XEFA 3T9OA 5BR5A 4F4BA 5L0JA 1M6TA 5A6BD 2A1DD 1FBBA 2IXNA 1K04A 3MBVA 3VAYA 2KYHA 3EGXA 2KSBA 2ZIYA 5JVEA 3UTXA 3UR3C 3K1IA 4I44A 2NSFA 1HW1A 4G7OF 3EG9B 4PJLA 5AX1A 3ZSUA 4O6YA 2R4SA 3EFOB 1UAZA 1FR0A 3C7JA 1H6GA 5FZTA 2ASRA 1A7EA 5F28E 1ST6A 3L8IA 2AWCA 4YT2A 1V74B 1TR2A 3V7OA 3QW0A 1E0PA 4DXWA 2WZLA 2Y3BA 2EIKC 4BJTA 4IB4A 2R02A 3F47A 1T6IA 3ZPRA 2JAFA 3TJ5A 1M0KA 5B3SC 1A7VA 2VB6A 3V2YA 3QBIA 1BR2A 2KS9A 1YYXA 3DD7A 2FFHA 2Y39A 1T6QA 5A44A 1D0YA 3HJCA 3NYMA 5DQZA 5L0HA 4AE4A 3RIPA 4GP5B 3VGAA 5B6YA 2P7VA 3JYYA 1YZCA 1L7CA 3NY8A 3GM1A 3X3CA 3Q6NA 3DJUB 1NSGB 3HLZA 1QSPA 2EPNA 4WAVA 5D91A 5DQTA 1OCZC 5L0FA 3KPHA 1IW9A 4Z9JA 3GEHA 3ZWIA 4OV0A 4BV0A 3LLKA 2F93A 3DQBA 4G71B 3GM2A 4DVZA 3RYLA 1Q0MA 2CYDA 3RFYA 2DI3A 2HJ3A 2XLHA 4IAQA 1VB5A 3C62A 1OXBA 3U3FA 1Q5IA 3ZVRA 1Z7Qc 1BR4A 4GQHA 2GWWA 5DYSA 1SF8A 4XWJA 3PQRA 1FMVA 1D1AA 1HY5A 3C8GA 4OIQF 4PJMA 1YA7O 4HWLA 4PFOA 5G54A 4J30B 3K6BA 3CODA 2AT9A 1TWGA 1U0BB 3WG7C 1M2OA 3AYNA 1EHKB 3PWHA 2IXPA 2OJQA 4CSAC 2HJMA 2KC3A 2WZFA 4CS8A 2YCZA 1RKEB 4ONSA 3KJ6A 1ORSC 1BZ4A 2WL8A 4FX5A 2BL2A 3B0UX 2YHSA 3MLGA 3QZCA 5L0IA 2R05A 3FOPA 5C1MA 4XEVA 4I3MA 3SEOA 1L3PA 3SP1A 1IXFA 2IXMA 4PJNA 2I35A 1XWJA 3NMJA 3VYWA 4AL1A 1GS9A 1Y6DA 2D5RB 2OCCC 2WVQA 5B1AC 1E2XA 1VLSA 3MYFA 4QI2A 5TJ5E 3T6JA 4CIHA 3S8GB 3AQCA 5BQGA 3LAYA 4EWCA 1YYJA 2OU6A 4N4WA 4FPDA 2Y69C 1S53A 3RH3A 3ATPA 3GEEA 2KSAA 2Q9AA 3SZRA 5H2LA 3AGTA 4FWVA 3W8IA 4KC9A 4M63A 1PXSA 1ZVZA 3C8GD 1IZMA 1LS4A 2A0UA 3MFNA 4HEAJ 3UMKA 1E86A 3FAPB 2R7UA 4CJGA 4YT4A 2YKZA 5BR2A 2Q9CA 4E18A 3T6GB 1AUEA 2HMQA 2YL3A 1V55C 3U9JA 3S84A 2UUHA 2QE9A 3HAQA 2AP3A 4UDVA 3VF0A 1LPEA 4GYCA 1LKXA 2FGYA 1O5HA 1QKOA 4IARA 4G0HA 1ORJA 3ECSA 1O3UA 3M1CB 3E70C 5EK0A 1M2VB 3U3BA 2Q7RA 4C3EA 1WWPA 3UNGC 4JC7A 2X72A 2JD3A 3LESA 5D92A 3CSKA 3T4RA 1ZHZA 3B0PA 1NG1A 4EJ4A 3OA1A 1RMVA 3UTWA 2I8BA 1HE1A 4HE8D 2NUTA 2BC5A 1QVXA 3G4ZA 4BEMJ 1JV6A 3L34A 5HSWA 1LS1A 2L6FA 5TGZA 3RVYA 1MNEA 3NKDA 3JSEO 3ZTMA 3DXJF 2WJLA 2ZXPA 1BBHA 3HARA 4J4QA 1ZW2A 2KQ9A 3VHZA 4U5CE 4YL3A 4EBBA 4B6IA 4EBKA 1H9GA 1F4ZA 4QIDA 2DGJA 1A7DA 3M79A 5H2PA 2RH1A 1MQVA 2PEDA 2QY9A 1O0AA 4WW3A 1NU7D 2XLOA 5A6AA 4JURI 4C7OA 3RVZA 4XTOA 1S7ZA 3TULA 3HASA 1Z5ZA 1M2VA 1MNDA 4J7YA 3UMIA 4W8PA 1Q0FA 5H2NA 1ZHXA 5KYWB 4OIRF 4JKVA 1J8MF 1IW7F 4RDAA 3TOLA 5ITCA 4OINF 2NTWA 2XS8A 4FBZA 5B6VA 4EHPA 3W2VA 2Y04A 4CJOA 1ZZPA 2QLAA 4OIOF 3RQGA 1X0I1 3L8JA 3QVZA 3A9CA 2LCHA 2M64A 5JJNA 1ZW3A 5B0WA 3FVYA 4PJJA 2VCAA 1KG9A 3IQCA 3MX3A 4ANJA 4U5EE 2LP4A 2EPMX 1KGBA 1R2NA 2JX0A 2LFDA 2J0WA 2E87A 3ABKC 2KW3C 2KSFA 5FJGA 4E0HA 4TL3A 2J9VA 3EJNA 3JT1A 4CS9C 3IHUA 3PMRA 4GYTA 2VCBA 3TJ6A 5G2AA 1BRXA 5F5FA 2D4UA 2BE5F 1PD1A 3V2WA 1JR8A 1MGYA 3Q7LA 2J46A 1Q0GA 4OD4A 3DMDA 2LK4A 2R4RA 3ZEVA 3PHF2 3MYIA 3BRJA 3K1IC 4XPYA 5AHZA 3AM6A 1WGWA 5B34A 3S8FB 3R7CA 2HV7A 3VRCA 4G78A 2EILC 5KKHA 4BEYA 1KNYA 3UONA 4K7BA 1OR3A 2L9JA 4PACA 2WJKA 2CGEA 4AE4B 5IY5C 2VASA 5JSLA 3QJTB 5E33A 2PNOA 4DVYP 4CX9A 4CDYA 5A8EA 2PFDA 3PDSA 2NG1A 2J45A 3EFOA 4XTKA 5JJEA 3UG9A 2CNWA 3ZIBA 4C3BA 1N1CA 4EA3A 4EBJA 4HFKB 3LJBA 1U19A 3QBLA 4K1OA 5G2DA 2B0HA 2FAPB 4YWQA 2W9YA 1PV3A 1OQCA 2XM0A 1ZHTA 2CCYA 1VJMA 3S3CB 1L9HA 2XS1A 3JTLO 3EH5B 1SZIA 4QI0A 3AGUA 2YVKA 1YZAA 5F8UA 2HS5A 3AG3C 1PY6A 5A69A 2ZXRA 1O87A 3S3DB 1TWHA 4JZAA 2YCXA 3VI0A 3QJVB 4EUKB 2HMZA 4YK5A 4PR9A 5BQHA 4J32B 3C18A 2HZ8A 1LE4A 4U9EA 5E3CA 1CGNA 5B1BC 2W4MA 1RKEA 2A69F 1RKCA 1YAUO 4KBLA 1YVIA 1BRRA 4N4YB 1WN0A 3H2UA 3I4UA 3LLIA 2G87A 1OCRC 2G3VA 3DAFA 4JJFA 4XT1A 1X0SA 4E0IA 4MD2A 3RW0A 3K7DA 1RJ9B 4PXFA 3EH2A 4XTLA 2XLMA 1ZU5A 3FMSA 3TQOA 2P6VA 1S52A 5KYNA 1CPQA 3EPVA 2CNWD 3PBLA 1TQGA 2G3KA 1UG7A 4YN0B 2V3CC 4HYXA 4ZLDA 3ITFA 2AU5A 2IBFA 4FESA 1TWAA 3QW1A 1Q0KA 2XLWA 1F1MA 1ZHYA 4X1HA 2YRFA 4LDQA 4X32A 2EI4A 2EIMC 4DKLA 1SR2A 3HNLA 1X0K1 1RJ9A 4O6MA 4BEZA 3E9VA 1H7IA 4CS7A 1PD0A 4PK4A 1S51A 1OCOC 3OE6A 3HTKC 2R7VA 1OKKA 4AX2A 3H65A 4NTFA 4MD1A 4DBQA 2GA0A 2X0CA 4CIPA 1RXQA 4C3DA 3ZG1A 5BUOA 2YDVA 2DB4A 4Q7CA 4NY3A 3U8VA 4JE9A 1D1BA 5KYYB 4OD5A 5HV9A 3EH4B 3PXOA 2R7RA 3NYLA 3B9QA 4CDAA 3LNRA 4G70B 5BQIA 2RSEB 1AT9A 3EMLA 4EIYA 2EPKX 4GBRA 4H54A 4Z9IA 4CSAA 4G7QB 4LDRA 1G4US 2O9XA 4CS8C 4U5FE 3NRHA 5LWEA 2XLDA 1E85A 3AG1C 4ULVA 3EHNA 5L0DA 2J9BA 4A4MA 2HFIA 4WGZA 2A0BA 1LN6A 1AEPA 2XSEA 2I15A 4H4KC 1GZMA 4MTGA 3HANA 3LNMB 3O6XA 3ZTZA 3VG9A 1PCXA 3S3BB 2B0JA 4GRVA 1FBKA 4LDLA 3SN6R 1JPJA 4PFPA 2ETSA 4GPOA 3W8HA 3OE9A 1OKKD 3OE0A 4XLPF 3KKBA 4P6IC 3M4BA 2I20A 1QM8A 2IXOA 3POVA 3AJMA 5B35A 4MTOA 4XQ1A 1M0MA 4IAOA 4AMJA 1DOVA 2R03A 5CI9A 3UTYA 2LIGA 1HMDA 5DS6A 2C03A 1LI5A 4BPMA 3K33A 2VCCA 4BJ6C 4YT8A 4KNFA 2R7OA 4BJ1A 2QNLA 1U6HA 2J7PA 3NSBA 4A2NB 1JAFA 2IM8A 2H7OA 2OEVA 3NYJA 3SYNA 2P61A 4BG0A 4U5GA 4YL1A 4K5YA 4JCHA 3KH2A 2Y02A 4JTDB 1WOLA 2JAGA 4MW8A 1YJGA 2UUIA 2XRHA 1Z3IX 2AVKA 3EG9A 5H2JA 1UFBA 4G72B 1J8YF 2YCWA 1NLXA 1I4YA 3LS0A 3O39A 5FCLA 3HKKA 1OR2A 3T45A 2WVOA 3PDMP 3KMIA 3O10A 4FA7B 2ZXOA 3WQJA 2F95A 3FDQA 3X2QC 4E7ZA 1Z6AA 1FFTC 3FOOA 3FXHA 4BEJA 1NFOA 4O7GA 1AVOB 2YZSA 1NZEA 3JRTA 3O55A 3ABWA 4U5HA 1CGME 2J8WA 2OQMA 5L0CA 2XLVA 3CZ6A 4ER9A 5A6KA 4YT5A 4JTAB 2VT4A 3HAPA 3ODUA 3G4XA 4DS7E 3ZDLA 4FAPB 4EKWA 4MBSA 3GWNA 5AZDA 3DM9B 3J06A 5G53A 2J7PD 1G4WR 1FTSA 2L81A 2XL6A 4JRZA 4MVQA 3QAKA 4Q4ZF 2LSEA 1I4ZA 1BDJB 4NCQA 2OEXA 3BEHA 3C8ZA 1YA9A 5COGA 2HKVA 1S8JA 1QKPA 3DM5A 4Y9HA 3FAJA 5H2OA 3OAXA 3QBGA 1NU9C 2XL8A 2GFHA 3A11A 3DE8A 5K0IA 3RQFA 4JW1A 4CDVA 5L3QA 3UTVA 1R4TA 1GUEA 4IWBA 3EZIA 1LM3B 3I5PA 1UCQA 3QJSB 3DWWA 4DRIB 1AP9A 3DKAA 3IEEA 4JIOA 3JZ0A 2L7AA 3CAXA 4AMIA 1NFNA 3V5XA 4C7OB 1TFKB 3EGXB 4CS9A 4JQ6A 5B6ZA 1L0MA 2M3GA 2GDCA 3DI5A 2H7VC 3QJQB 3S9OA 4XXJA 1T6UA 2A6HF 3MBGA 1CGOA 2Z73A 4XLNF 2Y3GA 3DDLA 3UZCA 4MVRA 3PCVA 4BJ6A 5E2QA 1V54C 5AHYA 2NTUA 2QTVA 3HNIA 4JR8A 1C3WA 1JV7A 5ITEA 2Y00A 3KL4A 5A45A 1D0ZA 4DJ9A 4BUOA 3C8GB 4MQ9F 4QI1A 1SMYF 5COFA 3V5ZA 1MMNA 1FAPB 1KG8A 4MVUA 2Q4FA 2XL4A 3TOMA 2EPOA 4R32A 2Y3HA 4G7SB 1TKNA 1IW6A 5L3VA 2PX0A 4NTBA 1APCA 3K1HA 3UMHA 2H8AA 2NUTB 3D4SA 4RBNA 4G7RB 1M57C 1T5OA 2KK1A 1KMEA 4L6RA 1JFPA 4U5DE 5JJJA 1XZQA 4MVZA 5B6WA 3SNHA 3VM6A 5AWZA 3ZC4A 3NG1A 1MMGA 1C03A 3ABMC 4LDEA 2VC9A 3H2VA 1QQ3A 2QUPA 3RQEA 1ZYRF 4N6HA 2EPLX 2HPYA 2CDQA 4D4XA 3GODA 4JVSA 1K40A 3Q7GA 4U5BE 2MHRA 5H2MA 5H2IA 3QTHA 1KU2A 3U2LA 3VVKA 5KYUB 3GEIA 3HNJA 4KLYA 256BA 2EINC 2P0NA 3N2ZB 3U2MA 2YEVA 3EQLF 2Y3DA 5JUAA 3BVDB 3NKEA 4DOZA 4MQSA 3SXMA 3RZEA 1A0BA 4N06A 2R25A 3NYAA 3UGOA 3JYHA 3S27A 4IRUA 3ASOC 3IQ5A 2Z55A 1KTMA 5CI8A 3LUTB 3K66A 4XPXA 1WTYA 3W4YA 2WVNA 4AK9A 1G5ZA 4P9FA 4LDOA 1P8HA 1I5NA 3HNKA 3TD7A 1C8RA 2MYSA 1W2WA 3GANA 4IGGA 4BVNA 4UG2A 4P9TA 1LIHA 2Q9BA 3QBKA 2QPEB 1LVKA 1C8SA 4UHRA 4LLEA 1JGJA 2L6HA 3LEOA 1H2SA 5B2NA 4AL0A 4OIPF 2R7QA 3QJUB 2XXAB 2VH3A 1ZHWA 5H2HA 4I1MA 3GWLA 4DRHB 5G28A 1E12A 1R84A 1YLMA 1F50A 1VGOA 3CAPA 1YARO 4NTAA 3U8PA 3S0XA 5B6XA 4XEKA 4CBEA 1S8LA 3GORA 3N0TA 3U0CA 2ZXWC 3RFMA 1S54A 1F88A 2F22A 3CQZA 1OW7A 4JTCB 3SXKA 2KGOA 5DHHA 4FAAB 1HZXA 1K05A 2EIJC 3EGDB 1H9TA 3ABLC 2GAQA 3C9MA 5L0GA 2LD6A 2Z15A 1XMEB 3S90A 5EN0A 5KYXB 4G7HF 4GP8B 3KYJA 2I21A 4MQTA 3AOUA 2WZGA 4QDLA 3W2WA 1FFHA 4NQFA 4J7TA 1M0LA 2Y01A 3US6A 3B0VC 2XXAA 3DJNB 5JT4A 4E17A 2OKUA 3L1MA 5DS4A 2OOCA 1OW8A 1P8IA 3OE8A 2PX3A 3HAOA 1E84A 5G36A 3EH3B 3NMKA 1CWQA 3G50A 3C63A 3JSZA 1EA8A 2ZFEA 3UGPA 1JOGA 2KSYA 1TN5A 4ZLCA 4MVOA 5A6JA 5H2KA 2ZPAA 1VTMP 2LQGA 5B3IA 1BRDA 1DZEA 2A68F 4HYJA 2J0XA 2R7SA 3M15A 3LEVA 2YWAA 1G8XA 5EGYA 1DOWA 4WJ0A 4JJGA 1GU8A 1BR1A 1QKRA 4MS2A 3WAQA 2G62A 5E3AA 4MVSA 1HW2A 4IJJA 1WATA 2WB7A 5KYXA 1HE9A 3TK0A 3Q6MA 2ICWG 4KNVA 3X1OA 1H68A 2RD9A 3WODF 3B71A 2PP4A 3IQTA 1BM1A 1T01A 2XM4A 4L35A 3P0GA 3IPMO 4YL0A 1JRAA 4Q5SF 2DYRC 5J7AA 2I1XA 1Q0DA 4MTFA 3V5YA 2LNLA 2R7XA 1JMWA 4K0DA 4QRYA 2KNHA 3C9LA 5T3WA 1PXRA 3RKOF 1WASA 3DAGA 3NMIA 2YQYA 3QAPA 4I1OB 2DYSC 2HUJA 4HFFB 4JEAA 2H7BA 2IOQA 2MWQA 1GGQA 3FHDA 2V26A 1Z63A 1OCCC 5COMA 4WGYA 2YCYA 3RF3A 3SXYA 5JP7A 3A7KA 1VLTA 3REYA 4BJ5C 2HV6A 2J9UA 3AG2C 4JCZA 5ETZA 1FMWA 4BWBA 4KNWA 2TMVP 2CW0F 3ZQVA 4DBRA 4XT3A 3EZHA 4X0RA 1OXKA 2HSBA 5KYWA 3VW7A 1EI7A 4XPWA 3ASNC 4YJWA 3OEOA 3QMKA 2W4BA 4NC3A 1LE2A 5JS5A 1VOMA 1GQAA 1VMAA 1C17M 5G2CA 1U89A 3QDCA 1C02A 2L6GA 3R2PA 1E83A 3EH1A 3S28A 1HMOA 2AWYA 2Q3TA 4RD9A 4XTNA 4O79A 3NDBB 1QHJA 2P1AA 5AGFA 3IQ6A 1EKYA 3N24A 4BJ5A 5CIVA 1B68A 4W8KA 5T3TA 4A4AA 2NUPA 4LLCA 3JRMO 1CPRA 3COCA 3CEXA 3ZPQA 1M56C 1TWCA 2A6EF 4G7ZF 2YL0A 2Y03A 2PBEA 3QVYA 2KJGA 3JCUQ 3NY9A 5AC5A 1D0XA 4MNDA 5DLJA 3EHMA 4LERA 1VYKA 3ZQYA 1XIOA 1Y4CA 4WABA 3F46A 4JEBA 3I5QA 2R7TA 4GP4B 4DJHA 2Q00A 3OWTA 3QJRB 3AQBA 2YL7A 3UZAA 1NBBA 1R5ID 1YDIA 4E7SA 4Z9HA 3AG4C 2HSQA 5KYYA 4DRJB 1SYQA 1JPNA 2YL1A 1GM5A 2YDOA 2OG2A 5DS5A 3LS1A 2NSGA 2LFFA 3WHNA 5EHHA 2IYLD 2ZD9A 1S05A 4DAJA 5GPGB 1V4AA 3DE9A 4D4NA 1XZPA 3EGDA 4KI2A 4GEHA 1QZXA 1EQ1A 2L6XA 5A6BA 4X31A 1VYIA 2QPDB 1TFOB 3M4CA 1TN0A 4ULWA 1MMAA 3U5SA 2R9RB 2XLEA 3U9MA 2NPUA 2C04A 1P8UA 1XJIA 3B29A 1FNTc 3KYIA 4O6NA 1OW6A 4LACB 1MMDA 2ZZLA 2M4EA 3DZAA 2R7WA 2BRDA 4MW3A 2YLGA 1Q5JA 1ORYA 2YLIA 2JPUA 1RCPA 2W45A 1A41A 2OJED 5AX0A 4PXKA 5KYUA 3T6BA 1D1CA 3AYMA 1QLEC 2X51A 5JRAA 3X3BA 3S29A 5F5HA 5DVWA 4LDKA 2J9WA 3NS0A 1QPUA
chains in the Genus database with same CATH topology
1M0MA 4AMJA 4XTOA 3HASA 3UTYA 5DHGA 3RFMA 1S54A 4U9DA 1F88A 2J4YA 5JLIA 5DHHA 4FAAB 1HZXA 5H2NA 4JKVA 2YLDA 4KNFA 3TOLA 3NSBA 5ITCA 1JAFA 3C9MA 2NTWA 5BR5A 1M6TA 4FBZA 1XMEB 1FBBA 5B6VA 3MBVA 5EN0A 2Y04A 4CJOA 4K5YA 2KSBA 4GP8B 2ZIYA 2Y02A 5JVEA 2QLAA 1X0I1 2JAGA 2I21A 3QVZA 3UTXA 4MQTA 5JJNA 5B0WA 5H2JA 1KG9A 4G72B 1M0LA 2Y01A 2YCWA 1KGBA 5JT4A 1R2NA 5AX1A 3T45A 3L1MA 5FJGA 4TL3A 4FA7B 2R4SA 3WQJA 1P8IA 1UAZA 3OE8A 3HAOA 1E84A 2F95A 5G36A 3EH3B 3NMKA 1CWQA 3C63A 5G2AA 1BRXA 2ZFEA 3V2WA 3FOOA 2KSYA 1MGYA 1TN5A 5H2KA 2R4RA 3ABWA 5B3IA 1BRDA 3QW0A 1DZEA 3ZEVA 1E0PA 4HYJA 2J8WA 3M15A 2XLVA 4IB4A 4ER9A 5AHZA 3AM6A 5B34A 3S8FB 3ZPRA 2JAFA 1M0KA 2VT4A 3HAPA 3VRCA 3ODUA 1A7VA 5KKHA 4BEYA 1GU8A 3UONA 3V2YA 4DS7E 3QBIA 4MBSA 5AZDA 2KS9A 1YYXA 5G53A 2WJKA 5A44A 5JSLA 2XL6A 3QJTB 3QAKA 4GP5B 3VGAA 5B6YA 1H68A 4CX9A 1YZCA 4CDYA 5A8EA 3NY8A 3PDSA 1BM1A 2XM4A 3X3CA 5JJEA 4L35A 1S8JA 3UG9A 1QKPA 3P0GA 4Y9HA 4WAVA 4EA3A 1IW9A 3ZWIA 4OV0A 5H2OA 3OAXA 1U19A 3QBLA 4BV0A 5J7AA 3QBGA 2F93A 3DQBA 4G71B 2I1XA 5G2DA 2XL8A 2LNLA 2XLHA 4IAQA 3C62A 2XM0A 2CCYA 1Q5IA 1VJMA 3DE8A 3S3CB 1L9HA 4QRYA 4CDVA 3UTVA 3C9LA 1GUEA 5DYSA 3PQRA 3EH5B 1YZAA 1PXRA 5F8UA 3NMIA 1LM3B 1PY6A 1UCQA 3QAPA 3QJSB 4HWLA 3S3DB 1AP9A 5G54A 2YCXA 3VI0A 3QJVB 4JEAA 3CODA 2AT9A 4U9EA 4AMIA 1CGNA 3AYNA 1EHKB 3PWHA 4WGYA 2YCYA 1BRRA 4N4YB 5JP7A 2YCZA 3A7KA 3REYA 4JQ6A 5B6ZA 3KJ6A 1L0MA 2M3GA 3QJQB 4XXJA 2G87A 5ETZA 4BWBA 4XT1A 1X0SA 4MD2A 3FOPA 3ZQVA 4XT3A 5C1MA 1CGOA 2Z73A 1IXFA 3DDLA 3UZCA 4PXFA 2I35A 3VW7A 4XTLA 5AHYA 2XLMA 3NMJA 2NTUA 3HNIA 4JR8A 1C3WA 1JV7A 1S52A 2Y00A 5ITEA 1CPQA 4NC3A 5JS5A 5A45A 1GQAA 5G2CA 3QDCA 4BUOA 3PBLA 4QI1A 1E83A 1KG8A 3TOMA 3S8GB 4XTNA 1QHJA 4G7SB 5AGFA 1YYJA 3IQ6A 4HYXA 4N4WA 4FPDA 1EKYA 1S53A 1IW6A 3QW1A 2XLWA 1APCA 3D4SA 4G7RB 4X1HA 2KSAA 1KMEA 4L6RA 1JFPA 5H2LA 4X32A 2EI4A 4DKLA 5JJJA 1PXSA 5B6WA 3HNLA 5AWZA 1CPRA 1X0K1 3COCA 1E86A 3ZPQA 4CJGA 4BEZA 2YKZA 5BR2A 2YL0A 2Y03A 4LDEA 3QVYA 1S51A 1QQ3A 3NY9A 3OE6A 4N6HA 2YL3A 2HPYA 4MD1A 3ZQYA 1XIOA 4D4XA 3HAQA 4CIPA 4JEBA 5H2MA 5H2IA 4GP4B 2YDVA 4DJHA 4GYCA 4JE9A 3QJRB 3VVKA 1QKOA 3HNJA 3EH4B 2YL7A 256BA 4IARA 1NBBA 3PXOA 4KLYA 3UZAA 4CDAA 4G70B 1AT9A 2YL1A 2YDOA 5JUAA 3BVDB 3EMLA 4EIYA 4MQSA 4GBRA 3RZEA 2X72A 4G7QB 3NYAA 1S05A 4DAJA 3DE9A 4D4NA 4EJ4A 5LWEA 2XLDA 3UTWA 3IQ5A 2Z55A 1E85A 2L6XA 4ULVA 4X31A 2QPDB 2BC5A 2J9BA 4A4MA 3M4CA 1JV6A 4WGZA 1TN0A 1LN6A 5TGZA 4LDOA 2XLEA 1P8HA 3HNKA 1P8UA 1XJIA 1GZMA 3HANA 1C8RA 4BVNA 3ZTZA 3ZTMA 3VG9A 4UG2A 3S3BB 2WJLA 1BBHA 3QBKA 2QPEB 3HARA 4J4QA 4GRVA 1C8SA 4UHRA 1JGJA 3VHZA 1FBKA 2ZZLA 2BRDA 4LDLA 5B2NA 1H2SA 3SN6R 2YLGA 1Q5JA 2YLIA 1RCPA 3QJUB 4GPOA 3OE9A 5AX0A 3OE0A 4PXKA 5H2HA 1F4ZA 4QIDA 5G28A 1E12A 3AYMA 3M4BA 1R84A 2I20A 1QM8A 5JRAA 1F50A 1VGOA 3CAPA 3X3BA 3M79A 3U8PA 5B35A 5H2PA 2RH1A 1MQVA 2PEDA 5B6XA 1O0AA 3NS0A 4WW3A 1QPUA 1S8LA 2XLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M0M A;  4AMJ A;  4XTO A;  3HAS A;  3UTY A;  5DHG A;  3RFM A;  1S54 A;  4U9D A;  1F88 A;  2J4Y A;  5JLI A;  5DHH A;  4FAA B;  1HZX A;  5H2N A;  4JKV A;  2YLD A;  4KNF A;  3TOL A;  3NSB A;  5ITC A;  1JAF A;  3C9M A;  2NTW A;  5BR5 A;  1M6T A;  4FBZ A;  1XME B;  1FBB A;  5B6V A;  3MBV A;  5EN0 A;  2Y04 A;  4CJO A;  4K5Y A;  2KSB A;  4GP8 B;  2ZIY A;  2Y02 A;  5JVE A;  2QLA A;  1X0I 1;  2JAG A;  2I21 A;  3QVZ A;  3UTX A;  4MQT A;  5JJN A;  5B0W A;  5H2J A;  1KG9 A;  4G72 B;  1M0L A;  2Y01 A;  2YCW A;  1KGB A;  5JT4 A;  1R2N A;  5AX1 A;  3T45 A;  3L1M A;  5FJG A;  4TL3 A;  4FA7 B;  2R4S A;  3WQJ A;  1P8I A;  1UAZ A;  3OE8 A;  3HAO A;  1E84 A;  2F95 A;  5G36 A;  3EH3 B;  3NMK A;  1CWQ A;  3C63 A;  5G2A A;  1BRX A;  2ZFE A;  3V2W A;  3FOO A;  2KSY A;  1MGY A;  1TN5 A;  5H2K A;  2R4R A;  3ABW A;  5B3I A;  1BRD A;  3QW0 A;  1DZE A;  3ZEV A;  1E0P A;  4HYJ A;  2J8W A;  3M15 A;  2XLV A;  4IB4 A;  4ER9 A;  5AHZ A;  3AM6 A;  5B34 A;  3S8F B;  3ZPR A;  2JAF A;  1M0K A;  2VT4 A;  3HAP A;  3VRC A;  3ODU A;  1A7V A;  5KKH A;  4BEY A;  1GU8 A;  3UON A;  3V2Y A;  3QBI A;  4MBS A;  5AZD A;  2KS9 A;  1YYX A;  5G53 A;  2WJK A;  5A44 A;  5JSL A;  2XL6 A;  3QJT B;  3QAK A;  4GP5 B;  3VGA A;  5B6Y A;  1H68 A;  4CX9 A;  1YZC A;  4CDY A;  5A8E A;  3NY8 A;  3PDS A;  1BM1 A;  2XM4 A;  3X3C A;  5JJE A;  4L35 A;  1S8J A;  3UG9 A;  1QKP A;  3P0G A;  4Y9H A;  4WAV A;  4EA3 A;  1IW9 A;  3ZWI A;  4OV0 A;  5H2O A;  3OAX A;  1U19 A;  3QBL A;  4BV0 A;  5J7A A;  3QBG A;  2F93 A;  3DQB A;  4G71 B;  2I1X A;  5G2D A;  2XL8 A;  2LNL A;  2XLH A;  4IAQ A;  3C62 A;  2XM0 A;  2CCY A;  1Q5I A;  1VJM A;  3DE8 A;  3S3C B;  1L9H A;  4QRY A;  4CDV A;  3UTV A;  3C9L A;  1GUE A;  5DYS A;  3PQR A;  3EH5 B;  1YZA A;  1PXR A;  5F8U A;  3NMI A;  1LM3 B;  1PY6 A;  1UCQ A;  3QAP A;  3QJS B;  4HWL A;  3S3D B;  1AP9 A;  5G54 A;  2YCX A;  3VI0 A;  3QJV B;  4JEA A;  3COD A;  2AT9 A;  4U9E A;  4AMI A;  1CGN A;  3AYN A;  1EHK B;  3PWH A;  4WGY A;  2YCY A;  1BRR A;  4N4Y B;  5JP7 A;  2YCZ A;  3A7K A;  3REY A;  4JQ6 A;  5B6Z A;  3KJ6 A;  1L0M A;  2M3G A;  3QJQ B;  4XXJ A;  2G87 A;  5ETZ A;  4BWB A;  4XT1 A;  1X0S A;  4MD2 A;  3FOP A;  3ZQV A;  4XT3 A;  5C1M A;  1CGO A;  2Z73 A;  1IXF A;  3DDL A;  3UZC A;  4PXF A;  2I35 A;  3VW7 A;  4XTL A;  5AHY A;  2XLM A;  3NMJ A;  2NTU A;  3HNI A;  4JR8 A;  1C3W A;  1JV7 A;  1S52 A;  2Y00 A;  5ITE A;  1CPQ A;  4NC3 A;  5JS5 A;  5A45 A;  1GQA A;  5G2C A;  3QDC A;  4BUO A;  3PBL A;  4QI1 A;  1E83 A;  1KG8 A;  3TOM A;  3S8G B;  4XTN A;  1QHJ A;  4G7S B;  5AGF A;  1YYJ A;  3IQ6 A;  4HYX A;  4N4W A;  4FPD A;  1EKY A;  1S53 A;  1IW6 A;  3QW1 A;  2XLW A;  1APC A;  3D4S A;  4G7R B;  4X1H A;  2KSA A;  1KME A;  4L6R A;  1JFP A;  5H2L A;  4X32 A;  2EI4 A;  4DKL A;  5JJJ A;  1PXS A;  5B6W A;  3HNL A;  5AWZ A;  1CPR A;  1X0K 1;  3COC A;  1E86 A;  3ZPQ A;  4CJG A;  4BEZ A;  2YKZ A;  5BR2 A;  2YL0 A;  2Y03 A;  4LDE A;  3QVY A;  1S51 A;  1QQ3 A;  3NY9 A;  3OE6 A;  4N6H A;  2YL3 A;  2HPY A;  4MD1 A;  3ZQY A;  1XIO A;  4D4X A;  3HAQ A;  4CIP A;  4JEB A;  5H2M A;  5H2I A;  4GP4 B;  2YDV A;  4DJH A;  4GYC A;  4JE9 A;  3QJR B;  3VVK A;  1QKO A;  3HNJ A;  3EH4 B;  2YL7 A;  256B A;  4IAR A;  1NBB A;  3PXO A;  4KLY A;  3UZA A;  4CDA A;  4G70 B;  1AT9 A;  2YL1 A;  2YDO A;  5JUA A;  3BVD B;  3EML A;  4EIY A;  4MQS A;  4GBR A;  3RZE A;  2X72 A;  4G7Q B;  3NYA A;  1S05 A;  4DAJ A;  3DE9 A;  4D4N A;  4EJ4 A;  5LWE A;  2XLD A;  3UTW A;  3IQ5 A;  2Z55 A;  1E85 A;  2L6X A;  4ULV A;  4X31 A;  2QPD B;  2BC5 A;  2J9B A;  4A4M A;  3M4C A;  1JV6 A;  4WGZ A;  1TN0 A;  1LN6 A;  5TGZ A;  4LDO A;  2XLE A;  1P8H A;  3HNK A;  1P8U A;  1XJI A;  1GZM A;  3HAN A;  1C8R A;  4BVN A;  3ZTZ A;  3ZTM A;  3VG9 A;  4UG2 A;  3S3B B;  2WJL A;  1BBH A;  3QBK A;  2QPE B;  3HAR A;  4J4Q A;  4GRV A;  1C8S A;  4UHR A;  1JGJ A;  3VHZ A;  1FBK A;  2ZZL A;  2BRD A;  4LDL A;  5B2N A;  1H2S A;  3SN6 R;  2YLG A;  1Q5J A;  2YLI A;  1RCP A;  3QJU B;  4GPO A;  3OE9 A;  5AX0 A;  3OE0 A;  4PXK A;  5H2H A;  1F4Z A;  4QID A;  5G28 A;  1E12 A;  3AYM A;  3M4B A;  1R84 A;  2I20 A;  1QM8 A;  5JRA A;  1F50 A;  1VGO A;  3CAP A;  3X3B A;  3M79 A;  3U8P A;  5B35 A;  5H2P A;  2RH1 A;  1MQV A;  2PED A;  5B6X A;  1O0A A;  3NS0 A;  4WW3 A;  1QPU A;  1S8L A;  2XLO A; 
#chains in the Genus database with same CATH topology
 3SXZ A;  1Z23 A;  5AC4 A;  5DHG A;  1ZU4 A;  5T1D B;  4U9D A;  3GM3 A;  2J4Y A;  5JLI A;  2NUP B;  4N6C A;  4MVM A;  1LI7 A;  3L0I A;  1T9K A;  2YLD A;  2PF4 E;  1VK5 A;  4XEF A;  3T9O A;  5BR5 A;  4F4B A;  5L0J A;  1M6T A;  5A6B D;  2A1D D;  1FBB A;  2IXN A;  1K04 A;  3MBV A;  3VAY A;  2KYH A;  3EGX A;  2KSB A;  2ZIY A;  5JVE A;  3UTX A;  3UR3 C;  3K1I A;  4I44 A;  2NSF A;  1HW1 A;  4G7O F;  3EG9 B;  4PJL A;  5AX1 A;  3ZSU A;  4O6Y A;  2R4S A;  3EFO B;  1UAZ A;  1FR0 A;  3C7J A;  1H6G A;  5FZT A;  2ASR A;  1A7E A;  5F28 E;  1ST6 A;  3L8I A;  2AWC A;  4YT2 A;  1V74 B;  1TR2 A;  3V7O A;  3QW0 A;  1E0P A;  4DXW A;  2WZL A;  2Y3B A;  2EIK C;  4BJT A;  4IB4 A;  2R02 A;  3F47 A;  1T6I A;  3ZPR A;  2JAF A;  3TJ5 A;  1M0K A;  5B3S C;  1A7V A;  2VB6 A;  3V2Y A;  3QBI A;  1BR2 A;  2KS9 A;  1YYX A;  3DD7 A;  2FFH A;  2Y39 A;  1T6Q A;  5A44 A;  1D0Y A;  3HJC A;  3NYM A;  5DQZ A;  5L0H A;  4AE4 A;  3RIP A;  4GP5 B;  3VGA A;  5B6Y A;  2P7V A;  3JYY A;  1YZC A;  1L7C A;  3NY8 A;  3GM1 A;  3X3C A;  3Q6N A;  3DJU B;  1NSG B;  3HLZ A;  1QSP A;  2EPN A;  4WAV A;  5D91 A;  5DQT A;  1OCZ C;  5L0F A;  3KPH A;  1IW9 A;  4Z9J A;  3GEH A;  3ZWI A;  4OV0 A;  4BV0 A;  3LLK A;  2F93 A;  3DQB A;  4G71 B;  3GM2 A;  4DVZ A;  3RYL A;  1Q0M A;  2CYD A;  3RFY A;  2DI3 A;  2HJ3 A;  2XLH A;  4IAQ A;  1VB5 A;  3C62 A;  1OXB A;  3U3F A;  1Q5I A;  3ZVR A;  1Z7Q c;  1BR4 A;  4GQH A;  2GWW A;  5DYS A;  1SF8 A;  4XWJ A;  3PQR A;  1FMV A;  1D1A A;  1HY5 A;  3C8G A;  4OIQ F;  4PJM A;  1YA7 O;  4HWL A;  4PFO A;  5G54 A;  4J30 B;  3K6B A;  3COD A;  2AT9 A;  1TWG A;  1U0B B;  3WG7 C;  1M2O A;  3AYN A;  1EHK B;  3PWH A;  2IXP A;  2OJQ A;  4CSA C;  2HJM A;  2KC3 A;  2WZF A;  4CS8 A;  2YCZ A;  1RKE B;  4ONS A;  3KJ6 A;  1ORS C;  1BZ4 A;  2WL8 A;  4FX5 A;  2BL2 A;  3B0U X;  2YHS A;  3MLG A;  3QZC A;  5L0I A;  2R05 A;  3FOP A;  5C1M A;  4XEV A;  4I3M A;  3SEO A;  1L3P A;  3SP1 A;  1IXF A;  2IXM A;  4PJN A;  2I35 A;  1XWJ A;  3NMJ A;  3VYW A;  4AL1 A;  1GS9 A;  1Y6D A;  2D5R B;  2OCC C;  2WVQ A;  5B1A C;  1E2X A;  1VLS A;  3MYF A;  4QI2 A;  5TJ5 E;  3T6J A;  4CIH A;  3S8G B;  3AQC A;  5BQG A;  3LAY A;  4EWC A;  1YYJ A;  2OU6 A;  4N4W A;  4FPD A;  2Y69 C;  1S53 A;  3RH3 A;  3ATP A;  3GEE A;  2KSA A;  2Q9A A;  3SZR A;  5H2L A;  3AGT A;  4FWV A;  3W8I A;  4KC9 A;  4M63 A;  1PXS A;  1ZVZ A;  3C8G D;  1IZM A;  1LS4 A;  2A0U A;  3MFN A;  4HEA J;  3UMK A;  1E86 A;  3FAP B;  2R7U A;  4CJG A;  4YT4 A;  2YKZ A;  5BR2 A;  2Q9C A;  4E18 A;  3T6G B;  1AUE A;  2HMQ A;  2YL3 A;  1V55 C;  3U9J A;  3S84 A;  2UUH A;  2QE9 A;  3HAQ A;  2AP3 A;  4UDV A;  3VF0 A;  1LPE A;  4GYC A;  1LKX A;  2FGY A;  1O5H A;  1QKO A;  4IAR A;  4G0H A;  1ORJ A;  3ECS A;  1O3U A;  3M1C B;  3E70 C;  5EK0 A;  1M2V B;  3U3B A;  2Q7R A;  4C3E A;  1WWP A;  3UNG C;  4JC7 A;  2X72 A;  2JD3 A;  3LES A;  5D92 A;  3CSK A;  3T4R A;  1ZHZ A;  3B0P A;  1NG1 A;  4EJ4 A;  3OA1 A;  1RMV A;  3UTW A;  2I8B A;  1HE1 A;  4HE8 D;  2NUT A;  2BC5 A;  1QVX A;  3G4Z A;  4BEM J;  1JV6 A;  3L34 A;  5HSW A;  1LS1 A;  2L6F A;  5TGZ A;  3RVY A;  1MNE A;  3NKD A;  3JSE O;  3ZTM A;  3DXJ F;  2WJL A;  2ZXP A;  1BBH A;  3HAR A;  4J4Q A;  1ZW2 A;  2KQ9 A;  3VHZ A;  4U5C E;  4YL3 A;  4EBB A;  4B6I A;  4EBK A;  1H9G A;  1F4Z A;  4QID A;  2DGJ A;  1A7D A;  3M79 A;  5H2P A;  2RH1 A;  1MQV A;  2PED A;  2QY9 A;  1O0A A;  4WW3 A;  1NU7 D;  2XLO A;  5A6A A;  4JUR I;  4C7O A;  3RVZ A;  4XTO A;  1S7Z A;  3TUL A;  3HAS A;  1Z5Z A;  1M2V A;  1MND A;  4J7Y A;  3UMI A;  4W8P A;  1Q0F A;  5H2N A;  1ZHX A;  5KYW B;  4OIR F;  4JKV A;  1J8M F;  1IW7 F;  4RDA A;  3TOL A;  5ITC A;  4OIN F;  2NTW A;  2XS8 A;  4FBZ A;  5B6V A;  4EHP A;  3W2V A;  2Y04 A;  4CJO A;  1ZZP A;  2QLA A;  4OIO F;  3RQG A;  1X0I 1;  3L8J A;  3QVZ A;  3A9C A;  2LCH A;  2M64 A;  5JJN A;  1ZW3 A;  5B0W A;  3FVY A;  4PJJ A;  2VCA A;  1KG9 A;  3IQC A;  3MX3 A;  4ANJ A;  4U5E E;  2LP4 A;  2EPM X;  1KGB A;  1R2N A;  2JX0 A;  2LFD A;  2J0W A;  2E87 A;  3ABK C;  2KW3 C;  2KSF A;  5FJG A;  4E0H A;  4TL3 A;  2J9V A;  3EJN A;  3JT1 A;  4CS9 C;  3IHU A;  3PMR A;  4GYT A;  2VCB A;  3TJ6 A;  5G2A A;  1BRX A;  5F5F A;  2D4U A;  2BE5 F;  1PD1 A;  3V2W A;  1JR8 A;  1MGY A;  3Q7L A;  2J46 A;  1Q0G A;  4OD4 A;  3DMD A;  2LK4 A;  2R4R A;  3ZEV A;  3PHF 2;  3MYI A;  3BRJ A;  3K1I C;  4XPY A;  5AHZ A;  3AM6 A;  1WGW A;  5B34 A;  3S8F B;  3R7C A;  2HV7 A;  3VRC A;  4G78 A;  2EIL C;  5KKH A;  4BEY A;  1KNY A;  3UON A;  4K7B A;  1OR3 A;  2L9J A;  4PAC A;  2WJK A;  2CGE A;  4AE4 B;  5IY5 C;  2VAS A;  5JSL A;  3QJT B;  5E33 A;  2PNO A;  4DVY P;  4CX9 A;  4CDY A;  5A8E A;  2PFD A;  3PDS A;  2NG1 A;  2J45 A;  3EFO A;  4XTK A;  5JJE A;  3UG9 A;  2CNW A;  3ZIB A;  4C3B A;  1N1C A;  4EA3 A;  4EBJ A;  4HFK B;  3LJB A;  1U19 A;  3QBL A;  4K1O A;  5G2D A;  2B0H A;  2FAP B;  4YWQ A;  2W9Y A;  1PV3 A;  1OQC A;  2XM0 A;  1ZHT A;  2CCY A;  1VJM A;  3S3C B;  1L9H A;  2XS1 A;  3JTL O;  3EH5 B;  1SZI A;  4QI0 A;  3AGU A;  2YVK A;  1YZA A;  5F8U A;  2HS5 A;  3AG3 C;  1PY6 A;  5A69 A;  2ZXR A;  1O87 A;  3S3D B;  1TWH A;  4JZA A;  2YCX A;  3VI0 A;  3QJV B;  4EUK B;  2HMZ A;  4YK5 A;  4PR9 A;  5BQH A;  4J32 B;  3C18 A;  2HZ8 A;  1LE4 A;  4U9E A;  5E3C A;  1CGN A;  5B1B C;  2W4M A;  1RKE A;  2A69 F;  1RKC A;  1YAU O;  4KBL A;  1YVI A;  1BRR A;  4N4Y B;  1WN0 A;  3H2U A;  3I4U A;  3LLI A;  2G87 A;  1OCR C;  2G3V A;  3DAF A;  4JJF A;  4XT1 A;  1X0S A;  4E0I A;  4MD2 A;  3RW0 A;  3K7D A;  1RJ9 B;  4PXF A;  3EH2 A;  4XTL A;  2XLM A;  1ZU5 A;  3FMS A;  3TQO A;  2P6V A;  1S52 A;  5KYN A;  1CPQ A;  3EPV A;  2CNW D;  3PBL A;  1TQG A;  2G3K A;  1UG7 A;  4YN0 B;  2V3C C;  4HYX A;  4ZLD A;  3ITF A;  2AU5 A;  2IBF A;  4FES A;  1TWA A;  3QW1 A;  1Q0K A;  2XLW A;  1F1M A;  1ZHY A;  4X1H A;  2YRF A;  4LDQ A;  4X32 A;  2EI4 A;  2EIM C;  4DKL A;  1SR2 A;  3HNL A;  1X0K 1;  1RJ9 A;  4O6M A;  4BEZ A;  3E9V A;  1H7I A;  4CS7 A;  1PD0 A;  4PK4 A;  1S51 A;  1OCO C;  3OE6 A;  3HTK C;  2R7V A;  1OKK A;  4AX2 A;  3H65 A;  4NTF A;  4MD1 A;  4DBQ A;  2GA0 A;  2X0C A;  4CIP A;  1RXQ A;  4C3D A;  3ZG1 A;  5BUO A;  2YDV A;  2DB4 A;  4Q7C A;  4NY3 A;  3U8V A;  4JE9 A;  1D1B A;  5KYY B;  4OD5 A;  5HV9 A;  3EH4 B;  3PXO A;  2R7R A;  3NYL A;  3B9Q A;  4CDA A;  3LNR A;  4G70 B;  5BQI A;  2RSE B;  1AT9 A;  3EML A;  4EIY A;  2EPK X;  4GBR A;  4H54 A;  4Z9I A;  4CSA A;  4G7Q B;  4LDR A;  1G4U S;  2O9X A;  4CS8 C;  4U5F E;  3NRH A;  5LWE A;  2XLD A;  1E85 A;  3AG1 C;  4ULV A;  3EHN A;  5L0D A;  2J9B A;  4A4M A;  2HFI A;  4WGZ A;  2A0B A;  1LN6 A;  1AEP A;  2XSE A;  2I15 A;  4H4K C;  1GZM A;  4MTG A;  3HAN A;  3LNM B;  3O6X A;  3ZTZ A;  3VG9 A;  1PCX A;  3S3B B;  2B0J A;  4GRV A;  1FBK A;  4LDL A;  3SN6 R;  1JPJ A;  4PFP A;  2ETS A;  4GPO A;  3W8H A;  3OE9 A;  1OKK D;  3OE0 A;  4XLP F;  3KKB A;  4P6I C;  3M4B A;  2I20 A;  1QM8 A;  2IXO A;  3POV A;  3AJM A;  5B35 A;  4MTO A;  4XQ1 A;  1M0M A;  4IAO A;  4AMJ A;  1DOV A;  2R03 A;  5CI9 A;  3UTY A;  2LIG A;  1HMD A;  5DS6 A;  2C03 A;  1LI5 A;  4BPM A;  3K33 A;  2VCC A;  4BJ6 C;  4YT8 A;  4KNF A;  2R7O A;  4BJ1 A;  2QNL A;  1U6H A;  2J7P A;  3NSB A;  4A2N B;  1JAF A;  2IM8 A;  2H7O A;  2OEV A;  3NYJ A;  3SYN A;  2P61 A;  4BG0 A;  4U5G A;  4YL1 A;  4K5Y A;  4JCH A;  3KH2 A;  2Y02 A;  4JTD B;  1WOL A;  2JAG A;  4MW8 A;  1YJG A;  2UUI A;  2XRH A;  1Z3I X;  2AVK A;  3EG9 A;  5H2J A;  1UFB A;  4G72 B;  1J8Y F;  2YCW A;  1NLX A;  1I4Y A;  3LS0 A;  3O39 A;  5FCL A;  3HKK A;  1OR2 A;  3T45 A;  2WVO A;  3PDM P;  3KMI A;  3O10 A;  4FA7 B;  2ZXO A;  3WQJ A;  2F95 A;  3FDQ A;  3X2Q C;  4E7Z A;  1Z6A A;  1FFT C;  3FOO A;  3FXH A;  4BEJ A;  1NFO A;  4O7G A;  1AVO B;  2YZS A;  1NZE A;  3JRT A;  3O55 A;  3ABW A;  4U5H A;  1CGM E;  2J8W A;  2OQM A;  5L0C A;  2XLV A;  3CZ6 A;  4ER9 A;  5A6K A;  4YT5 A;  4JTA B;  2VT4 A;  3HAP A;  3ODU A;  3G4X A;  4DS7 E;  3ZDL A;  4FAP B;  4EKW A;  4MBS A;  3GWN A;  5AZD A;  3DM9 B;  3J06 A;  5G53 A;  2J7P D;  1G4W R;  1FTS A;  2L81 A;  2XL6 A;  4JRZ A;  4MVQ A;  3QAK A;  4Q4Z F;  2LSE A;  1I4Z A;  1BDJ B;  4NCQ A;  2OEX A;  3BEH A;  3C8Z A;  1YA9 A;  5COG A;  2HKV A;  1S8J A;  1QKP A;  3DM5 A;  4Y9H A;  3FAJ A;  5H2O A;  3OAX A;  3QBG A;  1NU9 C;  2XL8 A;  2GFH A;  3A11 A;  3DE8 A;  5K0I A;  3RQF A;  4JW1 A;  4CDV A;  5L3Q A;  3UTV A;  1R4T A;  1GUE A;  4IWB A;  3EZI A;  1LM3 B;  3I5P A;  1UCQ A;  3QJS B;  3DWW A;  4DRI B;  1AP9 A;  3DKA A;  3IEE A;  4JIO A;  3JZ0 A;  2L7A A;  3CAX A;  4AMI A;  1NFN A;  3V5X A;  4C7O B;  1TFK B;  3EGX B;  4CS9 A;  4JQ6 A;  5B6Z A;  1L0M A;  2M3G A;  2GDC A;  3DI5 A;  2H7V C;  3QJQ B;  3S9O A;  4XXJ A;  1T6U A;  2A6H F;  3MBG A;  1CGO A;  2Z73 A;  4XLN F;  2Y3G A;  3DDL A;  3UZC A;  4MVR A;  3PCV A;  4BJ6 A;  5E2Q A;  1V54 C;  5AHY A;  2NTU A;  2QTV A;  3HNI A;  4JR8 A;  1C3W A;  1JV7 A;  5ITE A;  2Y00 A;  3KL4 A;  5A45 A;  1D0Z A;  4DJ9 A;  4BUO A;  3C8G B;  4MQ9 F;  4QI1 A;  1SMY F;  5COF A;  3V5Z A;  1MMN A;  1FAP B;  1KG8 A;  4MVU A;  2Q4F A;  2XL4 A;  3TOM A;  2EPO A;  4R32 A;  2Y3H A;  4G7S B;  1TKN A;  1IW6 A;  5L3V A;  2PX0 A;  4NTB A;  1APC A;  3K1H A;  3UMH A;  2H8A A;  2NUT B;  3D4S A;  4RBN A;  4G7R B;  1M57 C;  1T5O A;  2KK1 A;  1KME A;  4L6R A;  1JFP A;  4U5D E;  5JJJ A;  1XZQ A;  4MVZ A;  5B6W A;  3SNH A;  3VM6 A;  5AWZ A;  3ZC4 A;  3NG1 A;  1MMG A;  1C03 A;  3ABM C;  4LDE A;  2VC9 A;  3H2V A;  1QQ3 A;  2QUP A;  3RQE A;  1ZYR F;  4N6H A;  2EPL X;  2HPY A;  2CDQ A;  4D4X A;  3GOD A;  4JVS A;  1K40 A;  3Q7G A;  4U5B E;  2MHR A;  5H2M A;  5H2I A;  3QTH A;  1KU2 A;  3U2L A;  3VVK A;  5KYU B;  3GEI A;  3HNJ A;  4KLY A;  256B A;  2EIN C;  2P0N A;  3N2Z B;  3U2M A;  2YEV A;  3EQL F;  2Y3D A;  5JUA A;  3BVD B;  3NKE A;  4DOZ A;  4MQS A;  3SXM A;  3RZE A;  1A0B A;  4N06 A;  2R25 A;  3NYA A;  3UGO A;  3JYH A;  3S27 A;  4IRU A;  3ASO C;  3IQ5 A;  2Z55 A;  1KTM A;  5CI8 A;  3LUT B;  3K66 A;  4XPX A;  1WTY A;  3W4Y A;  2WVN A;  4AK9 A;  1G5Z A;  4P9F A;  4LDO A;  1P8H A;  1I5N A;  3HNK A;  3TD7 A;  1C8R A;  2MYS A;  1W2W A;  3GAN A;  4IGG A;  4BVN A;  4UG2 A;  4P9T A;  1LIH A;  2Q9B A;  3QBK A;  2QPE B;  1LVK A;  1C8S A;  4UHR A;  4LLE A;  1JGJ A;  2L6H A;  3LEO A;  1H2S A;  5B2N A;  4AL0 A;  4OIP F;  2R7Q A;  3QJU B;  2XXA B;  2VH3 A;  1ZHW A;  5H2H A;  4I1M A;  3GWL A;  4DRH B;  5G28 A;  1E12 A;  1R84 A;  1YLM A;  1F50 A;  1VGO A;  3CAP A;  1YAR O;  4NTA A;  3U8P A;  3S0X A;  5B6X A;  4XEK A;  4CBE A;  1S8L A;  3GOR A;  3N0T A;  3U0C A;  2ZXW C;  3RFM A;  1S54 A;  1F88 A;  2F22 A;  3CQZ A;  1OW7 A;  4JTC B;  3SXK A;  2KGO A;  5DHH A;  4FAA B;  1HZX A;  1K05 A;  2EIJ C;  3EGD B;  1H9T A;  3ABL C;  2GAQ A;  3C9M A;  5L0G A;  2LD6 A;  2Z15 A;  1XME B;  3S90 A;  5EN0 A;  5KYX B;  4G7H F;  4GP8 B;  3KYJ A;  2I21 A;  4MQT A;  3AOU A;  2WZG A;  4QDL A;  3W2W A;  1FFH A;  4NQF A;  4J7T A;  1M0L A;  2Y01 A;  3US6 A;  3B0V C;  2XXA A;  3DJN B;  5JT4 A;  4E17 A;  2OKU A;  3L1M A;  5DS4 A;  2OOC A;  1OW8 A;  1P8I A;  3OE8 A;  2PX3 A;  3HAO A;  1E84 A;  5G36 A;  3EH3 B;  3NMK A;  1CWQ A;  3G50 A;  3C63 A;  3JSZ A;  1EA8 A;  2ZFE A;  3UGP A;  1JOG A;  2KSY A;  1TN5 A;  4ZLC A;  4MVO A;  5A6J A;  5H2K A;  2ZPA A;  1VTM P;  2LQG A;  5B3I A;  1BRD A;  1DZE A;  2A68 F;  4HYJ A;  2J0X A;  2R7S A;  3M15 A;  3LEV A;  2YWA A;  1G8X A;  5EGY A;  1DOW A;  4WJ0 A;  4JJG A;  1GU8 A;  1BR1 A;  1QKR A;  4MS2 A;  3WAQ A;  2G62 A;  5E3A A;  4MVS A;  1HW2 A;  4IJJ A;  1WAT A;  2WB7 A;  5KYX A;  1HE9 A;  3TK0 A;  3Q6M A;  2ICW G;  4KNV A;  3X1O A;  1H68 A;  2RD9 A;  3WOD F;  3B71 A;  2PP4 A;  3IQT A;  1BM1 A;  1T01 A;  2XM4 A;  4L35 A;  3P0G A;  3IPM O;  4YL0 A;  1JRA A;  4Q5S F;  2DYR C;  5J7A A;  2I1X A;  1Q0D A;  4MTF A;  3V5Y A;  2LNL A;  2R7X A;  1JMW A;  4K0D A;  4QRY A;  2KNH A;  3C9L A;  5T3W A;  1PXR A;  3RKO F;  1WAS A;  3DAG A;  3NMI A;  2YQY A;  3QAP A;  4I1O B;  2DYS C;  2HUJ A;  4HFF B;  4JEA A;  2H7B A;  2IOQ A;  2MWQ A;  1GGQ A;  3FHD A;  2V26 A;  1Z63 A;  1OCC C;  5COM A;  4WGY A;  2YCY A;  3RF3 A;  3SXY A;  5JP7 A;  3A7K A;  1VLT A;  3REY A;  4BJ5 C;  2HV6 A;  2J9U A;  3AG2 C;  4JCZ A;  5ETZ A;  1FMW A;  4BWB A;  4KNW A;  2TMV P;  2CW0 F;  3ZQV A;  4DBR A;  4XT3 A;  3EZH A;  4X0R A;  1OXK A;  2HSB A;  5KYW A;  3VW7 A;  1EI7 A;  4XPW A;  3ASN C;  4YJW A;  3OEO A;  3QMK A;  2W4B A;  4NC3 A;  1LE2 A;  5JS5 A;  1VOM A;  1GQA A;  1VMA A;  1C17 M;  5G2C A;  1U89 A;  3QDC A;  1C02 A;  2L6G A;  3R2P A;  1E83 A;  3EH1 A;  3S28 A;  1HMO A;  2AWY A;  2Q3T A;  4RD9 A;  4XTN A;  4O79 A;  3NDB B;  1QHJ A;  2P1A A;  5AGF A;  3IQ6 A;  1EKY A;  3N24 A;  4BJ5 A;  5CIV A;  1B68 A;  4W8K A;  5T3T A;  4A4A A;  2NUP A;  4LLC A;  3JRM O;  1CPR A;  3COC A;  3CEX A;  3ZPQ A;  1M56 C;  1TWC A;  2A6E F;  4G7Z F;  2YL0 A;  2Y03 A;  2PBE A;  3QVY A;  2KJG A;  3JCU Q;  3NY9 A;  5AC5 A;  1D0X A;  4MND A;  5DLJ A;  3EHM A;  4LER A;  1VYK A;  3ZQY A;  1XIO A;  1Y4C A;  4WAB A;  3F46 A;  4JEB A;  3I5Q A;  2R7T A;  4GP4 B;  4DJH A;  2Q00 A;  3OWT A;  3QJR B;  3AQB A;  2YL7 A;  3UZA A;  1NBB A;  1R5I D;  1YDI A;  4E7S A;  4Z9H A;  3AG4 C;  2HSQ A;  5KYY A;  4DRJ B;  1SYQ A;  1JPN A;  2YL1 A;  1GM5 A;  2YDO A;  2OG2 A;  5DS5 A;  3LS1 A;  2NSG A;  2LFF A;  3WHN A;  5EHH A;  2IYL D;  2ZD9 A;  1S05 A;  4DAJ A;  5GPG B;  1V4A A;  3DE9 A;  4D4N A;  1XZP A;  3EGD A;  4KI2 A;  4GEH A;  1QZX A;  1EQ1 A;  2L6X A;  5A6B A;  4X31 A;  1VYI A;  2QPD B;  1TFO B;  3M4C A;  1TN0 A;  4ULW A;  1MMA A;  3U5S A;  2R9R B;  2XLE A;  3U9M A;  2NPU A;  2C04 A;  1P8U A;  1XJI A;  3B29 A;  1FNT c;  3KYI A;  4O6N A;  1OW6 A;  4LAC B;  1MMD A;  2ZZL A;  2M4E A;  3DZA A;  2R7W A;  2BRD A;  4MW3 A;  2YLG A;  1Q5J A;  1ORY A;  2YLI A;  2JPU A;  1RCP A;  2W45 A;  1A41 A;  2OJE D;  5AX0 A;  4PXK A;  5KYU A;  3T6B A;  1D1C A;  3AYM A;  1QLE C;  2X51 A;  5JRA A;  3X3B A;  3S29 A;  5F5H A;  5DVW A;  4LDK A;  2J9W A;  3NS0 A;  1QPU A; 
#chains in the Genus database with same CATH homology
 1M0M A;  4AMJ A;  4XTO A;  3HAS A;  3UTY A;  5DHG A;  3RFM A;  1S54 A;  4U9D A;  1F88 A;  2J4Y A;  5JLI A;  5DHH A;  4FAA B;  1HZX A;  5H2N A;  4JKV A;  2YLD A;  4KNF A;  3TOL A;  3NSB A;  5ITC A;  1JAF A;  3C9M A;  2NTW A;  5BR5 A;  1M6T A;  4FBZ A;  1XME B;  1FBB A;  5B6V A;  3MBV A;  5EN0 A;  2Y04 A;  4CJO A;  4K5Y A;  2KSB A;  4GP8 B;  2ZIY A;  2Y02 A;  5JVE A;  2QLA A;  1X0I 1;  2JAG A;  2I21 A;  3QVZ A;  3UTX A;  4MQT A;  5JJN A;  5B0W A;  5H2J A;  1KG9 A;  4G72 B;  1M0L A;  2Y01 A;  2YCW A;  1KGB A;  5JT4 A;  1R2N A;  5AX1 A;  3T45 A;  3L1M A;  5FJG A;  4TL3 A;  4FA7 B;  2R4S A;  3WQJ A;  1P8I A;  1UAZ A;  3OE8 A;  3HAO A;  1E84 A;  2F95 A;  5G36 A;  3EH3 B;  3NMK A;  1CWQ A;  3C63 A;  5G2A A;  1BRX A;  2ZFE A;  3V2W A;  3FOO A;  2KSY A;  1MGY A;  1TN5 A;  5H2K A;  2R4R A;  3ABW A;  5B3I A;  1BRD A;  3QW0 A;  1DZE A;  3ZEV A;  1E0P A;  4HYJ A;  2J8W A;  3M15 A;  2XLV A;  4IB4 A;  4ER9 A;  5AHZ A;  3AM6 A;  5B34 A;  3S8F B;  3ZPR A;  2JAF A;  1M0K A;  2VT4 A;  3HAP A;  3VRC A;  3ODU A;  1A7V A;  5KKH A;  4BEY A;  1GU8 A;  3UON A;  3V2Y A;  4DS7 E;  3QBI A;  4MBS A;  5AZD A;  2KS9 A;  1YYX A;  5G53 A;  2WJK A;  5A44 A;  5JSL A;  2XL6 A;  3QJT B;  3QAK A;  4GP5 B;  3VGA A;  5B6Y A;  1H68 A;  4CX9 A;  1YZC A;  4CDY A;  5A8E A;  3NY8 A;  3PDS A;  1BM1 A;  2XM4 A;  3X3C A;  5JJE A;  4L35 A;  1S8J A;  3UG9 A;  1QKP A;  3P0G A;  4Y9H A;  4WAV A;  4EA3 A;  1IW9 A;  3ZWI A;  4OV0 A;  5H2O A;  3OAX A;  1U19 A;  3QBL A;  4BV0 A;  5J7A A;  3QBG A;  2F93 A;  3DQB A;  4G71 B;  2I1X A;  5G2D A;  2XL8 A;  2LNL A;  2XLH A;  4IAQ A;  3C62 A;  2XM0 A;  2CCY A;  1Q5I A;  1VJM A;  3DE8 A;  3S3C B;  1L9H A;  4QRY A;  4CDV A;  3UTV A;  3C9L A;  1GUE A;  5DYS A;  3PQR A;  3EH5 B;  1YZA A;  1PXR A;  5F8U A;  3NMI A;  1LM3 B;  1PY6 A;  1UCQ A;  3QAP A;  3QJS B;  4HWL A;  3S3D B;  1AP9 A;  5G54 A;  2YCX A;  3VI0 A;  3QJV B;  4JEA A;  3COD A;  2AT9 A;  4U9E A;  4AMI A;  1CGN A;  3AYN A;  1EHK B;  3PWH A;  4WGY A;  2YCY A;  1BRR A;  4N4Y B;  5JP7 A;  2YCZ A;  3A7K A;  3REY A;  4JQ6 A;  5B6Z A;  3KJ6 A;  1L0M A;  2M3G A;  3QJQ B;  4XXJ A;  2G87 A;  5ETZ A;  4BWB A;  4XT1 A;  1X0S A;  4MD2 A;  3FOP A;  3ZQV A;  4XT3 A;  5C1M A;  1CGO A;  2Z73 A;  1IXF A;  3DDL A;  3UZC A;  4PXF A;  2I35 A;  3VW7 A;  4XTL A;  5AHY A;  2XLM A;  3NMJ A;  2NTU A;  3HNI A;  4JR8 A;  1C3W A;  1JV7 A;  1S52 A;  2Y00 A;  5ITE A;  1CPQ A;  4NC3 A;  5JS5 A;  5A45 A;  1GQA A;  5G2C A;  3QDC A;  4BUO A;  3PBL A;  4QI1 A;  1E83 A;  1KG8 A;  3TOM A;  3S8G B;  4XTN A;  1QHJ A;  4G7S B;  5AGF A;  1YYJ A;  3IQ6 A;  4HYX A;  4N4W A;  4FPD A;  1EKY A;  1S53 A;  1IW6 A;  3QW1 A;  2XLW A;  1APC A;  3D4S A;  4G7R B;  4X1H A;  2KSA A;  1KME A;  4L6R A;  1JFP A;  5H2L A;  4X32 A;  2EI4 A;  4DKL A;  5JJJ A;  1PXS A;  5B6W A;  3HNL A;  5AWZ A;  1CPR A;  1X0K 1;  3COC A;  1E86 A;  3ZPQ A;  4CJG A;  4BEZ A;  2YKZ A;  5BR2 A;  2YL0 A;  2Y03 A;  4LDE A;  3QVY A;  1S51 A;  1QQ3 A;  3NY9 A;  3OE6 A;  4N6H A;  2YL3 A;  2HPY A;  4MD1 A;  3ZQY A;  1XIO A;  4D4X A;  3HAQ A;  4CIP A;  4JEB A;  5H2M A;  5H2I A;  4GP4 B;  2YDV A;  4DJH A;  4GYC A;  4JE9 A;  3QJR B;  3VVK A;  1QKO A;  3HNJ A;  3EH4 B;  2YL7 A;  256B A;  4IAR A;  1NBB A;  3PXO A;  4KLY A;  3UZA A;  4CDA A;  4G70 B;  1AT9 A;  2YL1 A;  2YDO A;  5JUA A;  3BVD B;  3EML A;  4EIY A;  4MQS A;  4GBR A;  3RZE A;  2X72 A;  4G7Q B;  3NYA A;  1S05 A;  4DAJ A;  3DE9 A;  4D4N A;  4EJ4 A;  5LWE A;  2XLD A;  3UTW A;  3IQ5 A;  2Z55 A;  1E85 A;  2L6X A;  4ULV A;  4X31 A;  2QPD B;  2BC5 A;  2J9B A;  4A4M A;  3M4C A;  1JV6 A;  4WGZ A;  1TN0 A;  1LN6 A;  5TGZ A;  4LDO A;  2XLE A;  1P8H A;  3HNK A;  1P8U A;  1XJI A;  1GZM A;  3HAN A;  1C8R A;  4BVN A;  3ZTZ A;  3ZTM A;  3VG9 A;  4UG2 A;  3S3B B;  2WJL A;  1BBH A;  3QBK A;  2QPE B;  3HAR A;  4J4Q A;  4GRV A;  1C8S A;  4UHR A;  1JGJ A;  3VHZ A;  1FBK A;  2ZZL A;  2BRD A;  4LDL A;  5B2N A;  1H2S A;  3SN6 R;  2YLG A;  1Q5J A;  2YLI A;  1RCP A;  3QJU B;  4GPO A;  3OE9 A;  5AX0 A;  3OE0 A;  4PXK A;  5H2H A;  1F4Z A;  4QID A;  5G28 A;  1E12 A;  3AYM A;  3M4B A;  1R84 A;  2I20 A;  1QM8 A;  5JRA A;  1F50 A;  1VGO A;  3CAP A;  3X3B A;  3M79 A;  3U8P A;  5B35 A;  5H2P A;  2RH1 A;  1MQV A;  2PED A;  5B6X A;  1O0A A;  3NS0 A;  4WW3 A;  1QPU A;  1S8L A;  2XLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...