4L6RA

Structure of the class b human glucagon g protein coupled receptor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
413
structure length
398
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Soluble cytochrome b562 and Glucagon receptor chimera
publication title Structure of the human glucagon class B G-protein-coupled receptor.
pubmed doi rcsb
source organism Escherichia coli
total genus 138
structure length 398
sequence length 413
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00002 7tm_2 7 transmembrane receptor (Secretin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4l6rA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4l6rA02
5JUAA 3QVYA 3OE6A 1QPUA 3S3DB 1GU8A 3S3CB 1RCPA 3TOLA 1P8IA 2ZFEA 3C63A 4XXJA 4IAQA 5JRAA 2YCYA 2ZZLA 1H2SA 5H2OA 2YLGA 3UONA 5G54A 4UG2A 2Y01A 4N4YB 2I20A 2Y03A 1M6TA 1KG9A 1KMEA 1IXFA 1XJIA 2CCYA 3HARA 1YYJA 1M0MA 1S8LA 2XLHA 1BM1A 1R84A 1LN6A 2Y04A 4N4WA 2AT9A 5F8UA 4QRYA 1BBHA 4MQSA 3U8PA 2KSYA 1S05A 3KJ6A 3M4BA 5DYSA 3HAOA 2XLWA 1EHKB 1UAZA 5B3IA 5H2KA 4GRVA 1VJMA 1IW6A 4CDAA 5B2NA 4XTLA 1LM3B 1X0K1 2QPDB 4U9DA 2G87A 5B34A 4QI1A 3UTXA 4GP8B 3QJQB 5TGZA 1EKYA 2YL7A 3QW0A 3UTYA 5BR5A 1MGYA 3M79A 3VHZA 4LDEA 2JAGA 3HNIA 2R4RA 5AGFA 5AX1A 2QLAA 5G2AA 3PDSA 3CAPA 5B35A 3QJSB 2I1XA 3T45A 3QJTB 2R4SA 3QBLA 4EIYA 3C9LA 3QVZA 1QKPA 1BRDA 5FJGA 4CJGA 1S51A 2XL6A 4CDYA 3X3BA 3HNKA 3IQ5A 1H68A 4CX9A 2F95A 1KGBA 4CDVA 1E83A 3ZWIA 4JQ6A 4XTOA 1E85A 2I21A 5H2LA 2X72A 3S3BB 1AT9A 1E86A 1O0AA 3MBVA 4NC3A 3A7KA 2YDOA 1Q5IA 3QW1A 3HNLA 2ZIYA 3QBKA 1S54A 5JVEA 4BV0A 4GP4B 4DAJA 3HAQA 2KSAA 4L6RA 5B6YA 4DJHA 4A4MA 5ITCA 4WAVA 3UZAA 2Y00A 4KNFA 2I35A 1KG8A 1U19A 4CJOA 3NMJA 3S8GB 3VI0A 4AMJA 4GPOA 2JAFA 4XT3A 3VW7A 3NYAA 4TL3A 2WJLA 4X31A 1Q5JA 1YZAA 1CPQA 5G28A 5H2IA 1QHJA 2PEDA 3RZEA 4HYXA 5LWEA 1E0PA 4K5YA 3AM6A 4FPDA 3ODUA 5AHZA 5J7AA 4LDOA 2VT4A 2YL3A 3QJUB 3SN6R 1C8RA 5G2DA 1IW9A 3EMLA 2KS9A 3PQRA 4XTNA 4BVNA 3M15A 2YCZA 5B6VA 2Z73A 4OV0A 3D4SA 4BWBA 4GP5B 3VGAA 1TN5A 1XMEB 3TOMA 5AHYA 3RFMA 1PXSA 5G53A 4FBZA 3HASA 5G2CA 4WGZA 1L9HA 4AMIA 1PXRA 3ZQVA 2LNLA 5A44A 4JKVA 5JJNA 3REYA 1FBBA 1E84A 2F93A 3AYMA 2EI4A 5DHHA 5A8EA 4IARA 4JE9A 3V2WA 3AYNA 1X0I1 2WJKA 4PXFA 3CODA 4JEAA 4BEZA 2YL0A 5A45A 3NY8A 4HWLA 4MD1A 3OE0A 1XIOA 5AX0A 4UHRA 3ZTMA 3QBIA 1YZCA 3COCA 4G70B 1PY6A 3HAPA 5KKHA 4G7QB 1DZEA 2YCWA 2BC5A 5DHGA 2YKZA 4G72B 4JEBA 4IB4A 1GUEA 2BRDA 4CIPA 2XLVA 1MQVA 1F50A 1R2NA 3VG9A 2NTUA 1QKOA 5H2PA 3DE8A 2XM4A 3HANA 3QDCA 3UG9A 2XLOA 4KLYA 1M0LA 2HPYA 3NMKA 3FOOA 2XLDA 4JR8A 4G7SB 5JLIA 1BRXA 1C8SA 4XT1A 1F4ZA 2YCXA 1JGJA 5C1MA 5B6ZA 2Z55A 4EJ4A 1JV6A 5ITEA 1JV7A 1CPRA 2J9BA 1BRRA 3DQBA 1TN0A 1S53A 1CGOA 3DE9A 3ABWA 3NSBA 4U9EA 3IQ6A 3OE9A 3FOPA 5JJEA 5AZDA 4ULVA 2KSBA 4GBRA 3PXOA 4LDLA 3EH5B 1F88A 5JP7A 3DDLA 3NS0A 2J4YA 1VGOA 3OE8A 4FA7B 3EH4B 4DKLA 2NTWA 2YDVA 2XM0A 5JT4A 1JAFA 1E12A 5JJJA 3ZTZA 1GQAA 1NBBA 1S8JA 4MBSA 5AWZA 3PBLA 4BUOA 4G7RB 4QIDA 1A7VA 3X3CA 2Y02A 3QJRB 3UZCA 1S52A 3V2YA 3C9MA 3HNJA 5G36A 5BR2A 5H2HA 1FBKA 4X32A 4MD2A 256BA 3VVKA 1CGNA 5H2NA 2YLIA 3VRCA 1C3WA 5H2JA 1P8UA 3OAXA 3QBGA 1GZMA 1YYXA 3ZQYA 1P8HA 2M3GA 4PXKA 3EH3B 1L0MA 3P0GA 2J8WA 5ETZA 5EN0A 4BEYA 2L6XA 4WW3A 3L1MA 5B0WA 3QAKA 1M0KA 2YL1A 2QPEB 3QJVB 2YLDA 1APCA 4D4NA 3UTVA 3BVDB 4MQTA 4J4QA 5JS5A 3QAPA 4N6HA 4WGYA 4G71B 2RH1A 4FAAB 3ZEVA 4Y9HA 3M4CA 3C62A 3ZPQA 3ZPRA 1X0SA 1QQ3A 4EA3A 2XLEA 1QM8A 3PWHA 3WQJA 4GYCA 3NY9A 3UTWA 4HYJA 3S8FB 1UCQA 4D4XA 1AP9A 4ER9A 1HZXA 5JSLA 1CWQA 2XLMA 5B6WA 5H2MA 1JFPA 3NMIA 4L35A 4X1HA 2XL8A 5B6XA
chains in the Genus database with same CATH superfamily
1R4TA 5JUAA 5CI9A 1FTSA 2W9YA 1GU8A 3S3CB 3C63A 4G7ZF 4AL0A 1NSGB 4W8PA 5G54A 3B0VC 4N4YB 4CS8C 1KMEA 1M0MA 3LJBA 4YT8A 2Y04A 5F8UA 4DRHB 2R7SA 1TKNA 2D5RB 3EG9B 2KSYA 5DS5A 2QE9A 2OG2A 4EBBA 1XZQA 3KL4A 4EBJA 5DYSA 1BZ4A 3K7DA 2XLWA 1EHKB 1UAZA 2IXPA 1SF8A 1YAUO 4AK9A 3C18A 4XPWA 4AE4A 4XTLA 4JTCB 4JTAB 4G7OF 2G87A 4QI1A 1KTMA 5TGZA 5T3WA 2YL7A 2IYLD 5BR5A 3M79A 3B0PA 4LDEA 2QTVA 5AX1A 3CAPA 5B35A 3QJSB 4OIOF 1WASA 4CS7A 5DLJA 2HMZA 1U89A 3FHDA 2WB7A 3RQFA 3FAJA 1H68A 4CX9A 5FCLA 1KGBA 3G4XA 3ZWIA 4XTOA 3ZG1A 1E85A 2X72A 3MX3A 1E86A 3O6XA 4NC3A 5T1DB 3Q7LA 1Q5IA 3M1CB 4PJJA 3ASNC 2AP3A 4C3BA 4ANJA 2UUHA 5JVEA 4GP4B 3HAQA 4OD5A 2KSAA 4L6RA 4E7SA 3K33A 4LLCA 2WVQA 3SYNA 2Y00A 4JCHA 4LDQA 2R25A 1U19A 3NMJA 2M64A 2JAFA 3DWWA 1Q5JA 2WZLA 3TK0A 3OA1A 1OKKD 5G28A 5H2IA 4LDKA 3SNHA 2J46A 1I5NA 4HYXA 5LWEA 1E0PA 2EIKC 3AM6A 4MTGA 4KNVA 1LS4A 2OJQA 3I5PA 1QLEC 1IW9A 4HFKB 3A11A 4E18A 2OKUA 2XXAA 2IM8A 4A4AA 5L0FA 3L0IA 1Q0MA 5A44A 3REYA 1FBBA 2F93A 1YARO 1G4US 4YWQA 3ZDLA 3EJNA 4JE9A 3LEVA 2WJKA 2VCBA 3CODA 3NY8A 3R7CA 4JCZA 3QBIA 2HJMA 1YZCA 3COCA 2EPMX 4I3MA 5KKHA 3DJUB 3EZHA 3GWLA 4BEJA 3TJ6A 2YKZA 2PBEA 4AE4B 4EWCA 2PX3A 1GUEA 3NKDA 4CIPA 1MQVA 3VG9A 3T4RA 3ZSUA 1QKOA 5H2PA 3DAGA 2XM4A 2BL2A 4YL0A 4BJTA 3QDCA 5D92A 2IXNA 4YN0B 4U5EE 2HPYA 1OW8A 3G4ZA 3H2UA 3FOOA 1H9TA 2EPKX 3GANA 1BRXA 1C8SA 1YLMA 1HW2A 2KQ9A 2YCXA 1JGJA 3CZ6A 1L3PA 1TQGA 1LE4A 4XPXA 1FFTC 2ZXRA 4YL1A 3UNGC 2YVKA 1WOLA 3DMDA 1S53A 2PNOA 3DE9A 3IQ6A 4DS7E 1NLXA 3PXOA 4LDLA 2Y3GA 3LESA 3NYLA 5COGA 4LDRA 1Z63A 2P61A 2OU6A 4W8KA 3N0TA 1Q0DA 2PP4A 3MFNA 1Z6AA 4BEMJ 2NTWA 2YDVA 2LIGA 4DOZA 1JAFA 1E12A 1V54C 4OINF 4QI2A 4H4KC 3WHNA 3U8VA 4BUOA 1ZHXA 2Y02A 3MYFA 5COFA 1S52A 1NU9C 3C9MA 3HNJA 1HMDA 5G36A 1FBKA 5A69A 4ZLDA 2H7BA 4MD2A 1Z5ZA 1CGNA 4CSAC 2Y39A 2YLIA 3T9OA 3VRCA 1C3WA 3DJNB 4G0HA 1GZMA 1YYXA 3K66A 1BR1A 3Q6MA 3P0GA 4DRIB 5EN0A 1V55C 2CNWD 2L6XA 3L1MA 2R7OA 3CQZA 1UG7A 1ZHTA 3QAKA 1S7ZA 2QY9A 4JURI 3UGPA 4OD4A 4DBQA 1APCA 2IXMA 1OW6A 4MQ9F 2IOQA 2HFIA 2XXAB 2Y3BA 1O5HA 2J7PD 5JS5A 1AVOB 1LS1A 1HW1A 3ZEVA 5D91A 4K1OA 3M4CA 2KC3A 1T6QA 3C62A 3ZPQA 3ZPRA 2EPLX 1X0SA 1QQ3A 1LIHA 3ASOC 1J8YF 3C8GA 1OR3A 3PWHA 3NY9A 2NSFA 1OCCC 2R7UA 4D4XA 3SP1A 4AL1A 1CWQA 3ECSA 3NYMA 1JFPA 3GEEA 3GM2A 2Y69C 4YT2A 3WODF 1OCRC 1D1AA 2W4MA 3S3DB 1D0YA 2J9WA 3DXJF 3TOLA 1P8IA 2ZFEA 2YCYA 1H2SA 4YT4A 5BQGA 4BJ6C 5T3TA 4UG2A 2I20A 1NFOA 2Y03A 4PACA 2LQGA 1M6TA 1ZHWA 2Q4FA 4FAPB 1UFBA 1IXFA 5E2QA 1XJIA 2CCYA 4P9FA 3HARA 4EBKA 2LSEA 4N4WA 1O87A 4N6CA 4QRYA 4C3DA 1AEPA 1NFNA 1TWAA 1BBHA 4LLEA 4J7YA 1S05A 2LCHA 3AQCA 3MYIA 3KJ6A 2HV6A 5E3AA 1YJGA 3VYWA 1C02A 3PHF2 4JIOA 3AOUA 4U5CE 2YEVA 5KYYA 3PDMP 1VJMA 1G4WR 2ZXWC 4PFPA 5B2NA 5TJ5E 1LM3B 3DI5A 4U9DA 4U5GA 5B34A 4GP8B 3PMRA 3CAXA 2JAGA 3HNIA 1MMNA 4XEFA 2R4RA 5HSWA 5AGFA 4IJJA 2H7OA 3PDSA 3K6BA 1M2OA 3LAYA 1JRAA 3ZIBA 1SMYF 3LUTB 3T45A 1B68A 3W2WA 3QJTB 2R4SA 3W8HA 4EIYA 4BJ1A 5A6BA 1QKPA 4CJGA 2OCCC 3FDQA 1QZXA 2LP4A 3HNKA 2AVKA 4K7BA 1Y4CA 3O39A 1WWPA 4JQ6A 1JMWA 5H2LA 1AT9A 3JTLO 2XRHA 3W2VA 3U2MA 4MVZA 2YDOA 3TQOA 4NCQA 3SXMA 3HNLA 2Q7RA 3QBKA 4BV0A 3N24A 4CBEA 2MYSA 5B6YA 3JYYA 1G8XA 2Y3DA 4IWBA 3UZAA 2YHSA 4KNFA 2I35A 1KG8A 2XSEA 4CJOA 3SZRA 4AMJA 1WN0A 2B0JA 4OIQF 3C8GB 4XT3A 3VW7A 1YZAA 3UR3C 2VASA 3GWNA 1QHJA 2CDQA 1WATA 1GS9A 4BJ6A 4K5YA 4I1MA 3ODUA 4XLPF 3C8ZA 3KYJA 2YL3A 4PK4A 2P6VA 1T6IA 5L0JA 5G2DA 3EMLA 3ABMC 3EFOA 1PV3A 2RD9A 1O3UA 4BWBA 4GP5B 1TN5A 1XMEB 5AHYA 1PXSA 3L34A 3HASA 5G2CA 4WGZA 1PXRA 3IQCA 3ZQVA 3RW0A 2LNLA 4ONSA 4GEHA 5JJNA 2ICWG 3AYMA 3FMSA 5DS4A 4XWJA 5DHHA 1D0XA 2L6FA 1M2VB 2G3KA 2XS8A 4H54A 3U9JA 1EQ1A 4E7ZA 3E9VA 3AYNA 1MNEA 3S29A 4JEAA 3ABKC 5A45A 4MW8A 4Q5SF 4MD1A 2R7XA 3HLZA 2LD6A 4QDLA 3U0CA 2OOCA 3NKEA 2YCWA 2JX0A 2VCAA 4HE8D 4YL3A 4MS2A 3KH2A 3K1HA 2NTUA 3DE8A 4FWVA 2XLOA 4KLYA 4AX2A 1OR2A 3VF0A 3CSKA 2XLDA 2NUTA 4XEVA 4O79A 5JLIA 4BJ5A 1RXQA 4FESA 1L7CA 2CW0F 2IBFA 1F1MA 2KYHA 5B6ZA 4EJ4A 1JV6A 2X0CA 4KI2A 4J7TA 2J9BA 1BRRA 1U6HA 2EINC 4YT5A 1U0BB 1YDIA 1TN0A 2KW3C 1RKEA 1JPNA 2ZD9A 5JJEA 2DYRC 1XWJA 2I8BA 4MVSA 3JZ0A 3NS0A 2J4YA 1GGQA 3OE8A 2E87A 4FA7B 1ZZPA 5JT4A 3RF3A 3ZTZA 2HSQA 1NBBA 1OCZC 5AWZA 3E70C 2J0WA 4MW3A 2GA0A 2KGOA 1NZEA 3GM1A 4G7RB 4QIDA 2J45A 3X3CA 4R32A 4LACB 4P6IC 3QJRB 5F28E 2OQMA 2GFHA 4MNDA 5H2HA 4O6YA 3KYIA 4X32A 3O10A 3I4UA 3B71A 5BQHA 5KYXA 4I1OB 3QBGA 1P8HA 2M3GA 5ETZA 3X1OA 1IZMA 2QUPA 3EFOB 2QPEB 2XL4A 1BDJB 1ZHYA 2ZXPA 1D1CA 3F47A 2GWWA 3UTVA 3BVDB 4J4QA 4U5FE 1A7EA 4KNWA 3QAPA 2KSFA 2EPOA 2RH1A 2TMVP 4NY3A 3S84A 2OEXA 4DJ9A 1JPJA 3WG7C 4RBNA 5A6JA 4PFOA 2OEVA 3F46A 4EA3A 2LFDA 2XLEA 4MTFA 4GYCA 3QTHA 3EH2A 5JSLA 2XLMA 5B6WA 5H2MA 1OKKA 4XLNF 3ATPA 3NMIA 3U3BA 1LI7A 4BG0A 1VYIA 3T6BA 3GEIA 4DRJB 1IW7F 1D1BA 3B0UX 3QVYA 4RD9A 2J0XA 1RCPA 2IXOA 1RMVA 4IAQA 1ORJA 2YLGA 3LNRA 1OQCA 3UONA 2Y01A 2HSBA 3QMKA 2NUTB 3C8GD 1JOGA 3RFYA 4O7GA 4FX5A 1YYJA 3W4YA 3DM9B 1GM5A 2XLHA 1CGME 3AG3C 1BM1A 1R84A 1LN6A 5BQIA 3HKKA 4XPYA 2AT9A 4EHPA 5GPGB 3IHUA 4MQSA 3U8PA 4I44A 2DGJA 4E17A 1PCXA 1Z3IX 3HAOA 1WTYA 4HEAJ 4MVQA 5B3IA 3EGXA 2GDCA 1IW6A 4CDAA 1C17M 4PR9A 4DVYP 4P9TA 3I5QA 5E3CA 2KJGA 2GAQA 3EGDA 3GEHA 5DQTA 3UTXA 4CS9A 3QW0A 3RQGA 2R03A 1H7IA 1MGYA 3VHZA 1MMGA 3T6JA 4HFFB 3RQEA 1A0BA 1W2WA 3AGUA 3TD7A 1H9GA 2QLAA 2PX0A 2W45A 5G2AA 4UDVA 4LERA 1BR2A 2Q9CA 4MVMA 3QBLA 1ZVZA 4JJGA 3QVZA 2EPNA 2O9XA 3S90A 4OIPF 4G78A 3G50A 4CDYA 3X3BA 2G3VA 3LLKA 5KYXB 3IQ5A 4CDVA 4O6NA 2I21A 3A7KA 1VLSA 3QW1A 1YA7O 4WABA 5L3QA 1ZU5A 3AQBA 2Q9AA 3W8IA 3SXZA 4DAJA 3RYLA 4DJHA 3BEHA 2A0BA 4A4MA 2KNHA 4WAVA 5ITCA 3EG9A 1ZYRF 3VI0A 1Q0GA 4O6MA 1VK5A 3FAPB 4XEKA 3DM5A 2HS5A 4E0HA 3NYAA 2R02A 4TL3A 2Q00A 3B29A 4KBLA 3EHNA 3H2VA 2R7RA 3NDBB 3SXYA 1DOWA 1DOVA 3UMHA 4MTOA 5AHZA 5J7AA 1KU2A 5AC5A 2FAPB 1HMOA 2VT4A 3RVZA 4U5DE 1C8RA 2NSGA 2DB4A 2CNWA 3EZIA 2KS9A 3PQRA 1YVIA 4BVNA 5B6VA 4J32B 2Z73A 3D4SA 3VGAA 4Z9JA 1MNDA 3RFMA 3EPVA 2R9RB 2XS1A 1FR0A 1L9HA 4AMIA 1QKRA 4ULWA 1E84A 2EI4A 3RH3A 2VC9A 4Z9HA 1K05A 2P7VA 1KNYA 3V2WA 4PXFA 4BEZA 4HWLA 1XIOA 3EHMA 3ZTMA 5KYWA 4G70B 1PY6A 4G7QB 1DZEA 5DHGA 4G72B 4JEBA 1NG1A 4BJ5C 4JTDB 3EGDB 4XQ1A 1F50A 1LE2A 2F22A 3J06A 1TWCA 1VOMA 1T6UA 2UUIA 1SR2A 5IY5C 4G7SB 3ABLC 4IAOA 4JRZA 5COMA 4YJWA 4C7OA 4XT1A 1FMWA 3MLGA 1VMAA 2R7QA 3UMIA 1F4ZA 5C1MA 4JZAA 2Z55A 1I4YA 1CPRA 2ZPAA 2NUPA 2CGEA 2V3CC 3DQBA 3L8JA 1CGOA 5L0DA 3NSBA 1HE1A 4U9EA 1G5ZA 2VCCA 3OE9A 3FOPA 1ZHZA 1OXBA 4ULVA 2KSBA 5AZDA 2R7TA 2I15A 3EH5B 1F88A 2NPUA 5JP7A 1TFOB 3DDLA 3VAYA 1VGOA 2L9JA 3EH4B 4DKLA 2XM0A 5AC4A 1VB5A 1SZIA 3UGOA 4E0IA 1S8JA 2B0HA 3LLIA 3PBLA 5A6KA 4Q4ZF 2C04A 1A7VA 3FVYA 3UZCA 3V2YA 4BPMA 3PCVA 5BR2A 2A69F 4U5BE 3IPMO 1Z23A 4A2NB 3LS1A 256BA 5H2NA 1PD0A 5H2JA 2W4BA 1JR8A 1TFKB 1QSPA 4PXKA 3EH3B 3WAQA 2WVOA 4WW3A 5B0WA 3A9CA 5KYYB 1M0KA 1A7DA 4JW1A 1SYQA 2X51A 4MQTA 2H7VC 4U5HA 1V4AA 1FMVA 4WGYA 4G71B 1ZU4A 4FAAB 3LS0A 5F5HA 1VYKA 2LFFA 1E2XA 4C3EA 1QM8A 4PJMA 3S28A 1RKCA 1TWHA 2R7WA 3WQJA 3S8FB 1UCQA 1AP9A 1HY5A 4ER9A 1HZXA 4DBRA 1T01A 2ASRA 5KYWB 2L6GA 4X1HA 2XL8A 3V7OA 5B6XA 1EA8A 1OW7A 2DI3A 1H6GA 3OE6A 3OWTA 2JPUA 1QPUA 1TR2A 1I4ZA 4XXJA 5JRAA 3K1IC 3O55A 2ZZLA 4MVOA 5H2OA 3V5YA 3U9MA 3AG1C 4B6IA 3Q6NA 5KYNA 5KYUA 1KG9A 2Z15A 1S8LA 2P1AA 4C7OB 2WZFA 5L0CA 2Q3TA 2G62A 3T6GB 3TULA 3RVYA 3IEEA 3EH1A 1RJ9A 3S9OA 3V5ZA 3HJCA 4CS8A 3NRHA 2Y3HA 2A1DD 2NUPB 3DKAA 2L6HA 2NG1A 3M4BA 5L0GA 4JC7A 4CS9C 1Y6DA 4YK5A 4NTAA 5H2KA 3U5SA 4GRVA 3ITFA 3N2ZB 1X0K1 2QPDB 2HKVA 1ZW3A 4QI0A 1FNTc 3QJQB 2J9UA 2CYDA 1EKYA 3IQTA 3UTYA 4NTBA 2HUJA 2H8AA 2YZSA 5HV9A 2PFDA 4J30B 1J8MF 2HV7A 3SXKA 2I1XA 2D4UA 3NYJA 4WJ0A 3C9LA 2MWQA 3S0XA 4Z9IA 5DVWA 1BRDA 5FJGA 4Q7CA 3POVA 3JT1A 1S51A 2XL6A 2YWAA 1MMDA 3JRMO 2YRFA 2KK1A 2F95A 2FFHA 2DYSC 1E83A 1ORYA 2A6EF 3AG2C 3S3BB 1YA9A 1O0AA 3MBVA 3S27A 3Q7GA 2ETSA 1LKXA 4IRUA 1T5OA 2ZIYA 1NU7D 1S54A 3GORA 5B1BC 1WGWA 2EIMC 2BE5F 3DAFA 4EKWA 4CIHA 3S8GB 5A6AA 4GPOA 5K0IA 2WJLA 4X31A 4JJFA 1R5ID 1CPQA 5DQZA 5BUOA 3K1IA 2PEDA 2HJ3A 3RZEA 3UMKA 3HTKC 4FPDA 3BRJA 3R2PA 1OXKA 4LDOA 2J9VA 2HZ8A 2JD3A 5B3SC 3DD7A 4GQHA 1EI7A 3QJUB 3SN6R 2M4EA 1RKEB 3AG4C 1QVXA 1VTMP 4MVUA 1HE9A 4XTNA 2AWYA 3C7JA 3M15A 5E33A 2YCZA 4OV0A 5EK0A 4ZLCA 1V74B 3TOMA 5KYUB 3V5XA 4N06A 2Q9BA 5G53A 4FBZA 4RDAA 4JKVA 5L0HA 3CEXA 1RJ9B 5A8EA 4IARA 1BR4A 2R05A 5FZTA 1ST6A 3FXHA 1X0I1 1M56C 2LK4A 2YL0A 1T9KA 3OE0A 1Q0FA 1D0ZA 5AX0A 4UHRA 1M57C 3NG1A 3JCUQ 1ORSC 2A0UA 3HAPA 4NQFA 1LVKA 2R7VA 2BC5A 2WL8A 4IB4A 2BRDA 1Z7Qc 2XLVA 1R2NA 4MVRA 3HANA 2VB6A 3H65A 3UG9A 1M0LA 3OEOA 1TWGA 4M63A 4X0RA 1FAPB 3GM3A 1OCOC 4PJNA 3NMKA 4JR8A 3SEOA 3JYHA 2YQYA 1PD1A 3LNMB 4GYTA 1LPEA 2QNLA 5A6BD 4JVSA 2A6HF 1AUEA 2WZGA 2ZXOA 2AWCA 3X2QC 5ITEA 2AU5A 1JV7A 1VLTA 2A68F 3RKOF 5EGYA 1XZPA 3ABWA 4NTFA 1A41A 2L7AA 3KPHA 3GODA 4IGGA 4GBRA 3VM6A 3LEOA 5L3VA 2VH3A 2V26A 2EIJC 3AJMA 3JSZA 4G7HF 5JJJA 1GQAA 4MBSA 3EQLF 1M2VA 2OJED 5EHHA 2WVNA 3TJ5A 1C03A 1K40A 2J7PA 4XTKA 2L81A 3US6A 3ZC4A 3VVKA 3L8IA 2EILC 4DVZA 3KKBA 2FGYA 5L0IA 1P8UA 2HMQA 3U2LA 3OAXA 3ZQYA 3AGTA 1ZW2A 2PF4E 4DXWA 1L0MA 2J8WA 3JSEO 2P0NA 1K04A 4BEYA 4KC9A 5B1AC 3JRTA 3KMIA 4PJLA 3U3FA 3EGXB 2YL1A 3QJVB 2YLDA 4CSAA 3DZAA 4D4NA 1N1CA 4F4BA 4K0DA 4EUKB 5DS6A 1FFHA 4N6HA 1MMAA 1Q0KA 4Y9HA 1LI5A 4OIRF 5F5FA 3B9QA 2RSEB 3RIPA 2C03A 3ZVRA 3UTWA 4HYJA 2MHRA 5CI8A 4L35A 3QZCA 3MBGA 5CIVA
chains in the Genus database with same CATH topology
5JUAA 3QVYA 3OE6A 1QPUA 3S3DB 1GU8A 3S3CB 1RCPA 3TOLA 1P8IA 2ZFEA 3C63A 4XXJA 4IAQA 5JRAA 2YCYA 2ZZLA 1H2SA 5H2OA 2YLGA 3UONA 5G54A 4UG2A 2Y01A 4N4YB 2I20A 2Y03A 1M6TA 1KG9A 1KMEA 1IXFA 1XJIA 2CCYA 3HARA 1YYJA 1M0MA 1S8LA 2XLHA 1BM1A 1R84A 1LN6A 2Y04A 4N4WA 2AT9A 5F8UA 4QRYA 1BBHA 4MQSA 3U8PA 2KSYA 1S05A 3KJ6A 3M4BA 5DYSA 3HAOA 2XLWA 1EHKB 1UAZA 5B3IA 5H2KA 4GRVA 1VJMA 1IW6A 4CDAA 5B2NA 4XTLA 1LM3B 1X0K1 2QPDB 4U9DA 2G87A 5B34A 4QI1A 3UTXA 4GP8B 3QJQB 5TGZA 1EKYA 2YL7A 3QW0A 3UTYA 5BR5A 1MGYA 3M79A 3VHZA 4LDEA 2JAGA 3HNIA 2R4RA 5AGFA 5AX1A 2QLAA 5G2AA 3PDSA 3CAPA 5B35A 3QJSB 2I1XA 3T45A 3QJTB 2R4SA 3QBLA 4EIYA 3C9LA 3QVZA 1QKPA 1BRDA 5FJGA 4CJGA 1S51A 2XL6A 4CDYA 3X3BA 3HNKA 3IQ5A 1H68A 4CX9A 2F95A 1KGBA 4CDVA 1E83A 3ZWIA 4JQ6A 4XTOA 1E85A 2I21A 5H2LA 2X72A 3S3BB 1AT9A 1E86A 1O0AA 3MBVA 4NC3A 3A7KA 2YDOA 1Q5IA 3QW1A 3HNLA 2ZIYA 3QBKA 1S54A 5JVEA 4BV0A 4GP4B 4DAJA 3HAQA 2KSAA 4L6RA 5B6YA 4DJHA 4A4MA 5ITCA 4WAVA 3UZAA 2Y00A 4KNFA 2I35A 1KG8A 1U19A 4CJOA 3NMJA 3S8GB 3VI0A 4AMJA 4GPOA 2JAFA 4XT3A 3VW7A 3NYAA 4TL3A 2WJLA 4X31A 1Q5JA 1YZAA 1CPQA 5G28A 5H2IA 1QHJA 2PEDA 3RZEA 4HYXA 5LWEA 1E0PA 4K5YA 3AM6A 4FPDA 3ODUA 5AHZA 5J7AA 4LDOA 2VT4A 2YL3A 3QJUB 3SN6R 1C8RA 5G2DA 1IW9A 3EMLA 2KS9A 3PQRA 4XTNA 4BVNA 3M15A 2YCZA 5B6VA 2Z73A 4OV0A 3D4SA 4BWBA 4GP5B 3VGAA 1TN5A 1XMEB 3TOMA 5AHYA 3RFMA 1PXSA 5G53A 4FBZA 3HASA 5G2CA 4WGZA 1L9HA 4AMIA 1PXRA 3ZQVA 2LNLA 5A44A 4JKVA 5JJNA 3REYA 1FBBA 1E84A 2F93A 3AYMA 2EI4A 5DHHA 5A8EA 4IARA 4JE9A 3V2WA 3AYNA 1X0I1 2WJKA 4PXFA 3CODA 4JEAA 4BEZA 2YL0A 5A45A 3NY8A 4HWLA 4MD1A 3OE0A 1XIOA 5AX0A 4UHRA 3ZTMA 3QBIA 1YZCA 3COCA 4G70B 1PY6A 3HAPA 5KKHA 4G7QB 1DZEA 2YCWA 2BC5A 5DHGA 2YKZA 4G72B 4JEBA 4IB4A 1GUEA 2BRDA 4CIPA 2XLVA 1MQVA 1F50A 1R2NA 3VG9A 2NTUA 1QKOA 5H2PA 3DE8A 2XM4A 3HANA 3QDCA 3UG9A 2XLOA 4KLYA 1M0LA 2HPYA 3NMKA 3FOOA 2XLDA 4JR8A 4G7SB 5JLIA 1BRXA 1C8SA 4XT1A 1F4ZA 2YCXA 1JGJA 5C1MA 5B6ZA 2Z55A 4EJ4A 1JV6A 5ITEA 1JV7A 1CPRA 2J9BA 1BRRA 3DQBA 1TN0A 1S53A 1CGOA 3DE9A 3ABWA 3NSBA 4U9EA 3IQ6A 4DS7E 3OE9A 3FOPA 5JJEA 5AZDA 4ULVA 2KSBA 4GBRA 3PXOA 4LDLA 3EH5B 1F88A 5JP7A 3DDLA 3NS0A 2J4YA 1VGOA 3OE8A 4FA7B 3EH4B 4DKLA 2NTWA 2YDVA 2XM0A 5JT4A 1JAFA 1E12A 5JJJA 3ZTZA 1GQAA 1NBBA 1S8JA 4MBSA 5AWZA 3PBLA 4BUOA 4G7RB 4QIDA 1A7VA 3X3CA 2Y02A 3QJRB 3UZCA 1S52A 3V2YA 3C9MA 3HNJA 5G36A 5BR2A 5H2HA 1FBKA 4X32A 4MD2A 256BA 3VVKA 1CGNA 5H2NA 2YLIA 3VRCA 1C3WA 5H2JA 1P8UA 3OAXA 3QBGA 1GZMA 1YYXA 3ZQYA 1P8HA 2M3GA 4PXKA 3EH3B 1L0MA 3P0GA 2J8WA 5ETZA 5EN0A 4BEYA 2L6XA 4WW3A 3L1MA 5B0WA 3QAKA 1M0KA 2YL1A 2QPEB 3QJVB 2YLDA 1APCA 4D4NA 3UTVA 3BVDB 4MQTA 4J4QA 5JS5A 3QAPA 4N6HA 4WGYA 4G71B 2RH1A 4FAAB 3ZEVA 4Y9HA 3M4CA 3C62A 3ZPQA 3ZPRA 1X0SA 1QQ3A 4EA3A 2XLEA 1QM8A 3PWHA 3WQJA 4GYCA 3NY9A 3UTWA 4HYJA 3S8FB 1UCQA 4D4XA 1AP9A 4ER9A 1HZXA 5JSLA 1CWQA 2XLMA 5B6WA 5H2MA 1JFPA 3NMIA 4L35A 4X1HA 2XL8A 5B6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JUA A;  3QVY A;  3OE6 A;  1QPU A;  3S3D B;  1GU8 A;  3S3C B;  1RCP A;  3TOL A;  1P8I A;  2ZFE A;  3C63 A;  4XXJ A;  4IAQ A;  5JRA A;  2YCY A;  2ZZL A;  1H2S A;  5H2O A;  2YLG A;  3UON A;  5G54 A;  4UG2 A;  2Y01 A;  4N4Y B;  2I20 A;  2Y03 A;  1M6T A;  1KG9 A;  1KME A;  1IXF A;  1XJI A;  2CCY A;  3HAR A;  1YYJ A;  1M0M A;  1S8L A;  2XLH A;  1BM1 A;  1R84 A;  1LN6 A;  2Y04 A;  4N4W A;  2AT9 A;  5F8U A;  4QRY A;  1BBH A;  4MQS A;  3U8P A;  2KSY A;  1S05 A;  3KJ6 A;  3M4B A;  5DYS A;  3HAO A;  2XLW A;  1EHK B;  1UAZ A;  5B3I A;  5H2K A;  4GRV A;  1VJM A;  1IW6 A;  4CDA A;  5B2N A;  4XTL A;  1LM3 B;  1X0K 1;  2QPD B;  4U9D A;  2G87 A;  5B34 A;  4QI1 A;  3UTX A;  4GP8 B;  3QJQ B;  5TGZ A;  1EKY A;  2YL7 A;  3QW0 A;  3UTY A;  5BR5 A;  1MGY A;  3M79 A;  3VHZ A;  4LDE A;  2JAG A;  3HNI A;  2R4R A;  5AGF A;  5AX1 A;  2QLA A;  5G2A A;  3PDS A;  3CAP A;  5B35 A;  3QJS B;  2I1X A;  3T45 A;  3QJT B;  2R4S A;  3QBL A;  4EIY A;  3C9L A;  3QVZ A;  1QKP A;  1BRD A;  5FJG A;  4CJG A;  1S51 A;  2XL6 A;  4CDY A;  3X3B A;  3HNK A;  3IQ5 A;  1H68 A;  4CX9 A;  2F95 A;  1KGB A;  4CDV A;  1E83 A;  3ZWI A;  4JQ6 A;  4XTO A;  1E85 A;  2I21 A;  5H2L A;  2X72 A;  3S3B B;  1AT9 A;  1E86 A;  1O0A A;  3MBV A;  4NC3 A;  3A7K A;  2YDO A;  1Q5I A;  3QW1 A;  3HNL A;  2ZIY A;  3QBK A;  1S54 A;  5JVE A;  4BV0 A;  4GP4 B;  4DAJ A;  3HAQ A;  2KSA A;  4L6R A;  5B6Y A;  4DJH A;  4A4M A;  5ITC A;  4WAV A;  3UZA A;  2Y00 A;  4KNF A;  2I35 A;  1KG8 A;  1U19 A;  4CJO A;  3NMJ A;  3S8G B;  3VI0 A;  4AMJ A;  4GPO A;  2JAF A;  4XT3 A;  3VW7 A;  3NYA A;  4TL3 A;  2WJL A;  4X31 A;  1Q5J A;  1YZA A;  1CPQ A;  5G28 A;  5H2I A;  1QHJ A;  2PED A;  3RZE A;  4HYX A;  5LWE A;  1E0P A;  4K5Y A;  3AM6 A;  4FPD A;  3ODU A;  5AHZ A;  5J7A A;  4LDO A;  2VT4 A;  2YL3 A;  3QJU B;  3SN6 R;  1C8R A;  5G2D A;  1IW9 A;  3EML A;  2KS9 A;  3PQR A;  4XTN A;  4BVN A;  3M15 A;  2YCZ A;  5B6V A;  2Z73 A;  4OV0 A;  3D4S A;  4BWB A;  4GP5 B;  3VGA A;  1TN5 A;  1XME B;  3TOM A;  5AHY A;  3RFM A;  1PXS A;  5G53 A;  4FBZ A;  3HAS A;  5G2C A;  4WGZ A;  1L9H A;  4AMI A;  1PXR A;  3ZQV A;  2LNL A;  5A44 A;  4JKV A;  5JJN A;  3REY A;  1FBB A;  1E84 A;  2F93 A;  3AYM A;  2EI4 A;  5DHH A;  5A8E A;  4IAR A;  4JE9 A;  3V2W A;  3AYN A;  1X0I 1;  2WJK A;  4PXF A;  3COD A;  4JEA A;  4BEZ A;  2YL0 A;  5A45 A;  3NY8 A;  4HWL A;  4MD1 A;  3OE0 A;  1XIO A;  5AX0 A;  4UHR A;  3ZTM A;  3QBI A;  1YZC A;  3COC A;  4G70 B;  1PY6 A;  3HAP A;  5KKH A;  4G7Q B;  1DZE A;  2YCW A;  2BC5 A;  5DHG A;  2YKZ A;  4G72 B;  4JEB A;  4IB4 A;  1GUE A;  2BRD A;  4CIP A;  2XLV A;  1MQV A;  1F50 A;  1R2N A;  3VG9 A;  2NTU A;  1QKO A;  5H2P A;  3DE8 A;  2XM4 A;  3HAN A;  3QDC A;  3UG9 A;  2XLO A;  4KLY A;  1M0L A;  2HPY A;  3NMK A;  3FOO A;  2XLD A;  4JR8 A;  4G7S B;  5JLI A;  1BRX A;  1C8S A;  4XT1 A;  1F4Z A;  2YCX A;  1JGJ A;  5C1M A;  5B6Z A;  2Z55 A;  4EJ4 A;  1JV6 A;  5ITE A;  1JV7 A;  1CPR A;  2J9B A;  1BRR A;  3DQB A;  1TN0 A;  1S53 A;  1CGO A;  3DE9 A;  3ABW A;  3NSB A;  4U9E A;  3IQ6 A;  3OE9 A;  3FOP A;  5JJE A;  5AZD A;  4ULV A;  2KSB A;  4GBR A;  3PXO A;  4LDL A;  3EH5 B;  1F88 A;  5JP7 A;  3DDL A;  3NS0 A;  2J4Y A;  1VGO A;  3OE8 A;  4FA7 B;  3EH4 B;  4DKL A;  2NTW A;  2YDV A;  2XM0 A;  5JT4 A;  1JAF A;  1E12 A;  5JJJ A;  3ZTZ A;  1GQA A;  1NBB A;  1S8J A;  4MBS A;  5AWZ A;  3PBL A;  4BUO A;  4G7R B;  4QID A;  1A7V A;  3X3C A;  2Y02 A;  3QJR B;  3UZC A;  1S52 A;  3V2Y A;  3C9M A;  3HNJ A;  5G36 A;  5BR2 A;  5H2H A;  1FBK A;  4X32 A;  4MD2 A;  256B A;  3VVK A;  1CGN A;  5H2N A;  2YLI A;  3VRC A;  1C3W A;  5H2J A;  1P8U A;  3OAX A;  3QBG A;  1GZM A;  1YYX A;  3ZQY A;  1P8H A;  2M3G A;  4PXK A;  3EH3 B;  1L0M A;  3P0G A;  2J8W A;  5ETZ A;  5EN0 A;  4BEY A;  2L6X A;  4WW3 A;  3L1M A;  5B0W A;  3QAK A;  1M0K A;  2YL1 A;  2QPE B;  3QJV B;  2YLD A;  1APC A;  4D4N A;  3UTV A;  3BVD B;  4MQT A;  4J4Q A;  5JS5 A;  3QAP A;  4N6H A;  4WGY A;  4G71 B;  2RH1 A;  4FAA B;  3ZEV A;  4Y9H A;  3M4C A;  3C62 A;  3ZPQ A;  3ZPR A;  1X0S A;  1QQ3 A;  4EA3 A;  2XLE A;  1QM8 A;  3PWH A;  3WQJ A;  4GYC A;  3NY9 A;  3UTW A;  4HYJ A;  3S8F B;  1UCQ A;  4D4X A;  1AP9 A;  4ER9 A;  1HZX A;  5JSL A;  1CWQ A;  2XLM A;  5B6W A;  5H2M A;  1JFP A;  3NMI A;  4L35 A;  4X1H A;  2XL8 A;  5B6X A; 
#chains in the Genus database with same CATH topology
 1R4T A;  5JUA A;  5CI9 A;  1FTS A;  2W9Y A;  1GU8 A;  3S3C B;  3C63 A;  4G7Z F;  4AL0 A;  1NSG B;  4W8P A;  5G54 A;  3B0V C;  4N4Y B;  4CS8 C;  1KME A;  1M0M A;  3LJB A;  4YT8 A;  2Y04 A;  5F8U A;  4DRH B;  2R7S A;  1TKN A;  2D5R B;  3EG9 B;  2KSY A;  5DS5 A;  2QE9 A;  2OG2 A;  4EBB A;  1XZQ A;  3KL4 A;  4EBJ A;  5DYS A;  1BZ4 A;  3K7D A;  2XLW A;  1EHK B;  1UAZ A;  2IXP A;  1SF8 A;  1YAU O;  4AK9 A;  3C18 A;  4XPW A;  4AE4 A;  4XTL A;  4JTC B;  4JTA B;  4G7O F;  2G87 A;  4QI1 A;  1KTM A;  5TGZ A;  5T3W A;  2YL7 A;  2IYL D;  5BR5 A;  3M79 A;  3B0P A;  4LDE A;  2QTV A;  5AX1 A;  3CAP A;  5B35 A;  3QJS B;  4OIO F;  1WAS A;  4CS7 A;  5DLJ A;  2HMZ A;  1U89 A;  3FHD A;  2WB7 A;  3RQF A;  3FAJ A;  1H68 A;  4CX9 A;  5FCL A;  1KGB A;  3G4X A;  3ZWI A;  4XTO A;  3ZG1 A;  1E85 A;  2X72 A;  3MX3 A;  1E86 A;  3O6X A;  4NC3 A;  5T1D B;  3Q7L A;  1Q5I A;  3M1C B;  4PJJ A;  3ASN C;  2AP3 A;  4C3B A;  4ANJ A;  2UUH A;  5JVE A;  4GP4 B;  3HAQ A;  4OD5 A;  2KSA A;  4L6R A;  4E7S A;  3K33 A;  4LLC A;  2WVQ A;  3SYN A;  2Y00 A;  4JCH A;  4LDQ A;  2R25 A;  1U19 A;  3NMJ A;  2M64 A;  2JAF A;  3DWW A;  1Q5J A;  2WZL A;  3TK0 A;  3OA1 A;  1OKK D;  5G28 A;  5H2I A;  4LDK A;  3SNH A;  2J46 A;  1I5N A;  4HYX A;  5LWE A;  1E0P A;  2EIK C;  3AM6 A;  4MTG A;  4KNV A;  1LS4 A;  2OJQ A;  3I5P A;  1QLE C;  1IW9 A;  4HFK B;  3A11 A;  4E18 A;  2OKU A;  2XXA A;  2IM8 A;  4A4A A;  5L0F A;  3L0I A;  1Q0M A;  5A44 A;  3REY A;  1FBB A;  2F93 A;  1YAR O;  1G4U S;  4YWQ A;  3ZDL A;  3EJN A;  4JE9 A;  3LEV A;  2WJK A;  2VCB A;  3COD A;  3NY8 A;  3R7C A;  4JCZ A;  3QBI A;  2HJM A;  1YZC A;  3COC A;  2EPM X;  4I3M A;  5KKH A;  3DJU B;  3EZH A;  3GWL A;  4BEJ A;  3TJ6 A;  2YKZ A;  2PBE A;  4AE4 B;  4EWC A;  2PX3 A;  1GUE A;  3NKD A;  4CIP A;  1MQV A;  3VG9 A;  3T4R A;  3ZSU A;  1QKO A;  5H2P A;  3DAG A;  2XM4 A;  2BL2 A;  4YL0 A;  4BJT A;  3QDC A;  5D92 A;  2IXN A;  4YN0 B;  4U5E E;  2HPY A;  1OW8 A;  3G4Z A;  3H2U A;  3FOO A;  1H9T A;  2EPK X;  3GAN A;  1BRX A;  1C8S A;  1YLM A;  1HW2 A;  2KQ9 A;  2YCX A;  1JGJ A;  3CZ6 A;  1L3P A;  1TQG A;  1LE4 A;  4XPX A;  1FFT C;  2ZXR A;  4YL1 A;  3UNG C;  2YVK A;  1WOL A;  3DMD A;  1S53 A;  2PNO A;  3DE9 A;  3IQ6 A;  4DS7 E;  1NLX A;  3PXO A;  4LDL A;  2Y3G A;  3LES A;  3NYL A;  5COG A;  4LDR A;  1Z63 A;  2P61 A;  2OU6 A;  4W8K A;  3N0T A;  1Q0D A;  2PP4 A;  3MFN A;  1Z6A A;  4BEM J;  2NTW A;  2YDV A;  2LIG A;  4DOZ A;  1JAF A;  1E12 A;  1V54 C;  4OIN F;  4QI2 A;  4H4K C;  3WHN A;  3U8V A;  4BUO A;  1ZHX A;  2Y02 A;  3MYF A;  5COF A;  1S52 A;  1NU9 C;  3C9M A;  3HNJ A;  1HMD A;  5G36 A;  1FBK A;  5A69 A;  4ZLD A;  2H7B A;  4MD2 A;  1Z5Z A;  1CGN A;  4CSA C;  2Y39 A;  2YLI A;  3T9O A;  3VRC A;  1C3W A;  3DJN B;  4G0H A;  1GZM A;  1YYX A;  3K66 A;  1BR1 A;  3Q6M A;  3P0G A;  4DRI B;  5EN0 A;  1V55 C;  2CNW D;  2L6X A;  3L1M A;  2R7O A;  3CQZ A;  1UG7 A;  1ZHT A;  3QAK A;  1S7Z A;  2QY9 A;  4JUR I;  3UGP A;  4OD4 A;  4DBQ A;  1APC A;  2IXM A;  1OW6 A;  4MQ9 F;  2IOQ A;  2HFI A;  2XXA B;  2Y3B A;  1O5H A;  2J7P D;  5JS5 A;  1AVO B;  1LS1 A;  1HW1 A;  3ZEV A;  5D91 A;  4K1O A;  3M4C A;  2KC3 A;  1T6Q A;  3C62 A;  3ZPQ A;  3ZPR A;  2EPL X;  1X0S A;  1QQ3 A;  1LIH A;  3ASO C;  1J8Y F;  3C8G A;  1OR3 A;  3PWH A;  3NY9 A;  2NSF A;  1OCC C;  2R7U A;  4D4X A;  3SP1 A;  4AL1 A;  1CWQ A;  3ECS A;  3NYM A;  1JFP A;  3GEE A;  3GM2 A;  2Y69 C;  4YT2 A;  3WOD F;  1OCR C;  1D1A A;  2W4M A;  3S3D B;  1D0Y A;  2J9W A;  3DXJ F;  3TOL A;  1P8I A;  2ZFE A;  2YCY A;  1H2S A;  4YT4 A;  5BQG A;  4BJ6 C;  5T3T A;  4UG2 A;  2I20 A;  1NFO A;  2Y03 A;  4PAC A;  2LQG A;  1M6T A;  1ZHW A;  2Q4F A;  4FAP B;  1UFB A;  1IXF A;  5E2Q A;  1XJI A;  2CCY A;  4P9F A;  3HAR A;  4EBK A;  2LSE A;  4N4W A;  1O87 A;  4N6C A;  4QRY A;  4C3D A;  1AEP A;  1NFN A;  1TWA A;  1BBH A;  4LLE A;  4J7Y A;  1S05 A;  2LCH A;  3AQC A;  3MYI A;  3KJ6 A;  2HV6 A;  5E3A A;  1YJG A;  3VYW A;  1C02 A;  3PHF 2;  4JIO A;  3AOU A;  4U5C E;  2YEV A;  5KYY A;  3PDM P;  1VJM A;  1G4W R;  2ZXW C;  4PFP A;  5B2N A;  5TJ5 E;  1LM3 B;  3DI5 A;  4U9D A;  4U5G A;  5B34 A;  4GP8 B;  3PMR A;  3CAX A;  2JAG A;  3HNI A;  1MMN A;  4XEF A;  2R4R A;  5HSW A;  5AGF A;  4IJJ A;  2H7O A;  3PDS A;  3K6B A;  1M2O A;  3LAY A;  1JRA A;  3ZIB A;  1SMY F;  3LUT B;  3T45 A;  1B68 A;  3W2W A;  3QJT B;  2R4S A;  3W8H A;  4EIY A;  4BJ1 A;  5A6B A;  1QKP A;  4CJG A;  2OCC C;  3FDQ A;  1QZX A;  2LP4 A;  3HNK A;  2AVK A;  4K7B A;  1Y4C A;  3O39 A;  1WWP A;  4JQ6 A;  1JMW A;  5H2L A;  1AT9 A;  3JTL O;  2XRH A;  3W2V A;  3U2M A;  4MVZ A;  2YDO A;  3TQO A;  4NCQ A;  3SXM A;  3HNL A;  2Q7R A;  3QBK A;  4BV0 A;  3N24 A;  4CBE A;  2MYS A;  5B6Y A;  3JYY A;  1G8X A;  2Y3D A;  4IWB A;  3UZA A;  2YHS A;  4KNF A;  2I35 A;  1KG8 A;  2XSE A;  4CJO A;  3SZR A;  4AMJ A;  1WN0 A;  2B0J A;  4OIQ F;  3C8G B;  4XT3 A;  3VW7 A;  1YZA A;  3UR3 C;  2VAS A;  3GWN A;  1QHJ A;  2CDQ A;  1WAT A;  1GS9 A;  4BJ6 A;  4K5Y A;  4I1M A;  3ODU A;  4XLP F;  3C8Z A;  3KYJ A;  2YL3 A;  4PK4 A;  2P6V A;  1T6I A;  5L0J A;  5G2D A;  3EML A;  3ABM C;  3EFO A;  1PV3 A;  2RD9 A;  1O3U A;  4BWB A;  4GP5 B;  1TN5 A;  1XME B;  5AHY A;  1PXS A;  3L34 A;  3HAS A;  5G2C A;  4WGZ A;  1PXR A;  3IQC A;  3ZQV A;  3RW0 A;  2LNL A;  4ONS A;  4GEH A;  5JJN A;  2ICW G;  3AYM A;  3FMS A;  5DS4 A;  4XWJ A;  5DHH A;  1D0X A;  2L6F A;  1M2V B;  2G3K A;  2XS8 A;  4H54 A;  3U9J A;  1EQ1 A;  4E7Z A;  3E9V A;  3AYN A;  1MNE A;  3S29 A;  4JEA A;  3ABK C;  5A45 A;  4MW8 A;  4Q5S F;  4MD1 A;  2R7X A;  3HLZ A;  2LD6 A;  4QDL A;  3U0C A;  2OOC A;  3NKE A;  2YCW A;  2JX0 A;  2VCA A;  4HE8 D;  4YL3 A;  4MS2 A;  3KH2 A;  3K1H A;  2NTU A;  3DE8 A;  4FWV A;  2XLO A;  4KLY A;  4AX2 A;  1OR2 A;  3VF0 A;  3CSK A;  2XLD A;  2NUT A;  4XEV A;  4O79 A;  5JLI A;  4BJ5 A;  1RXQ A;  4FES A;  1L7C A;  2CW0 F;  2IBF A;  1F1M A;  2KYH A;  5B6Z A;  4EJ4 A;  1JV6 A;  2X0C A;  4KI2 A;  4J7T A;  2J9B A;  1BRR A;  1U6H A;  2EIN C;  4YT5 A;  1U0B B;  1YDI A;  1TN0 A;  2KW3 C;  1RKE A;  1JPN A;  2ZD9 A;  5JJE A;  2DYR C;  1XWJ A;  2I8B A;  4MVS A;  3JZ0 A;  3NS0 A;  2J4Y A;  1GGQ A;  3OE8 A;  2E87 A;  4FA7 B;  1ZZP A;  5JT4 A;  3RF3 A;  3ZTZ A;  2HSQ A;  1NBB A;  1OCZ C;  5AWZ A;  3E70 C;  2J0W A;  4MW3 A;  2GA0 A;  2KGO A;  1NZE A;  3GM1 A;  4G7R B;  4QID A;  2J45 A;  3X3C A;  4R32 A;  4LAC B;  4P6I C;  3QJR B;  5F28 E;  2OQM A;  2GFH A;  4MND A;  5H2H A;  4O6Y A;  3KYI A;  4X32 A;  3O10 A;  3I4U A;  3B71 A;  5BQH A;  5KYX A;  4I1O B;  3QBG A;  1P8H A;  2M3G A;  5ETZ A;  3X1O A;  1IZM A;  2QUP A;  3EFO B;  2QPE B;  2XL4 A;  1BDJ B;  1ZHY A;  2ZXP A;  1D1C A;  3F47 A;  2GWW A;  3UTV A;  3BVD B;  4J4Q A;  4U5F E;  1A7E A;  4KNW A;  3QAP A;  2KSF A;  2EPO A;  2RH1 A;  2TMV P;  4NY3 A;  3S84 A;  2OEX A;  4DJ9 A;  1JPJ A;  3WG7 C;  4RBN A;  5A6J A;  4PFO A;  2OEV A;  3F46 A;  4EA3 A;  2LFD A;  2XLE A;  4MTF A;  4GYC A;  3QTH A;  3EH2 A;  5JSL A;  2XLM A;  5B6W A;  5H2M A;  1OKK A;  4XLN F;  3ATP A;  3NMI A;  3U3B A;  1LI7 A;  4BG0 A;  1VYI A;  3T6B A;  3GEI A;  4DRJ B;  1IW7 F;  1D1B A;  3B0U X;  3QVY A;  4RD9 A;  2J0X A;  1RCP A;  2IXO A;  1RMV A;  4IAQ A;  1ORJ A;  2YLG A;  3LNR A;  1OQC A;  3UON A;  2Y01 A;  2HSB A;  3QMK A;  2NUT B;  3C8G D;  1JOG A;  3RFY A;  4O7G A;  4FX5 A;  1YYJ A;  3W4Y A;  3DM9 B;  1GM5 A;  2XLH A;  1CGM E;  3AG3 C;  1BM1 A;  1R84 A;  1LN6 A;  5BQI A;  3HKK A;  4XPY A;  2AT9 A;  4EHP A;  5GPG B;  3IHU A;  4MQS A;  3U8P A;  4I44 A;  2DGJ A;  4E17 A;  1PCX A;  1Z3I X;  3HAO A;  1WTY A;  4HEA J;  4MVQ A;  5B3I A;  3EGX A;  2GDC A;  1IW6 A;  4CDA A;  1C17 M;  4PR9 A;  4DVY P;  4P9T A;  3I5Q A;  5E3C A;  2KJG A;  2GAQ A;  3EGD A;  3GEH A;  5DQT A;  3UTX A;  4CS9 A;  3QW0 A;  3RQG A;  2R03 A;  1H7I A;  1MGY A;  3VHZ A;  1MMG A;  3T6J A;  4HFF B;  3RQE A;  1A0B A;  1W2W A;  3AGU A;  3TD7 A;  1H9G A;  2QLA A;  2PX0 A;  2W45 A;  5G2A A;  4UDV A;  4LER A;  1BR2 A;  2Q9C A;  4MVM A;  3QBL A;  1ZVZ A;  4JJG A;  3QVZ A;  2EPN A;  2O9X A;  3S90 A;  4OIP F;  4G78 A;  3G50 A;  4CDY A;  3X3B A;  2G3V A;  3LLK A;  5KYX B;  3IQ5 A;  4CDV A;  4O6N A;  2I21 A;  3A7K A;  1VLS A;  3QW1 A;  1YA7 O;  4WAB A;  5L3Q A;  1ZU5 A;  3AQB A;  2Q9A A;  3W8I A;  3SXZ A;  4DAJ A;  3RYL A;  4DJH A;  3BEH A;  2A0B A;  4A4M A;  2KNH A;  4WAV A;  5ITC A;  3EG9 A;  1ZYR F;  3VI0 A;  1Q0G A;  4O6M A;  1VK5 A;  3FAP B;  4XEK A;  3DM5 A;  2HS5 A;  4E0H A;  3NYA A;  2R02 A;  4TL3 A;  2Q00 A;  3B29 A;  4KBL A;  3EHN A;  3H2V A;  2R7R A;  3NDB B;  3SXY A;  1DOW A;  1DOV A;  3UMH A;  4MTO A;  5AHZ A;  5J7A A;  1KU2 A;  5AC5 A;  2FAP B;  1HMO A;  2VT4 A;  3RVZ A;  4U5D E;  1C8R A;  2NSG A;  2DB4 A;  2CNW A;  3EZI A;  2KS9 A;  3PQR A;  1YVI A;  4BVN A;  5B6V A;  4J32 B;  2Z73 A;  3D4S A;  3VGA A;  4Z9J A;  1MND A;  3RFM A;  3EPV A;  2R9R B;  2XS1 A;  1FR0 A;  1L9H A;  4AMI A;  1QKR A;  4ULW A;  1E84 A;  2EI4 A;  3RH3 A;  2VC9 A;  4Z9H A;  1K05 A;  2P7V A;  1KNY A;  3V2W A;  4PXF A;  4BEZ A;  4HWL A;  1XIO A;  3EHM A;  3ZTM A;  5KYW A;  4G70 B;  1PY6 A;  4G7Q B;  1DZE A;  5DHG A;  4G72 B;  4JEB A;  1NG1 A;  4BJ5 C;  4JTD B;  3EGD B;  4XQ1 A;  1F50 A;  1LE2 A;  2F22 A;  3J06 A;  1TWC A;  1VOM A;  1T6U A;  2UUI A;  1SR2 A;  5IY5 C;  4G7S B;  3ABL C;  4IAO A;  4JRZ A;  5COM A;  4YJW A;  4C7O A;  4XT1 A;  1FMW A;  3MLG A;  1VMA A;  2R7Q A;  3UMI A;  1F4Z A;  5C1M A;  4JZA A;  2Z55 A;  1I4Y A;  1CPR A;  2ZPA A;  2NUP A;  2CGE A;  2V3C C;  3DQB A;  3L8J A;  1CGO A;  5L0D A;  3NSB A;  1HE1 A;  4U9E A;  1G5Z A;  2VCC A;  3OE9 A;  3FOP A;  1ZHZ A;  1OXB A;  4ULV A;  2KSB A;  5AZD A;  2R7T A;  2I15 A;  3EH5 B;  1F88 A;  2NPU A;  5JP7 A;  1TFO B;  3DDL A;  3VAY A;  1VGO A;  2L9J A;  3EH4 B;  4DKL A;  2XM0 A;  5AC4 A;  1VB5 A;  1SZI A;  3UGO A;  4E0I A;  1S8J A;  2B0H A;  3LLI A;  3PBL A;  5A6K A;  4Q4Z F;  2C04 A;  1A7V A;  3FVY A;  3UZC A;  3V2Y A;  4BPM A;  3PCV A;  5BR2 A;  2A69 F;  4U5B E;  3IPM O;  1Z23 A;  4A2N B;  3LS1 A;  256B A;  5H2N A;  1PD0 A;  5H2J A;  2W4B A;  1JR8 A;  1TFK B;  1QSP A;  4PXK A;  3EH3 B;  3WAQ A;  2WVO A;  4WW3 A;  5B0W A;  3A9C A;  5KYY B;  1M0K A;  1A7D A;  4JW1 A;  1SYQ A;  2X51 A;  4MQT A;  2H7V C;  4U5H A;  1V4A A;  1FMV A;  4WGY A;  4G71 B;  1ZU4 A;  4FAA B;  3LS0 A;  5F5H A;  1VYK A;  2LFF A;  1E2X A;  4C3E A;  1QM8 A;  4PJM A;  3S28 A;  1RKC A;  1TWH A;  2R7W A;  3WQJ A;  3S8F B;  1UCQ A;  1AP9 A;  1HY5 A;  4ER9 A;  1HZX A;  4DBR A;  1T01 A;  2ASR A;  5KYW B;  2L6G A;  4X1H A;  2XL8 A;  3V7O A;  5B6X A;  1EA8 A;  1OW7 A;  2DI3 A;  1H6G A;  3OE6 A;  3OWT A;  2JPU A;  1QPU A;  1TR2 A;  1I4Z A;  4XXJ A;  5JRA A;  3K1I C;  3O55 A;  2ZZL A;  4MVO A;  5H2O A;  3V5Y A;  3U9M A;  3AG1 C;  4B6I A;  3Q6N A;  5KYN A;  5KYU A;  1KG9 A;  2Z15 A;  1S8L A;  2P1A A;  4C7O B;  2WZF A;  5L0C A;  2Q3T A;  2G62 A;  3T6G B;  3TUL A;  3RVY A;  3IEE A;  3EH1 A;  1RJ9 A;  3S9O A;  3V5Z A;  3HJC A;  4CS8 A;  3NRH A;  2Y3H A;  2A1D D;  2NUP B;  3DKA A;  2L6H A;  2NG1 A;  3M4B A;  5L0G A;  4JC7 A;  4CS9 C;  1Y6D A;  4YK5 A;  4NTA A;  5H2K A;  3U5S A;  4GRV A;  3ITF A;  3N2Z B;  1X0K 1;  2QPD B;  2HKV A;  1ZW3 A;  4QI0 A;  1FNT c;  3QJQ B;  2J9U A;  2CYD A;  1EKY A;  3IQT A;  3UTY A;  4NTB A;  2HUJ A;  2H8A A;  2YZS A;  5HV9 A;  2PFD A;  4J30 B;  1J8M F;  2HV7 A;  3SXK A;  2I1X A;  2D4U A;  3NYJ A;  4WJ0 A;  3C9L A;  2MWQ A;  3S0X A;  4Z9I A;  5DVW A;  1BRD A;  5FJG A;  4Q7C A;  3POV A;  3JT1 A;  1S51 A;  2XL6 A;  2YWA A;  1MMD A;  3JRM O;  2YRF A;  2KK1 A;  2F95 A;  2FFH A;  2DYS C;  1E83 A;  1ORY A;  2A6E F;  3AG2 C;  3S3B B;  1YA9 A;  1O0A A;  3MBV A;  3S27 A;  3Q7G A;  2ETS A;  1LKX A;  4IRU A;  1T5O A;  2ZIY A;  1NU7 D;  1S54 A;  3GOR A;  5B1B C;  1WGW A;  2EIM C;  2BE5 F;  3DAF A;  4EKW A;  4CIH A;  3S8G B;  5A6A A;  4GPO A;  5K0I A;  2WJL A;  4X31 A;  4JJF A;  1R5I D;  1CPQ A;  5DQZ A;  5BUO A;  3K1I A;  2PED A;  2HJ3 A;  3RZE A;  3UMK A;  3HTK C;  4FPD A;  3BRJ A;  3R2P A;  1OXK A;  4LDO A;  2J9V A;  2HZ8 A;  2JD3 A;  5B3S C;  3DD7 A;  4GQH A;  1EI7 A;  3QJU B;  3SN6 R;  2M4E A;  1RKE B;  3AG4 C;  1QVX A;  1VTM P;  4MVU A;  1HE9 A;  4XTN A;  2AWY A;  3C7J A;  3M15 A;  5E33 A;  2YCZ A;  4OV0 A;  5EK0 A;  4ZLC A;  1V74 B;  3TOM A;  5KYU B;  3V5X A;  4N06 A;  2Q9B A;  5G53 A;  4FBZ A;  4RDA A;  4JKV A;  5L0H A;  3CEX A;  1RJ9 B;  5A8E A;  4IAR A;  1BR4 A;  2R05 A;  5FZT A;  1ST6 A;  3FXH A;  1X0I 1;  1M56 C;  2LK4 A;  2YL0 A;  1T9K A;  3OE0 A;  1Q0F A;  1D0Z A;  5AX0 A;  4UHR A;  1M57 C;  3NG1 A;  3JCU Q;  1ORS C;  2A0U A;  3HAP A;  4NQF A;  1LVK A;  2R7V A;  2BC5 A;  2WL8 A;  4IB4 A;  2BRD A;  1Z7Q c;  2XLV A;  1R2N A;  4MVR A;  3HAN A;  2VB6 A;  3H65 A;  3UG9 A;  1M0L A;  3OEO A;  1TWG A;  4M63 A;  4X0R A;  1FAP B;  3GM3 A;  1OCO C;  4PJN A;  3NMK A;  4JR8 A;  3SEO A;  3JYH A;  2YQY A;  1PD1 A;  3LNM B;  4GYT A;  1LPE A;  2QNL A;  5A6B D;  4JVS A;  2A6H F;  1AUE A;  2WZG A;  2ZXO A;  2AWC A;  3X2Q C;  5ITE A;  2AU5 A;  1JV7 A;  1VLT A;  2A68 F;  3RKO F;  5EGY A;  1XZP A;  3ABW A;  4NTF A;  1A41 A;  2L7A A;  3KPH A;  3GOD A;  4IGG A;  4GBR A;  3VM6 A;  3LEO A;  5L3V A;  2VH3 A;  2V26 A;  2EIJ C;  3AJM A;  3JSZ A;  4G7H F;  5JJJ A;  1GQA A;  4MBS A;  3EQL F;  1M2V A;  2OJE D;  5EHH A;  2WVN A;  3TJ5 A;  1C03 A;  1K40 A;  2J7P A;  4XTK A;  2L81 A;  3US6 A;  3ZC4 A;  3VVK A;  3L8I A;  2EIL C;  4DVZ A;  3KKB A;  2FGY A;  5L0I A;  1P8U A;  2HMQ A;  3U2L A;  3OAX A;  3ZQY A;  3AGT A;  1ZW2 A;  2PF4 E;  4DXW A;  1L0M A;  2J8W A;  3JSE O;  2P0N A;  1K04 A;  4BEY A;  4KC9 A;  5B1A C;  3JRT A;  3KMI A;  4PJL A;  3U3F A;  3EGX B;  2YL1 A;  3QJV B;  2YLD A;  4CSA A;  3DZA A;  4D4N A;  1N1C A;  4F4B A;  4K0D A;  4EUK B;  5DS6 A;  1FFH A;  4N6H A;  1MMA A;  1Q0K A;  4Y9H A;  1LI5 A;  4OIR F;  5F5F A;  3B9Q A;  2RSE B;  3RIP A;  2C03 A;  3ZVR A;  3UTW A;  4HYJ A;  2MHR A;  5CI8 A;  4L35 A;  3QZC A;  3MBG A;  5CIV A; 
#chains in the Genus database with same CATH homology
 5JUA A;  3QVY A;  3OE6 A;  1QPU A;  3S3D B;  1GU8 A;  3S3C B;  1RCP A;  3TOL A;  1P8I A;  2ZFE A;  3C63 A;  4XXJ A;  4IAQ A;  5JRA A;  2YCY A;  2ZZL A;  1H2S A;  5H2O A;  2YLG A;  3UON A;  5G54 A;  4UG2 A;  2Y01 A;  4N4Y B;  2I20 A;  2Y03 A;  1M6T A;  1KG9 A;  1KME A;  1IXF A;  1XJI A;  2CCY A;  3HAR A;  1YYJ A;  1M0M A;  1S8L A;  2XLH A;  1BM1 A;  1R84 A;  1LN6 A;  2Y04 A;  4N4W A;  2AT9 A;  5F8U A;  4QRY A;  1BBH A;  4MQS A;  3U8P A;  2KSY A;  1S05 A;  3KJ6 A;  3M4B A;  5DYS A;  3HAO A;  2XLW A;  1EHK B;  1UAZ A;  5B3I A;  5H2K A;  4GRV A;  1VJM A;  1IW6 A;  4CDA A;  5B2N A;  4XTL A;  1LM3 B;  1X0K 1;  2QPD B;  4U9D A;  2G87 A;  5B34 A;  4QI1 A;  3UTX A;  4GP8 B;  3QJQ B;  5TGZ A;  1EKY A;  2YL7 A;  3QW0 A;  3UTY A;  5BR5 A;  1MGY A;  3M79 A;  3VHZ A;  4LDE A;  2JAG A;  3HNI A;  2R4R A;  5AGF A;  5AX1 A;  2QLA A;  5G2A A;  3PDS A;  3CAP A;  5B35 A;  3QJS B;  2I1X A;  3T45 A;  3QJT B;  2R4S A;  3QBL A;  4EIY A;  3C9L A;  3QVZ A;  1QKP A;  1BRD A;  5FJG A;  4CJG A;  1S51 A;  2XL6 A;  4CDY A;  3X3B A;  3HNK A;  3IQ5 A;  1H68 A;  4CX9 A;  2F95 A;  1KGB A;  4CDV A;  1E83 A;  3ZWI A;  4JQ6 A;  4XTO A;  1E85 A;  2I21 A;  5H2L A;  2X72 A;  3S3B B;  1AT9 A;  1E86 A;  1O0A A;  3MBV A;  4NC3 A;  3A7K A;  2YDO A;  1Q5I A;  3QW1 A;  3HNL A;  2ZIY A;  3QBK A;  1S54 A;  5JVE A;  4BV0 A;  4GP4 B;  4DAJ A;  3HAQ A;  2KSA A;  4L6R A;  5B6Y A;  4DJH A;  4A4M A;  5ITC A;  4WAV A;  3UZA A;  2Y00 A;  4KNF A;  2I35 A;  1KG8 A;  1U19 A;  4CJO A;  3NMJ A;  3S8G B;  3VI0 A;  4AMJ A;  4GPO A;  2JAF A;  4XT3 A;  3VW7 A;  3NYA A;  4TL3 A;  2WJL A;  4X31 A;  1Q5J A;  1YZA A;  1CPQ A;  5G28 A;  5H2I A;  1QHJ A;  2PED A;  3RZE A;  4HYX A;  5LWE A;  1E0P A;  4K5Y A;  3AM6 A;  4FPD A;  3ODU A;  5AHZ A;  5J7A A;  4LDO A;  2VT4 A;  2YL3 A;  3QJU B;  3SN6 R;  1C8R A;  5G2D A;  1IW9 A;  3EML A;  2KS9 A;  3PQR A;  4XTN A;  4BVN A;  3M15 A;  2YCZ A;  5B6V A;  2Z73 A;  4OV0 A;  3D4S A;  4BWB A;  4GP5 B;  3VGA A;  1TN5 A;  1XME B;  3TOM A;  5AHY A;  3RFM A;  1PXS A;  5G53 A;  4FBZ A;  3HAS A;  5G2C A;  4WGZ A;  1L9H A;  4AMI A;  1PXR A;  3ZQV A;  2LNL A;  5A44 A;  4JKV A;  5JJN A;  3REY A;  1FBB A;  1E84 A;  2F93 A;  3AYM A;  2EI4 A;  5DHH A;  5A8E A;  4IAR A;  4JE9 A;  3V2W A;  3AYN A;  1X0I 1;  2WJK A;  4PXF A;  3COD A;  4JEA A;  4BEZ A;  2YL0 A;  5A45 A;  3NY8 A;  4HWL A;  4MD1 A;  3OE0 A;  1XIO A;  5AX0 A;  4UHR A;  3ZTM A;  3QBI A;  1YZC A;  3COC A;  4G70 B;  1PY6 A;  3HAP A;  5KKH A;  4G7Q B;  1DZE A;  2YCW A;  2BC5 A;  5DHG A;  2YKZ A;  4G72 B;  4JEB A;  4IB4 A;  1GUE A;  2BRD A;  4CIP A;  2XLV A;  1MQV A;  1F50 A;  1R2N A;  3VG9 A;  2NTU A;  1QKO A;  5H2P A;  3DE8 A;  2XM4 A;  3HAN A;  3QDC A;  3UG9 A;  2XLO A;  4KLY A;  1M0L A;  2HPY A;  3NMK A;  3FOO A;  2XLD A;  4JR8 A;  4G7S B;  5JLI A;  1BRX A;  1C8S A;  4XT1 A;  1F4Z A;  2YCX A;  1JGJ A;  5C1M A;  5B6Z A;  2Z55 A;  4EJ4 A;  1JV6 A;  5ITE A;  1JV7 A;  1CPR A;  2J9B A;  1BRR A;  3DQB A;  1TN0 A;  1S53 A;  1CGO A;  3DE9 A;  3ABW A;  3NSB A;  4U9E A;  3IQ6 A;  4DS7 E;  3OE9 A;  3FOP A;  5JJE A;  5AZD A;  4ULV A;  2KSB A;  4GBR A;  3PXO A;  4LDL A;  3EH5 B;  1F88 A;  5JP7 A;  3DDL A;  3NS0 A;  2J4Y A;  1VGO A;  3OE8 A;  4FA7 B;  3EH4 B;  4DKL A;  2NTW A;  2YDV A;  2XM0 A;  5JT4 A;  1JAF A;  1E12 A;  5JJJ A;  3ZTZ A;  1GQA A;  1NBB A;  1S8J A;  4MBS A;  5AWZ A;  3PBL A;  4BUO A;  4G7R B;  4QID A;  1A7V A;  3X3C A;  2Y02 A;  3QJR B;  3UZC A;  1S52 A;  3V2Y A;  3C9M A;  3HNJ A;  5G36 A;  5BR2 A;  5H2H A;  1FBK A;  4X32 A;  4MD2 A;  256B A;  3VVK A;  1CGN A;  5H2N A;  2YLI A;  3VRC A;  1C3W A;  5H2J A;  1P8U A;  3OAX A;  3QBG A;  1GZM A;  1YYX A;  3ZQY A;  1P8H A;  2M3G A;  4PXK A;  3EH3 B;  1L0M A;  3P0G A;  2J8W A;  5ETZ A;  5EN0 A;  4BEY A;  2L6X A;  4WW3 A;  3L1M A;  5B0W A;  3QAK A;  1M0K A;  2YL1 A;  2QPE B;  3QJV B;  2YLD A;  1APC A;  4D4N A;  3UTV A;  3BVD B;  4MQT A;  4J4Q A;  5JS5 A;  3QAP A;  4N6H A;  4WGY A;  4G71 B;  2RH1 A;  4FAA B;  3ZEV A;  4Y9H A;  3M4C A;  3C62 A;  3ZPQ A;  3ZPR A;  1X0S A;  1QQ3 A;  4EA3 A;  2XLE A;  1QM8 A;  3PWH A;  3WQJ A;  4GYC A;  3NY9 A;  3UTW A;  4HYJ A;  3S8F B;  1UCQ A;  4D4X A;  1AP9 A;  4ER9 A;  1HZX A;  5JSL A;  1CWQ A;  2XLM A;  5B6W A;  5H2M A;  1JFP A;  3NMI A;  4L35 A;  4X1H A;  2XL8 A;  5B6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...