4L6RA

Structure of the class b human glucagon g protein coupled receptor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
413
structure length
398
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human glucagon class B G-protein-coupled receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Soluble cytochrome b562 and Glucagon receptor chimera
total genus 138
structure length 398
sequence length 413
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00002 7tm_2 7 transmembrane receptor (Secretin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4l6rA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4l6rA02
4GP8B 2Y01A 4ULVA 2VT4A 4CDVA 4GP4B 4D4XA 3EMLA 3QBIA 1L0MA 4UG2A 4JEAA 5G36A 3S8GB 1R84A 1PXRA 4GPOA 3QAKA 4EA3A 4GBRA 4IB4A 1XJIA 3VVKA 5LWEA 4CJOA 4EIYA 3QBGA 1EHKB 2R4RA 3HNKA 1IW9A 1KMEA 3ZEVA 4D4NA 3AYMA 5H2IA 3VGAA 1BRXA 1F88A 2JAFA 4L6RA 3NMKA 1XIOA 5A44A 4G70B 5C1MA 2XLHA 2J4YA 1QM8A 1M0MA 5AWZA 3M15A 4PXFA 4X1HA 5AHYA 3UZCA 3VW7A 1BRRA 1CGOA 2I35A 2CCYA 4XTNA 3SN6R 3MBVA 1L9HA 2L6XA 4WAVA 2Z73A 5DYSA 5FJGA 4DKLA 1S54A 1KG9A 1YZCA 5ITEA 4G7RB 4XT1A 1JFPA 1FBBA 5B6YA 3L1MA 2YDOA 1VJMA 1RCPA 4G7QB 3CAPA 1AT9A 2XLWA 1KG8A 2Y03A 4GYCA 3VRCA 3U8PA 4IARA 4N6HA 4MD1A 5JSLA 1M0LA 3C9MA 1E12A 4MQSA 3RFMA 2G87A 2XLVA 1CWQA 2XL6A 3C63A 5EN0A 4MD2A 1YYXA 5BR2A 4NC3A 4U9EA 3PDSA 4L35A 4X32A 2YLDA 3HASA 3NMIA 5JJEA 2QPDB 1QKOA 4CDYA 4N4YB 5A8EA 3ZTZA 5TGZA 2KSYA 5G2CA 2YCXA 4JQ6A 3A7KA 3UTWA 5JJNA 4X31A 1IW6A 2AT9A 2YKZA 5AHZA 1S52A 4WGZA 5H2JA 4HYJA 5H2MA 5DHHA 1JV6A 5AGFA 3PXOA 4KNFA 256BA 3HNIA 2NTWA 1IXFA 5H2KA 1QKPA 1PY6A 4G71B 3NMJA 2X72A 1GZMA 4OV0A 2ZFEA 3HAQA 1P8IA 4KLYA 5G28A 1JGJA 1AP9A 2YL7A 3PQRA 3C62A 3DE9A 2F93A 1LM3B 3HANA 3NS0A 3ZTMA 5B6XA 5B2NA 3NY9A 1M0KA 1S8JA 1JAFA 3TOMA 1XMEB 3QJTB 1YYJA 4WW3A 3VHZA 4BWBA 2YDVA 3ZPQA 2J8WA 3P0GA 4WGYA 5H2OA 4GRVA 5B0WA 3OAXA 3PWHA 4XT3A 2YLGA 3QVYA 3D4SA 1VGOA 2BRDA 3HNLA 1TN5A 3QJSB 1C3WA 2JAGA 1S05A 5G2DA 2I20A 5JRAA 3NY8A 4DJHA 4FPDA 1S51A 3FOPA 1P8UA 4PXKA 1E85A 2XLEA 4QI1A 3EH5B 2ZZLA 4XTLA 5JLIA 3X3CA 3ZQYA 1BRDA 1KGBA 3V2YA 4JR8A 5B34A 5J7AA 3X3BA 4G7SB 3ZPRA 5H2PA 2Y00A 4BUOA 4FBZA 4BVNA 2YL3A 3C9LA 3DDLA 4BV0A 4HYXA 2YCWA 2HPYA 3VI0A 2RH1A 2XLOA 4AMIA 5JT4A 3VG9A 3TOLA 3QJQB 4HWLA 2YL0A 5B3IA 5JS5A 1P8HA 4U9DA 4CDAA 5B6ZA 2XM4A 3IQ5A 1CPQA 3FOOA 4QRYA 3QBLA 1BBHA 1QQ3A 2KSBA 1JV7A 5A45A 3S3BB 1C8SA 2QLAA 3PBLA 4LDLA 3S8FB 1YZAA 3ODUA 1LN6A 5F8UA 3HARA 2Y04A 5H2HA 2XLMA 1GQAA 5DHGA 1QPUA 3OE8A 3S3CB 3EH4B 1GU8A 3QW1A 3DQBA 4XTOA 1CGNA 1EKYA 5BR5A 1E83A 2Z55A 3EH3B 3UTYA 4CJGA 3UTVA 1F4ZA 3V2WA 5AX0A 3HAOA 1E0PA 2F95A 3HNJA 3ZQVA 3ZWIA 3IQ6A 1FBKA 2YCZA 3QJVB 4GP5B 2EI4A 1DZEA 4MBSA 4N4WA 5JP7A 1S8LA 3QBKA 1UCQA 3QJUB 2M3GA 3OE0A 3QW0A 5ETZA 3UG9A 5H2LA 2XL8A 5JUAA 4BEZA 2BC5A 2NTUA 4BEYA 2LNLA 3M4BA 4QIDA 2PEDA 2ZIYA 3UONA 3KJ6A 3NSBA 3S3DB 3OE6A 5B6VA 4K5YA 4CIPA 3REYA 3OE9A 4LDOA 2WJLA 1H68A 3RZEA 3WQJA 2YL1A 1X0SA 1A7VA 3QDCA 3UTXA 5AX1A 3ABWA 1S53A 1M6TA 1MGYA 2Y02A 3CODA 1GUEA 5JVEA 2YLIA 1E86A 5H2NA 2KSAA 1C8RA 4JE9A 4FA7B 3AYNA 2WJKA 1Q5IA 4LDEA 4A4MA 1MQVA 1E84A 4XXJA 1NBBA 1CPRA 2I1XA 5G54A 4MQTA 5B6WA 3DE8A 5B35A 1Q5JA 2QPEB 4UHRA 3M4CA 3AM6A 1X0K1 5ITCA 1X0I1 5AZDA 3UZAA 5KKHA 2I21A 3QJRB 5JJJA 4Y9HA 4JKVA 1H2SA 4AMJA 3QAPA 3HAPA 4JEBA 3COCA 3NYAA 4EJ4A 4TL3A 1APCA 2R4SA 1F50A 1HZXA 2XM0A 3BVDB 5G53A 1R2NA 3M79A 3QVZA 2YCYA 2J9BA 4FAAB 4IAQA 4G72B 1PXSA 4DAJA 4ER9A 3T45A 4J4QA 1UAZA 1BM1A 1TN0A 5G2AA 1QHJA 2XLDA 1U19A 4CX9A 2KS9A 1O0AA
chains in the Genus database with same CATH superfamily
5DVWA 2Y01A 1C03A 5FZTA 1Q0DA 2VT4A 4F4BA 3V5ZA 4AK9A 5DS4A 5L0IA 4GP4B 3N0TA 4D4XA 5HV9A 3U9JA 4KI2A 3RFYA 2DB4A 1O5HA 1NU7D 4M63A 2W45A 1H9TA 3QBGA 4J30B 1EHKB 4MW8A 1IW9A 3ABKC 5H2IA 3E9VA 2GA0A 4WABA 3FAPB 1F88A 4PACA 1OQCA 4L6RA 5A44A 4BJ5C 3I4UA 1U6HA 3GM2A 4MVZA 4I44A 2Q00A 5A69A 2OU6A 3DZAA 2L9JA 4MTGA 4JW1A 2ZXPA 4QDLA 3S84A 4CBEA 1TKNA 3DAGA 4YN0B 4K7BA 3NKDA 1ZHTA 2F22A 1JFPA 1FBBA 1ZHYA 1VJMA 1RCPA 4YT2A 4G7QB 2VB6A 3K7DA 2Y03A 2HSQA 4AL0A 3FVYA 4XEVA 3L0IA 3DMDA 5EN0A 1YYXA 3HASA 3LESA 3JSEO 3VAYA 1IZMA 5TGZA 3Q7LA 5KYWB 3B71A 3A7KA 1HMOA 1HY5A 3EGXA 5JJNA 1VYKA 2XXAA 5L0FA 1S52A 4WGZA 5H2JA 1FFTC 5H2MA 5DHHA 1I4ZA 4A2NB 5EHHA 3HNIA 1QKPA 4KC9A 2ETSA 1GGQA 3EFOB 3W8IA 2QNLA 1GZMA 3OWTA 4OV0A 4JZAA 3UGOA 3BRJA 4Q5SF 3OEOA 1JGJA 2LFDA 2V26A 2QTVA 1Q0MA 3O55A 4C7OA 2YL7A 3PQRA 3C62A 4ANJA 4LLCA 2F93A 5A6KA 2Y39A 1T6QA 3AQCA 4KNVA 1JAFA 3TOMA 1FR0A 3ZPQA 3T6JA 2J8WA 1OCOC 4U5HA 3GEEA 4WGYA 5HSWA 2BL2A 3OAXA 3PWHA 3EJNA 3RIPA 2YLGA 3ASNC 3QVYA 3GWLA 2R7SA 3D4SA 1YLMA 3QJSB 3TULA 4MNDA 1C3WA 2JAGA 2KW3C 4U5BE 3AGTA 4GYTA 3K1HA 3V7OA 4DJHA 3ZSUA 4FPDA 2XLEA 3LEOA 1V4AA 2Q9AA 3V2YA 4JR8A 5E3CA 3KMIA 1NFOA 3ZPRA 4MVUA 3F47A 1LI7A 2YL3A 3IQCA 1M2VB 3F46A 2KJGA 2VCCA 4DRJB 2RSEB 1I4YA 2RH1A 4AMIA 3QJQB 4MVSA 5B3IA 4U9DA 2XM4A 3C8GB 1CPQA 4FWVA 4LDRA 3QBLA 1ZHZA 2OEXA 2LK4A 2KSBA 2IOQA 4W8KA 3LNMB 3SXKA 3PBLA 1VLTA 3DJNB 4JIOA 5F8UA 2WZGA 1YDIA 1OKKD 1T6UA 3MFNA 4E17A 4DRHB 4E0IA 4J32B 4XPYA 3PCVA 1CGNA 1XWJA 4PR9A 2FAPB 1ZHWA 3UTYA 1RJ9B 3UR3C 3HAOA 3IEEA 2EILC 3WHNA 1T01A 3HNJA 2VC9A 3J06A 1FBKA 4CSAC 1R5ID 2YCZA 5EGYA 2L6HA 3ABMC 2JPUA 4N4WA 1DZEA 5COMA 4MBSA 3LS0A 3BEHA 3FXHA 3KH2A 2B0JA 1A0BA 1FMWA 5H2LA 1RXQA 2KGOA 3NSBA 5B3SC 2GAQA 1JPNA 4DJ9A 1EI7A 1RKEA 4CS9A 2DYRC 5D91A 1D1CA 4G0HA 1X0SA 2J0XA 3QDCA 2J7PD 3AG1C 4BJ6A 5E2QA 3VYWA 5DLJA 5JVEA 3AG3C 4JTAB 4JE9A 4YT8A 3K33A 3UMHA 4XXJA 1FMVA 1NBBA 5A6JA 2I1XA 1HMDA 4NTBA 3SYNA 4U5DE 3B0UX 2G3KA 1JMWA 5B35A 4JTDB 3M4CA 3UMKA 4OIQF 1MNEA 1ZU4A 5AZDA 1D1BA 3MYIA 5KYYA 5JJJA 4HE8D 3UMIA 4JKVA 2L6GA 3U5SA 3LS1A 1M56C 3KYJA 4JEBA 4CS8C 1APCA 5B1BC 4NTAA 3RQEA 2D5RB 4IAOA 1HZXA 2XSEA 3FDQA 3BVDB 2YZSA 3KPHA 3N2ZB 3QVZA 4FAAB 1MNDA 4ER9A 1G5ZA 4J4QA 2ZXOA 2XLDA 1KNYA 4YT5A 4GP8B 4CDVA 1TWGA 1Z63A 3NDBB 3EMLA 1L0MA 1OKKA 4UG2A 3O10A 1R84A 1PXRA 4GPOA 1NSGB 4GBRA 1WATA 5LWEA 4EIYA 4O6YA 5L0JA 2R4RA 1KMEA 2LQGA 5COGA 4P9TA 2CW0F 3JZ0A 2R7QA 4IGGA 1SZIA 4BJ6C 1XIOA 1HE9A 1QVXA 4NTFA 4AL1A 3EGXB 1CGME 2J4YA 3GODA 2KSFA 1M0MA 4R32A 2X0CA 3M15A 4PXFA 3NG1A 5AHYA 2EIMC 2HMZA 1TQGA 3GM3A 4YK5A 2HMQA 3DD7A 4WAVA 1BDJB 1D1AA 1S54A 4N06A 3PHF2 1YZCA 3RKOF 5ITEA 3GANA 3HKKA 4IWBA 4XT1A 5B6YA 1IW7F 4RD9A 3JRMO 5KYNA 2YDOA 3H65A 3CAPA 1NU9C 3JTLO 3R2PA 5KYXA 2XLWA 1E2XA 1RJ9A 3VRCA 2R25A 3AJMA 4J7TA 5JSLA 3FAJA 3C9MA 1E12A 4MQSA 1ORYA 2XLVA 3EGDA 2XL6A 1BZ4A 4I1MA 3EHMA 4NC3A 4XPXA 4U9EA 2HSBA 2KC3A 2MHRA 5JJEA 1FTSA 1BR2A 4Q7CA 1HW2A 5A8EA 3ZDLA 1JRAA 4XEKA 5D92A 3WG7C 3C8GA 2AU5A 1HE1A 4LERA 4E0HA 2LCHA 5T1DB 1GS9A 2J46A 4HYJA 1MMAA 4KNFA 3EG9A 5H2KA 4MVOA 3UGPA 4O6MA 1Y6DA 2X72A 4EUKB 5F5HA 2ZFEA 3EPVA 4AE4A 2ZPAA 4KLYA 2QUPA 3H2VA 2MYSA 1AP9A 2CNWA 1UG7A 1A7EA 3DE9A 1WN0A 1LM3B 5T3TA 3HANA 3NS0A 1PCXA 2R9RB 5B2NA 3NY9A 1S8JA 3QJTB 2KNHA 3SP1A 1YYJA 2IXOA 2VASA 1BR4A 5A6BA 3QZCA 3OA1A 4MVRA 2W4BA 2BRDA 1WOLA 4OIOF 2IXPA 2ICWG 3N24A 4LDQA 1S05A 5G2DA 5TJ5E 3EQLF 3RYLA 2ZZLA 3TJ6A 2GFHA 2YWAA 2OOCA 5A6BD 3X3BA 1W2WA 2HJMA 4BUOA 2Y00A 3WODF 4BVNA 2OJED 2J0WA 2Q4FA 4BV0A 2R05A 2HPYA 3VI0A 4XLNF 5JT4A 1P8HA 2ASRA 1ZHXA 1OCZC 1O87A 1BBHA 4XEFA 1QQ3A 2WZLA 1Y4CA 3DM9B 4IRUA 4LDLA 3NYJA 1LN6A 5H2HA 4GEHA 1OCRC 5DHGA 1QPUA 3OE8A 3EH4B 1GU8A 3QW1A 1JR8A 3MYFA 1A41A 1D0YA 4FX5A 1C02A 1ZYRF 4CJGA 3PDMP 4Q4ZF 3V2WA 3MBGA 5AX0A 3AG4C 4IJJA 3ZQVA 2EPMX 3IQ6A 3DJUB 1H6GA 2P0NA 3S0XA 3DI5A 3QBKA 1M2OA 2M3GA 2G3VA 4OD5A 3QW0A 4UDVA 3C7JA 5BQIA 2H7VC 3C8GD 2LNLA 3M4BA 2PEDA 2ZIYA 4QIDA 3KJ6A 5KYUA 1LE2A 3OE6A 4K5YA 3L8JA 2R7TA 2I8BA 3M1CB 3ZC4A 3CAXA 2E87A 4DVYP 3PMRA 2A1DD 1K05A 1MMNA 3WAQA 1MGYA 1VLSA 2Y02A 3K6BA 5DQZA 3A9CA 3CODA 3NKEA 2GWWA 3FMSA 1E86A 4CSAA 4FA7B 3AYNA 2WJKA 1Q5IA 4LDEA 1E84A 3FHDA 3GWNA 2KQ9A 1LS1A 5F5FA 3H2UA 5L0HA 5G54A 3DE8A 1Q5JA 4UHRA 4P9FA 1F1MA 3AM6A 2ZD9A 2LP4A 2NUPB 5KKHA 5BUOA 2AVKA 1ZW2A 2IBFA 1FFHA 4CS8A 1H2SA 2C03A 3S90A 4XLPF 4EJ4A 4TL3A 4O79A 3V5YA 2TMVP 2R4SA 2L7AA 3G4ZA 2XM0A 2NUPA 4G7ZF 5L3QA 1T9KA 3M79A 2NPUA 4IAQA 4G72B 1PXSA 3T45A 4OIPF 1UAZA 1BM1A 3QMKA 1JOGA 2PNOA 3GM1A 3NRHA 5CI8A 1Q0GA 2P1AA 2EPKX 3DWWA 3GEIA 3QBIA 5G36A 3S8GB 1NG1A 4OIRF 3K1IA 3EG9B 2AWYA 2FFHA 3VVKA 4MTFA 3HNKA 5E33A 4J7YA 2MWQA 4D4NA 5A6AA 3AYMA 4G78A 3I5PA 5DQTA 4EKWA 3KL4A 2LFFA 3Q6NA 1YA9A 5L0DA 4G70B 5C1MA 2XLHA 1H9GA 3W2VA 4DOZA 4PJNA 1OR2A 1KTMA 4X1HA 1OR3A 5AC5A 3VW7A 4BEMJ 5GPGB 2CCYA 2UUHA 2L81A 4XTNA 4AX2A 5KYXB 3L34A 3ITFA 3HTKC 1LVKA 2L6XA 5COFA 5DYSA 4DKLA 1B68A 1L3PA 1Z5ZA 2Y3DA 3O39A 3L1MA 3RQGA 4EBBA 1AT9A 2A6HF 1KG8A 2X51A 4HEAJ 4GYCA 2J9UA 2LSEA 2QE9A 4IARA 3S28A 2HUJA 5L0GA 4PFPA 4DVZA 4PFOA 2R03A 1Z6AA 3LLIA 4O6NA 1O3UA 3RFMA 2G87A 1PV3A 1CWQA 3C63A 2I15A 3SNHA 3TJ5A 5BR2A 3PDSA 2YLDA 1OCCC 3NMIA 3K66A 2QPDB 3KYIA 1QKOA 4JCHA 4N4YB 2J9VA 3US6A 3ZTZA 1VYIA 2YCXA 4JQ6A 1EQ1A 3UTWA 5BQGA 4CIHA 1EA8A 2YKZA 3JSZA 5AHZA 4XPWA 5L3VA 1JV6A 5AGFA 3Q6MA 4JJFA 256BA 1IXFA 2R7VA 4FESA 1LIHA 1Z23A 1SYQA 2NG1A 4RDAA 3T9OA 4QI2A 4G71B 2Y3HA 3NMJA 3DKAA 2HFIA 1P8IA 1LKXA 1SMYF 4U5CE 1NFNA 1YJGA 5AC4A 2Y69C 4JCZA 3RQFA 4BG0A 2PX3A 3QTHA 4PK4A 1VTMP 3ZTMA 5B6XA 4DXWA 1M0KA 4RBNA 1XMEB 4YL1A 2YDVA 2EINC 1AEPA 2YVKA 3P0GA 4GRVA 5B0WA 2R7WA 2CYDA 1DOVA 1VGOA 2A0BA 1TN5A 2HJ3A 3EZIA 2I20A 4ZLCA 4EBKA 2HV6A 2XRHA 4YJWA 5JRAA 1ZW3A 4BJTA 2YRFA 3FOPA 1P8UA 1E85A 3EH5B 4XTLA 1AVOB 5JLIA 4U5GA 3ZQYA 1BRDA 1KGBA 2RD9A 5B34A 3IHUA 2L6FA 5H2PA 3AOUA 3TQOA 1G8XA 4HYXA 3ZVRA 2A68F 4DRIB 3VG9A 4EWCA 3TOLA 2YL0A 3W2WA 4CDAA 5B6ZA 2Q9BA 2YHSA 3IQ5A 2NUTA 1NZEA 3FOOA 4QRYA 3T6GB 4JC7A 1VB5A 4K0DA 2IM8A 2OQMA 5A45A 4AE4B 2EIKC 4GQHA 2BE5F 1YZAA 4NCQA 3ODUA 1RKCA 3U3FA 4LACB 2XS1A 2Y04A 2NSFA 1ORSC 1YAUO 4YWQA 5DS5A 2KK1A 3JYHA 4XTOA 4H54A 2OJQA 2R7XA 1EKYA 2OKUA 2JD3A 3LJBA 4W8PA 3EH3B 1FAPB 1F4ZA 3CZ6A 4MVQA 4Z9IA 1OXBA 3ZWIA 2EI4A 4CS9C 5JP7A 1S8LA 4JTCB 1UCQA 3TK0A 3OE0A 2PBEA 3UG9A 1SF8A 5JUAA 4BEZA 2NTUA 1D0XA 1C17M 1Z3IX 2AP3A 4MW3A 5B6VA 3U8VA 2H8AA 4HFFB 4I3MA 3E70C 4LDOA 1V55C 3VM6A 1H68A 3RZEA 2IXNA 3WQJA 2OG2A 3RH3A 4PJJA 4EHPA 3GEHA 3UTXA 2PF4E 2OEVA 3ABWA 1S53A 3CQZA 4PJLA 1GUEA 3NYLA 1T6IA 2YLIA 3TD7A 2KSAA 1C8RA 1TFOB 2HV7A 5F28E 1YA7O 4NQFA 2R7OA 1CPRA 3EGDB 5L0CA 1K40A 2VCAA 1ZZPA 3EZHA 1WWPA 1VOMA 1ORJA 3LEVA 3ZIBA 1TR2A 1ZU5A 3UZAA 2I21A 4BEJA 3QJRB 2Q7RA 4Y9HA 2UUIA 3V5XA 3QAPA 3JRTA 3COCA 3NYAA 2H7BA 3IQTA 4YL0A 4NY3A 1R2NA 4OINF 4N6CA 1XZPA 2J9BA 3JYYA 1TN0A 2W9YA 1QHJA 1U19A 2XS8A 1S7ZA 2O9XA 4B6IA 3ABLC 1OXKA 1VK5A 2NSGA 4ULVA 3W4YA 1QZXA 5CI9A 1TFKB 2Q9CA 4JEAA 2YEVA 3U2LA 3QAKA 4C3BA 2QY9A 4EA3A 1Q0KA 4IB4A 1XJIA 3L8IA 4E18A 4CJOA 3RVYA 2YQYA 3ECSA 4HFKB 3ZEVA 3VGAA 1BRXA 4Z9JA 2JAFA 3U0CA 3NMKA 3JT1A 1LPEA 3S27A 1QM8A 5AWZA 2VH3A 2CNWD 1BR1A 2P61A 3UZCA 1QSPA 1D0ZA 3AQBA 3G50A 1BRRA 1CGOA 5EK0A 4U5FE 3SZRA 2I35A 2WVQA 2GDCA 5BQHA 3SN6R 3LLKA 3Q7GA 3B0VC 3MBVA 1L9HA 4K1OA 1YARO 4MS2A 2P7VA 2Z73A 5FJGA 2CGEA 3S29A 1KG9A 1T5OA 2EPLX 3EH1A 4G7RB 3CSKA 2PX0A 2WVNA 1VMAA 4C3EA 4DBQA 2JX0A 1U0BB 4P6IC 5K0IA 3U8PA 1L7CA 1G4WR 2XL4A 4N6HA 4MD1A 3K1IC 1M0LA 2KYHA 3AGUA 4MD2A 4C3DA 2A0UA 4L35A 4X32A 4MTOA 2J45A 3UNGC 4CDYA 3GORA 2EIJC 3HLZA 1GM5A 2KSYA 5G2CA 3U3BA 1LI5A 4FAPB 2NUTB 3C8ZA 4X31A 1IW6A 2AT9A 4ONSA 4LLEA 2J7PA 3I5QA 2HZ8A 3PXOA 2NTWA 4OD4A 1PY6A 1KU2A 1J8MF 3VF0A 4G7OF 1UFBA 3HAQA 2Z15A 1Z7Qc 1RKEB 5G28A 2J9WA 1H7IA 1WTYA 3DM5A 3C18A 3EHNA 2LD6A 2OCCC 4YL3A 3R7CA 3MX3A 4G7HF 2PP4A 3ATPA 2HKVA 1PD0A 1V54C 5CIVA 4WW3A 4E7ZA 3VHZA 4BWBA 1NLXA 2R02A 4JVSA 5H2OA 2EPOA 4XT3A 4JURI 4XWJA 4Z9HA 5DS6A 4BPMA 2EPNA 3O6XA 4XTKA 2IYLD 3HNLA 3MLGA 1M2VA 1RMVA 3A11A 3NY8A 5T3WA 1S51A 4PXKA 5KYUB 4QI1A 3X3CA 3NYMA 4EBJA 5J7AA 1YVIA 3JCUQ 3SEOA 4G7SB 1QKRA 4PJMA 2FGYA 4FBZA 3C9LA 3DDLA 1A7DA 1M57C 4JJGA 2YCWA 1OW6A 2XLOA 4HWLA 5JS5A 5B1AC 1OW7A 3X2QC 3ZG1A 4A4AA 1OW8A 1JV7A 3S3BB 1C8SA 2R7UA 4KNWA 3LAYA 2DI3A 2QLAA 3LUTB 1LS4A 3S8FB 1HW1A 3HARA 2XLMA 5E3AA 1GQAA 2VCBA 2A6EF 3S3CB 3SXMA 2ZXRA 1Q0FA 1TWCA 2PFDA 3DQBA 4KBLA 2DYSC 3CEXA 3SXZA 3ASOC 1MMGA 5BR5A 1E83A 2Z55A 3LNRA 3UTVA 2Q3TA 4CS7A 3HJCA 1DOWA 1WGWA 1E0PA 2WL8A 2F95A 4WJ0A 4YT4A 3RF3A 2G62A 3U9MA 4XQ1A 3QJVB 4GP5B 2M64A 4X0RA 4ZLDA 3QJUB 1ST6A 1J8YF 2A69F 1LE4A 4QI0A 5ETZA 3POVA 2XL8A 1JPJA 2BC5A 1I5NA 1PD1A 1SR2A 4BEYA 2P6VA 3UONA 4H4KC 2W4MA 3W8HA 3S3DB 3U2MA 4CIPA 3REYA 3OE9A 2IXMA 4U5EE 2WB7A 2WJLA 2WZFA 3B9QA 1MMDA 3G4XA 2YL1A 2AWCA 1A7VA 2CDQA 3B29A 1K04A 5AX1A 1M6TA 3S9OA 4DS7E 4I1OB 3T4RA 2WVOA 3KKBA 1R4TA 1TWHA 1ZVZA 4JRZA 2R7RA 3T6BA 2C04A 5H2NA 1N1CA 4A4MA 1MQVA 5KYYB 3RW0A 4O7GA 1G4US 2HS5A 5IY5C 4MQTA 5B6WA 1AUEA 2H7OA 2QPEB 2Y3GA 4E7SA 1X0K1 5ITCA 1X0I1 1TWAA 3EFOA 3AG2C 1XZQA 2XXAB 2DGJA 4BJ1A 4ULWA 4AMJA 1WASA 5KYWA 3HAPA 4MQ9F 4C7OB 2B0HA 3DXJF 1FNTc 1F50A 1QLEC 5G53A 2V3CC 2Y3BA 3EH2A 2ZXWC 4DBRA 3DAFA 3B0PA 3X1OA 2YCYA 1U89A 4DAJA 3IPMO 4MVMA 4BJ5A 4LDKA 1V74B 5FCLA 2D4UA 5G2AA 2LIGA 4CX9A 2M4EA 2KS9A 3RVZA 3SXYA 1O0AA
chains in the Genus database with same CATH topology
4GP8B 2Y01A 4ULVA 2VT4A 4CDVA 4GP4B 4D4XA 3EMLA 3QBIA 1L0MA 4UG2A 4JEAA 5G36A 3S8GB 1R84A 1PXRA 4GPOA 3QAKA 4EA3A 4GBRA 4IB4A 1XJIA 3VVKA 5LWEA 4CJOA 4EIYA 3QBGA 1EHKB 2R4RA 3HNKA 1IW9A 1KMEA 3ZEVA 4D4NA 3AYMA 5H2IA 3VGAA 1BRXA 1F88A 2JAFA 4L6RA 3NMKA 1XIOA 5A44A 4G70B 5C1MA 2XLHA 2J4YA 1QM8A 1M0MA 5AWZA 3M15A 4PXFA 4X1HA 5AHYA 3UZCA 3VW7A 1BRRA 1CGOA 2I35A 2CCYA 4XTNA 3SN6R 3MBVA 1L9HA 2L6XA 4WAVA 2Z73A 5DYSA 5FJGA 4DKLA 1S54A 1KG9A 1YZCA 5ITEA 4G7RB 4XT1A 1JFPA 1FBBA 5B6YA 3L1MA 2YDOA 1VJMA 1RCPA 4G7QB 3CAPA 1AT9A 2XLWA 1KG8A 2Y03A 4GYCA 3VRCA 3U8PA 4IARA 4N6HA 4MD1A 5JSLA 1M0LA 3C9MA 1E12A 4MQSA 3RFMA 2G87A 2XLVA 1CWQA 2XL6A 3C63A 5EN0A 4MD2A 1YYXA 5BR2A 4NC3A 4U9EA 3PDSA 4L35A 4X32A 2YLDA 3HASA 3NMIA 5JJEA 2QPDB 1QKOA 4CDYA 4N4YB 5A8EA 3ZTZA 5TGZA 2KSYA 5G2CA 2YCXA 4JQ6A 3A7KA 3UTWA 5JJNA 4X31A 1IW6A 2AT9A 2YKZA 5AHZA 1S52A 4WGZA 5H2JA 4HYJA 5H2MA 5DHHA 1JV6A 5AGFA 3PXOA 4KNFA 256BA 3HNIA 2NTWA 1IXFA 5H2KA 1QKPA 1PY6A 4G71B 3NMJA 2X72A 1GZMA 4OV0A 2ZFEA 3HAQA 1P8IA 4KLYA 5G28A 1JGJA 1AP9A 2YL7A 3PQRA 3C62A 3DE9A 2F93A 1LM3B 3HANA 3NS0A 3ZTMA 5B6XA 5B2NA 3NY9A 1M0KA 1S8JA 1JAFA 3TOMA 1XMEB 3QJTB 1YYJA 4WW3A 3VHZA 4BWBA 2YDVA 3ZPQA 2J8WA 3P0GA 4WGYA 5H2OA 4GRVA 5B0WA 3OAXA 3PWHA 4XT3A 2YLGA 3QVYA 3D4SA 1VGOA 2BRDA 3HNLA 1TN5A 3QJSB 1C3WA 2JAGA 1S05A 5G2DA 2I20A 5JRAA 3NY8A 4DJHA 4FPDA 1S51A 3FOPA 1P8UA 4PXKA 1E85A 2XLEA 4QI1A 3EH5B 2ZZLA 4XTLA 5JLIA 3X3CA 3ZQYA 1BRDA 1KGBA 3V2YA 4JR8A 5B34A 5J7AA 3X3BA 4G7SB 3ZPRA 5H2PA 2Y00A 4BUOA 4FBZA 4BVNA 2YL3A 3C9LA 3DDLA 4BV0A 4HYXA 2YCWA 2HPYA 3VI0A 2RH1A 2XLOA 4AMIA 5JT4A 3VG9A 3TOLA 3QJQB 4HWLA 2YL0A 5B3IA 5JS5A 1P8HA 4U9DA 4CDAA 5B6ZA 2XM4A 3IQ5A 1CPQA 3FOOA 4QRYA 3QBLA 1BBHA 1QQ3A 2KSBA 1JV7A 5A45A 3S3BB 1C8SA 2QLAA 3PBLA 4LDLA 3S8FB 1YZAA 3ODUA 1LN6A 5F8UA 3HARA 2Y04A 5H2HA 2XLMA 1GQAA 5DHGA 1QPUA 3OE8A 3S3CB 3EH4B 1GU8A 3QW1A 3DQBA 4XTOA 1CGNA 1EKYA 5BR5A 1E83A 2Z55A 3EH3B 3UTYA 4CJGA 3UTVA 1F4ZA 3V2WA 5AX0A 3HAOA 1E0PA 2F95A 3HNJA 3ZQVA 3ZWIA 3IQ6A 1FBKA 2YCZA 3QJVB 4GP5B 2EI4A 1DZEA 4MBSA 4N4WA 5JP7A 1S8LA 3QBKA 1UCQA 3QJUB 2M3GA 3OE0A 3QW0A 5ETZA 3UG9A 5H2LA 2XL8A 5JUAA 4BEZA 2BC5A 2NTUA 4BEYA 2LNLA 3M4BA 4QIDA 2PEDA 2ZIYA 3UONA 3KJ6A 3NSBA 3S3DB 3OE6A 5B6VA 4K5YA 4CIPA 3REYA 3OE9A 4LDOA 2WJLA 1H68A 3RZEA 3WQJA 2YL1A 1X0SA 1A7VA 3QDCA 3UTXA 5AX1A 3ABWA 1S53A 1M6TA 1MGYA 4DS7E 2Y02A 3CODA 1GUEA 5JVEA 2YLIA 1E86A 5H2NA 2KSAA 1C8RA 4JE9A 4FA7B 3AYNA 2WJKA 1Q5IA 4LDEA 4A4MA 1MQVA 1E84A 4XXJA 1NBBA 1CPRA 2I1XA 5G54A 4MQTA 5B6WA 3DE8A 5B35A 1Q5JA 2QPEB 4UHRA 3M4CA 3AM6A 1X0K1 5ITCA 1X0I1 5AZDA 3UZAA 5KKHA 2I21A 3QJRB 5JJJA 4Y9HA 4JKVA 1H2SA 4AMJA 3QAPA 3HAPA 4JEBA 3COCA 3NYAA 4EJ4A 4TL3A 1APCA 2R4SA 1F50A 1HZXA 2XM0A 3BVDB 5G53A 1R2NA 3M79A 3QVZA 2YCYA 2J9BA 4FAAB 4IAQA 4G72B 1PXSA 4DAJA 4ER9A 3T45A 4J4QA 1UAZA 1BM1A 1TN0A 5G2AA 1QHJA 2XLDA 1U19A 4CX9A 2KS9A 1O0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GP8 B;  2Y01 A;  4ULV A;  2VT4 A;  4CDV A;  4GP4 B;  4D4X A;  3EML A;  3QBI A;  1L0M A;  4UG2 A;  4JEA A;  5G36 A;  3S8G B;  1R84 A;  1PXR A;  4GPO A;  3QAK A;  4EA3 A;  4GBR A;  4IB4 A;  1XJI A;  3VVK A;  5LWE A;  4CJO A;  4EIY A;  3QBG A;  1EHK B;  2R4R A;  3HNK A;  1IW9 A;  1KME A;  3ZEV A;  4D4N A;  3AYM A;  5H2I A;  3VGA A;  1BRX A;  1F88 A;  2JAF A;  4L6R A;  3NMK A;  1XIO A;  5A44 A;  4G70 B;  5C1M A;  2XLH A;  2J4Y A;  1QM8 A;  1M0M A;  5AWZ A;  3M15 A;  4PXF A;  4X1H A;  5AHY A;  3UZC A;  3VW7 A;  1BRR A;  1CGO A;  2I35 A;  2CCY A;  4XTN A;  3SN6 R;  3MBV A;  1L9H A;  2L6X A;  4WAV A;  2Z73 A;  5DYS A;  5FJG A;  4DKL A;  1S54 A;  1KG9 A;  1YZC A;  5ITE A;  4G7R B;  4XT1 A;  1JFP A;  1FBB A;  5B6Y A;  3L1M A;  2YDO A;  1VJM A;  1RCP A;  4G7Q B;  3CAP A;  1AT9 A;  2XLW A;  1KG8 A;  2Y03 A;  4GYC A;  3VRC A;  3U8P A;  4IAR A;  4N6H A;  4MD1 A;  5JSL A;  1M0L A;  3C9M A;  1E12 A;  4MQS A;  3RFM A;  2G87 A;  2XLV A;  1CWQ A;  2XL6 A;  3C63 A;  5EN0 A;  4MD2 A;  1YYX A;  5BR2 A;  4NC3 A;  4U9E A;  3PDS A;  4L35 A;  4X32 A;  2YLD A;  3HAS A;  3NMI A;  5JJE A;  2QPD B;  1QKO A;  4CDY A;  4N4Y B;  5A8E A;  3ZTZ A;  5TGZ A;  2KSY A;  5G2C A;  2YCX A;  4JQ6 A;  3A7K A;  3UTW A;  5JJN A;  4X31 A;  1IW6 A;  2AT9 A;  2YKZ A;  5AHZ A;  1S52 A;  4WGZ A;  5H2J A;  4HYJ A;  5H2M A;  5DHH A;  1JV6 A;  5AGF A;  3PXO A;  4KNF A;  256B A;  3HNI A;  2NTW A;  1IXF A;  5H2K A;  1QKP A;  1PY6 A;  4G71 B;  3NMJ A;  2X72 A;  1GZM A;  4OV0 A;  2ZFE A;  3HAQ A;  1P8I A;  4KLY A;  5G28 A;  1JGJ A;  1AP9 A;  2YL7 A;  3PQR A;  3C62 A;  3DE9 A;  2F93 A;  1LM3 B;  3HAN A;  3NS0 A;  3ZTM A;  5B6X A;  5B2N A;  3NY9 A;  1M0K A;  1S8J A;  1JAF A;  3TOM A;  1XME B;  3QJT B;  1YYJ A;  4WW3 A;  3VHZ A;  4BWB A;  2YDV A;  3ZPQ A;  2J8W A;  3P0G A;  4WGY A;  5H2O A;  4GRV A;  5B0W A;  3OAX A;  3PWH A;  4XT3 A;  2YLG A;  3QVY A;  3D4S A;  1VGO A;  2BRD A;  3HNL A;  1TN5 A;  3QJS B;  1C3W A;  2JAG A;  1S05 A;  5G2D A;  2I20 A;  5JRA A;  3NY8 A;  4DJH A;  4FPD A;  1S51 A;  3FOP A;  1P8U A;  4PXK A;  1E85 A;  2XLE A;  4QI1 A;  3EH5 B;  2ZZL A;  4XTL A;  5JLI A;  3X3C A;  3ZQY A;  1BRD A;  1KGB A;  3V2Y A;  4JR8 A;  5B34 A;  5J7A A;  3X3B A;  4G7S B;  3ZPR A;  5H2P A;  2Y00 A;  4BUO A;  4FBZ A;  4BVN A;  2YL3 A;  3C9L A;  3DDL A;  4BV0 A;  4HYX A;  2YCW A;  2HPY A;  3VI0 A;  2RH1 A;  2XLO A;  4AMI A;  5JT4 A;  3VG9 A;  3TOL A;  3QJQ B;  4HWL A;  2YL0 A;  5B3I A;  5JS5 A;  1P8H A;  4U9D A;  4CDA A;  5B6Z A;  2XM4 A;  3IQ5 A;  1CPQ A;  3FOO A;  4QRY A;  3QBL A;  1BBH A;  1QQ3 A;  2KSB A;  1JV7 A;  5A45 A;  3S3B B;  1C8S A;  2QLA A;  3PBL A;  4LDL A;  3S8F B;  1YZA A;  3ODU A;  1LN6 A;  5F8U A;  3HAR A;  2Y04 A;  5H2H A;  2XLM A;  1GQA A;  5DHG A;  1QPU A;  3OE8 A;  3S3C B;  3EH4 B;  1GU8 A;  3QW1 A;  3DQB A;  4XTO A;  1CGN A;  1EKY A;  5BR5 A;  1E83 A;  2Z55 A;  3EH3 B;  3UTY A;  4CJG A;  3UTV A;  1F4Z A;  3V2W A;  5AX0 A;  3HAO A;  1E0P A;  2F95 A;  3HNJ A;  3ZQV A;  3ZWI A;  3IQ6 A;  1FBK A;  2YCZ A;  3QJV B;  4GP5 B;  2EI4 A;  1DZE A;  4MBS A;  4N4W A;  5JP7 A;  1S8L A;  3QBK A;  1UCQ A;  3QJU B;  2M3G A;  3OE0 A;  3QW0 A;  5ETZ A;  3UG9 A;  5H2L A;  2XL8 A;  5JUA A;  4BEZ A;  2BC5 A;  2NTU A;  4BEY A;  2LNL A;  3M4B A;  4QID A;  2PED A;  2ZIY A;  3UON A;  3KJ6 A;  3NSB A;  3S3D B;  3OE6 A;  5B6V A;  4K5Y A;  4CIP A;  3REY A;  3OE9 A;  4LDO A;  2WJL A;  1H68 A;  3RZE A;  3WQJ A;  2YL1 A;  1X0S A;  1A7V A;  3QDC A;  3UTX A;  5AX1 A;  3ABW A;  1S53 A;  1M6T A;  1MGY A;  2Y02 A;  3COD A;  1GUE A;  5JVE A;  2YLI A;  1E86 A;  5H2N A;  2KSA A;  1C8R A;  4JE9 A;  4FA7 B;  3AYN A;  2WJK A;  1Q5I A;  4LDE A;  4A4M A;  1MQV A;  1E84 A;  4XXJ A;  1NBB A;  1CPR A;  2I1X A;  5G54 A;  4MQT A;  5B6W A;  3DE8 A;  5B35 A;  1Q5J A;  2QPE B;  4UHR A;  3M4C A;  3AM6 A;  1X0K 1;  5ITC A;  1X0I 1;  5AZD A;  3UZA A;  5KKH A;  2I21 A;  3QJR B;  5JJJ A;  4Y9H A;  4JKV A;  1H2S A;  4AMJ A;  3QAP A;  3HAP A;  4JEB A;  3COC A;  3NYA A;  4EJ4 A;  4TL3 A;  1APC A;  2R4S A;  1F50 A;  1HZX A;  2XM0 A;  3BVD B;  5G53 A;  1R2N A;  3M79 A;  3QVZ A;  2YCY A;  2J9B A;  4FAA B;  4IAQ A;  4G72 B;  1PXS A;  4DAJ A;  4ER9 A;  3T45 A;  4J4Q A;  1UAZ A;  1BM1 A;  1TN0 A;  5G2A A;  1QHJ A;  2XLD A;  1U19 A;  4CX9 A;  2KS9 A;  1O0A A; 
#chains in the Genus database with same CATH topology
 5DVW A;  2Y01 A;  1C03 A;  5FZT A;  1Q0D A;  2VT4 A;  4F4B A;  3V5Z A;  4AK9 A;  5DS4 A;  5L0I A;  4GP4 B;  3N0T A;  4D4X A;  5HV9 A;  3U9J A;  4KI2 A;  3RFY A;  2DB4 A;  1O5H A;  1NU7 D;  4M63 A;  2W45 A;  1H9T A;  3QBG A;  4J30 B;  1EHK B;  4MW8 A;  1IW9 A;  3ABK C;  5H2I A;  3E9V A;  2GA0 A;  4WAB A;  3FAP B;  1F88 A;  4PAC A;  1OQC A;  4L6R A;  5A44 A;  4BJ5 C;  3I4U A;  1U6H A;  3GM2 A;  4MVZ A;  4I44 A;  2Q00 A;  5A69 A;  2OU6 A;  3DZA A;  2L9J A;  4MTG A;  4JW1 A;  2ZXP A;  4QDL A;  3S84 A;  4CBE A;  1TKN A;  3DAG A;  4YN0 B;  4K7B A;  3NKD A;  1ZHT A;  2F22 A;  1JFP A;  1FBB A;  1ZHY A;  1VJM A;  1RCP A;  4YT2 A;  4G7Q B;  2VB6 A;  3K7D A;  2Y03 A;  2HSQ A;  4AL0 A;  3FVY A;  4XEV A;  3L0I A;  3DMD A;  5EN0 A;  1YYX A;  3HAS A;  3LES A;  3JSE O;  3VAY A;  1IZM A;  5TGZ A;  3Q7L A;  5KYW B;  3B71 A;  3A7K A;  1HMO A;  1HY5 A;  3EGX A;  5JJN A;  1VYK A;  2XXA A;  5L0F A;  1S52 A;  4WGZ A;  5H2J A;  1FFT C;  5H2M A;  5DHH A;  1I4Z A;  4A2N B;  5EHH A;  3HNI A;  1QKP A;  4KC9 A;  2ETS A;  1GGQ A;  3EFO B;  3W8I A;  2QNL A;  1GZM A;  3OWT A;  4OV0 A;  4JZA A;  3UGO A;  3BRJ A;  4Q5S F;  3OEO A;  1JGJ A;  2LFD A;  2V26 A;  2QTV A;  1Q0M A;  3O55 A;  4C7O A;  2YL7 A;  3PQR A;  3C62 A;  4ANJ A;  4LLC A;  2F93 A;  5A6K A;  2Y39 A;  1T6Q A;  3AQC A;  4KNV A;  1JAF A;  3TOM A;  1FR0 A;  3ZPQ A;  3T6J A;  2J8W A;  1OCO C;  4U5H A;  3GEE A;  4WGY A;  5HSW A;  2BL2 A;  3OAX A;  3PWH A;  3EJN A;  3RIP A;  2YLG A;  3ASN C;  3QVY A;  3GWL A;  2R7S A;  3D4S A;  1YLM A;  3QJS B;  3TUL A;  4MND A;  1C3W A;  2JAG A;  2KW3 C;  4U5B E;  3AGT A;  4GYT A;  3K1H A;  3V7O A;  4DJH A;  3ZSU A;  4FPD A;  2XLE A;  3LEO A;  1V4A A;  2Q9A A;  3V2Y A;  4JR8 A;  5E3C A;  3KMI A;  1NFO A;  3ZPR A;  4MVU A;  3F47 A;  1LI7 A;  2YL3 A;  3IQC A;  1M2V B;  3F46 A;  2KJG A;  2VCC A;  4DRJ B;  2RSE B;  1I4Y A;  2RH1 A;  4AMI A;  3QJQ B;  4MVS A;  5B3I A;  4U9D A;  2XM4 A;  3C8G B;  1CPQ A;  4FWV A;  4LDR A;  3QBL A;  1ZHZ A;  2OEX A;  2LK4 A;  2KSB A;  2IOQ A;  4W8K A;  3LNM B;  3SXK A;  3PBL A;  1VLT A;  3DJN B;  4JIO A;  5F8U A;  2WZG A;  1YDI A;  1OKK D;  1T6U A;  3MFN A;  4E17 A;  4DRH B;  4E0I A;  4J32 B;  4XPY A;  3PCV A;  1CGN A;  1XWJ A;  4PR9 A;  2FAP B;  1ZHW A;  3UTY A;  1RJ9 B;  3UR3 C;  3HAO A;  3IEE A;  2EIL C;  3WHN A;  1T01 A;  3HNJ A;  2VC9 A;  3J06 A;  1FBK A;  4CSA C;  1R5I D;  2YCZ A;  5EGY A;  2L6H A;  3ABM C;  2JPU A;  4N4W A;  1DZE A;  5COM A;  4MBS A;  3LS0 A;  3BEH A;  3FXH A;  3KH2 A;  2B0J A;  1A0B A;  1FMW A;  5H2L A;  1RXQ A;  2KGO A;  3NSB A;  5B3S C;  2GAQ A;  1JPN A;  4DJ9 A;  1EI7 A;  1RKE A;  4CS9 A;  2DYR C;  5D91 A;  1D1C A;  4G0H A;  1X0S A;  2J0X A;  3QDC A;  2J7P D;  3AG1 C;  4BJ6 A;  5E2Q A;  3VYW A;  5DLJ A;  5JVE A;  3AG3 C;  4JTA B;  4JE9 A;  4YT8 A;  3K33 A;  3UMH A;  4XXJ A;  1FMV A;  1NBB A;  5A6J A;  2I1X A;  1HMD A;  4NTB A;  3SYN A;  4U5D E;  3B0U X;  2G3K A;  1JMW A;  5B35 A;  4JTD B;  3M4C A;  3UMK A;  4OIQ F;  1MNE A;  1ZU4 A;  5AZD A;  1D1B A;  3MYI A;  5KYY A;  5JJJ A;  4HE8 D;  3UMI A;  4JKV A;  2L6G A;  3U5S A;  3LS1 A;  1M56 C;  3KYJ A;  4JEB A;  4CS8 C;  1APC A;  5B1B C;  4NTA A;  3RQE A;  2D5R B;  4IAO A;  1HZX A;  2XSE A;  3FDQ A;  3BVD B;  2YZS A;  3KPH A;  3N2Z B;  3QVZ A;  4FAA B;  1MND A;  4ER9 A;  1G5Z A;  4J4Q A;  2ZXO A;  2XLD A;  1KNY A;  4YT5 A;  4GP8 B;  4CDV A;  1TWG A;  1Z63 A;  3NDB B;  3EML A;  1L0M A;  1OKK A;  4UG2 A;  3O10 A;  1R84 A;  1PXR A;  4GPO A;  1NSG B;  4GBR A;  1WAT A;  5LWE A;  4EIY A;  4O6Y A;  5L0J A;  2R4R A;  1KME A;  2LQG A;  5COG A;  4P9T A;  2CW0 F;  3JZ0 A;  2R7Q A;  4IGG A;  1SZI A;  4BJ6 C;  1XIO A;  1HE9 A;  1QVX A;  4NTF A;  4AL1 A;  3EGX B;  1CGM E;  2J4Y A;  3GOD A;  2KSF A;  1M0M A;  4R32 A;  2X0C A;  3M15 A;  4PXF A;  3NG1 A;  5AHY A;  2EIM C;  2HMZ A;  1TQG A;  3GM3 A;  4YK5 A;  2HMQ A;  3DD7 A;  4WAV A;  1BDJ B;  1D1A A;  1S54 A;  4N06 A;  3PHF 2;  1YZC A;  3RKO F;  5ITE A;  3GAN A;  3HKK A;  4IWB A;  4XT1 A;  5B6Y A;  1IW7 F;  4RD9 A;  3JRM O;  5KYN A;  2YDO A;  3H65 A;  3CAP A;  1NU9 C;  3JTL O;  3R2P A;  5KYX A;  2XLW A;  1E2X A;  1RJ9 A;  3VRC A;  2R25 A;  3AJM A;  4J7T A;  5JSL A;  3FAJ A;  3C9M A;  1E12 A;  4MQS A;  1ORY A;  2XLV A;  3EGD A;  2XL6 A;  1BZ4 A;  4I1M A;  3EHM A;  4NC3 A;  4XPX A;  4U9E A;  2HSB A;  2KC3 A;  2MHR A;  5JJE A;  1FTS A;  1BR2 A;  4Q7C A;  1HW2 A;  5A8E A;  3ZDL A;  1JRA A;  4XEK A;  5D92 A;  3WG7 C;  3C8G A;  2AU5 A;  1HE1 A;  4LER A;  4E0H A;  2LCH A;  5T1D B;  1GS9 A;  2J46 A;  4HYJ A;  1MMA A;  4KNF A;  3EG9 A;  5H2K A;  4MVO A;  3UGP A;  4O6M A;  1Y6D A;  2X72 A;  4EUK B;  5F5H A;  2ZFE A;  3EPV A;  4AE4 A;  2ZPA A;  4KLY A;  2QUP A;  3H2V A;  2MYS A;  1AP9 A;  2CNW A;  1UG7 A;  1A7E A;  3DE9 A;  1WN0 A;  1LM3 B;  5T3T A;  3HAN A;  3NS0 A;  1PCX A;  2R9R B;  5B2N A;  3NY9 A;  1S8J A;  3QJT B;  2KNH A;  3SP1 A;  1YYJ A;  2IXO A;  2VAS A;  1BR4 A;  5A6B A;  3QZC A;  3OA1 A;  4MVR A;  2W4B A;  2BRD A;  1WOL A;  4OIO F;  2IXP A;  2ICW G;  3N24 A;  4LDQ A;  1S05 A;  5G2D A;  5TJ5 E;  3EQL F;  3RYL A;  2ZZL A;  3TJ6 A;  2GFH A;  2YWA A;  2OOC A;  5A6B D;  3X3B A;  1W2W A;  2HJM A;  4BUO A;  2Y00 A;  3WOD F;  4BVN A;  2OJE D;  2J0W A;  2Q4F A;  4BV0 A;  2R05 A;  2HPY A;  3VI0 A;  4XLN F;  5JT4 A;  1P8H A;  2ASR A;  1ZHX A;  1OCZ C;  1O87 A;  1BBH A;  4XEF A;  1QQ3 A;  2WZL A;  1Y4C A;  3DM9 B;  4IRU A;  4LDL A;  3NYJ A;  1LN6 A;  5H2H A;  4GEH A;  1OCR C;  5DHG A;  1QPU A;  3OE8 A;  3EH4 B;  1GU8 A;  3QW1 A;  1JR8 A;  3MYF A;  1A41 A;  1D0Y A;  4FX5 A;  1C02 A;  1ZYR F;  4CJG A;  3PDM P;  4Q4Z F;  3V2W A;  3MBG A;  5AX0 A;  3AG4 C;  4IJJ A;  3ZQV A;  2EPM X;  3IQ6 A;  3DJU B;  1H6G A;  2P0N A;  3S0X A;  3DI5 A;  3QBK A;  1M2O A;  2M3G A;  2G3V A;  4OD5 A;  3QW0 A;  4UDV A;  3C7J A;  5BQI A;  2H7V C;  3C8G D;  2LNL A;  3M4B A;  2PED A;  2ZIY A;  4QID A;  3KJ6 A;  5KYU A;  1LE2 A;  3OE6 A;  4K5Y A;  3L8J A;  2R7T A;  2I8B A;  3M1C B;  3ZC4 A;  3CAX A;  2E87 A;  4DVY P;  3PMR A;  2A1D D;  1K05 A;  1MMN A;  3WAQ A;  1MGY A;  1VLS A;  2Y02 A;  3K6B A;  5DQZ A;  3A9C A;  3COD A;  3NKE A;  2GWW A;  3FMS A;  1E86 A;  4CSA A;  4FA7 B;  3AYN A;  2WJK A;  1Q5I A;  4LDE A;  1E84 A;  3FHD A;  3GWN A;  2KQ9 A;  1LS1 A;  5F5F A;  3H2U A;  5L0H A;  5G54 A;  3DE8 A;  1Q5J A;  4UHR A;  4P9F A;  1F1M A;  3AM6 A;  2ZD9 A;  2LP4 A;  2NUP B;  5KKH A;  5BUO A;  2AVK A;  1ZW2 A;  2IBF A;  1FFH A;  4CS8 A;  1H2S A;  2C03 A;  3S90 A;  4XLP F;  4EJ4 A;  4TL3 A;  4O79 A;  3V5Y A;  2TMV P;  2R4S A;  2L7A A;  3G4Z A;  2XM0 A;  2NUP A;  4G7Z F;  5L3Q A;  1T9K A;  3M79 A;  2NPU A;  4IAQ A;  4G72 B;  1PXS A;  3T45 A;  4OIP F;  1UAZ A;  1BM1 A;  3QMK A;  1JOG A;  2PNO A;  3GM1 A;  3NRH A;  5CI8 A;  1Q0G A;  2P1A A;  2EPK X;  3DWW A;  3GEI A;  3QBI A;  5G36 A;  3S8G B;  1NG1 A;  4OIR F;  3K1I A;  3EG9 B;  2AWY A;  2FFH A;  3VVK A;  4MTF A;  3HNK A;  5E33 A;  4J7Y A;  2MWQ A;  4D4N A;  5A6A A;  3AYM A;  4G78 A;  3I5P A;  5DQT A;  4EKW A;  3KL4 A;  2LFF A;  3Q6N A;  1YA9 A;  5L0D A;  4G70 B;  5C1M A;  2XLH A;  1H9G A;  3W2V A;  4DOZ A;  4PJN A;  1OR2 A;  1KTM A;  4X1H A;  1OR3 A;  5AC5 A;  3VW7 A;  4BEM J;  5GPG B;  2CCY A;  2UUH A;  2L81 A;  4XTN A;  4AX2 A;  5KYX B;  3L34 A;  3ITF A;  3HTK C;  1LVK A;  2L6X A;  5COF A;  5DYS A;  4DKL A;  1B68 A;  1L3P A;  1Z5Z A;  2Y3D A;  3O39 A;  3L1M A;  3RQG A;  4EBB A;  1AT9 A;  2A6H F;  1KG8 A;  2X51 A;  4HEA J;  4GYC A;  2J9U A;  2LSE A;  2QE9 A;  4IAR A;  3S28 A;  2HUJ A;  5L0G A;  4PFP A;  4DVZ A;  4PFO A;  2R03 A;  1Z6A A;  3LLI A;  4O6N A;  1O3U A;  3RFM A;  2G87 A;  1PV3 A;  1CWQ A;  3C63 A;  2I15 A;  3SNH A;  3TJ5 A;  5BR2 A;  3PDS A;  2YLD A;  1OCC C;  3NMI A;  3K66 A;  2QPD B;  3KYI A;  1QKO A;  4JCH A;  4N4Y B;  2J9V A;  3US6 A;  3ZTZ A;  1VYI A;  2YCX A;  4JQ6 A;  1EQ1 A;  3UTW A;  5BQG A;  4CIH A;  1EA8 A;  2YKZ A;  3JSZ A;  5AHZ A;  4XPW A;  5L3V A;  1JV6 A;  5AGF A;  3Q6M A;  4JJF A;  256B A;  1IXF A;  2R7V A;  4FES A;  1LIH A;  1Z23 A;  1SYQ A;  2NG1 A;  4RDA A;  3T9O A;  4QI2 A;  4G71 B;  2Y3H A;  3NMJ A;  3DKA A;  2HFI A;  1P8I A;  1LKX A;  1SMY F;  4U5C E;  1NFN A;  1YJG A;  5AC4 A;  2Y69 C;  4JCZ A;  3RQF A;  4BG0 A;  2PX3 A;  3QTH A;  4PK4 A;  1VTM P;  3ZTM A;  5B6X A;  4DXW A;  1M0K A;  4RBN A;  1XME B;  4YL1 A;  2YDV A;  2EIN C;  1AEP A;  2YVK A;  3P0G A;  4GRV A;  5B0W A;  2R7W A;  2CYD A;  1DOV A;  1VGO A;  2A0B A;  1TN5 A;  2HJ3 A;  3EZI A;  2I20 A;  4ZLC A;  4EBK A;  2HV6 A;  2XRH A;  4YJW A;  5JRA A;  1ZW3 A;  4BJT A;  2YRF A;  3FOP A;  1P8U A;  1E85 A;  3EH5 B;  4XTL A;  1AVO B;  5JLI A;  4U5G A;  3ZQY A;  1BRD A;  1KGB A;  2RD9 A;  5B34 A;  3IHU A;  2L6F A;  5H2P A;  3AOU A;  3TQO A;  1G8X A;  4HYX A;  3ZVR A;  2A68 F;  4DRI B;  3VG9 A;  4EWC A;  3TOL A;  2YL0 A;  3W2W A;  4CDA A;  5B6Z A;  2Q9B A;  2YHS A;  3IQ5 A;  2NUT A;  1NZE A;  3FOO A;  4QRY A;  3T6G B;  4JC7 A;  1VB5 A;  4K0D A;  2IM8 A;  2OQM A;  5A45 A;  4AE4 B;  2EIK C;  4GQH A;  2BE5 F;  1YZA A;  4NCQ A;  3ODU A;  1RKC A;  3U3F A;  4LAC B;  2XS1 A;  2Y04 A;  2NSF A;  1ORS C;  1YAU O;  4YWQ A;  5DS5 A;  2KK1 A;  3JYH A;  4XTO A;  4H54 A;  2OJQ A;  2R7X A;  1EKY A;  2OKU A;  2JD3 A;  3LJB A;  4W8P A;  3EH3 B;  1FAP B;  1F4Z A;  3CZ6 A;  4MVQ A;  4Z9I A;  1OXB A;  3ZWI A;  2EI4 A;  4CS9 C;  5JP7 A;  1S8L A;  4JTC B;  1UCQ A;  3TK0 A;  3OE0 A;  2PBE A;  3UG9 A;  1SF8 A;  5JUA A;  4BEZ A;  2NTU A;  1D0X A;  1C17 M;  1Z3I X;  2AP3 A;  4MW3 A;  5B6V A;  3U8V A;  2H8A A;  4HFF B;  4I3M A;  3E70 C;  4LDO A;  1V55 C;  3VM6 A;  1H68 A;  3RZE A;  2IXN A;  3WQJ A;  2OG2 A;  3RH3 A;  4PJJ A;  4EHP A;  3GEH A;  3UTX A;  2PF4 E;  2OEV A;  3ABW A;  1S53 A;  3CQZ A;  4PJL A;  1GUE A;  3NYL A;  1T6I A;  2YLI A;  3TD7 A;  2KSA A;  1C8R A;  1TFO B;  2HV7 A;  5F28 E;  1YA7 O;  4NQF A;  2R7O A;  1CPR A;  3EGD B;  5L0C A;  1K40 A;  2VCA A;  1ZZP A;  3EZH A;  1WWP A;  1VOM A;  1ORJ A;  3LEV A;  3ZIB A;  1TR2 A;  1ZU5 A;  3UZA A;  2I21 A;  4BEJ A;  3QJR B;  2Q7R A;  4Y9H A;  2UUI A;  3V5X A;  3QAP A;  3JRT A;  3COC A;  3NYA A;  2H7B A;  3IQT A;  4YL0 A;  4NY3 A;  1R2N A;  4OIN F;  4N6C A;  1XZP A;  2J9B A;  3JYY A;  1TN0 A;  2W9Y A;  1QHJ A;  1U19 A;  2XS8 A;  1S7Z A;  2O9X A;  4B6I A;  3ABL C;  1OXK A;  1VK5 A;  2NSG A;  4ULV A;  3W4Y A;  1QZX A;  5CI9 A;  1TFK B;  2Q9C A;  4JEA A;  2YEV A;  3U2L A;  3QAK A;  4C3B A;  2QY9 A;  4EA3 A;  1Q0K A;  4IB4 A;  1XJI A;  3L8I A;  4E18 A;  4CJO A;  3RVY A;  2YQY A;  3ECS A;  4HFK B;  3ZEV A;  3VGA A;  1BRX A;  4Z9J A;  2JAF A;  3U0C A;  3NMK A;  3JT1 A;  1LPE A;  3S27 A;  1QM8 A;  5AWZ A;  2VH3 A;  2CNW D;  1BR1 A;  2P61 A;  3UZC A;  1QSP A;  1D0Z A;  3AQB A;  3G50 A;  1BRR A;  1CGO A;  5EK0 A;  4U5F E;  3SZR A;  2I35 A;  2WVQ A;  2GDC A;  5BQH A;  3SN6 R;  3LLK A;  3Q7G A;  3B0V C;  3MBV A;  1L9H A;  4K1O A;  1YAR O;  4MS2 A;  2P7V A;  2Z73 A;  5FJG A;  2CGE A;  3S29 A;  1KG9 A;  1T5O A;  2EPL X;  3EH1 A;  4G7R B;  3CSK A;  2PX0 A;  2WVN A;  1VMA A;  4C3E A;  4DBQ A;  2JX0 A;  1U0B B;  4P6I C;  5K0I A;  3U8P A;  1L7C A;  1G4W R;  2XL4 A;  4N6H A;  4MD1 A;  3K1I C;  1M0L A;  2KYH A;  3AGU A;  4MD2 A;  4C3D A;  2A0U A;  4L35 A;  4X32 A;  4MTO A;  2J45 A;  3UNG C;  4CDY A;  3GOR A;  2EIJ C;  3HLZ A;  1GM5 A;  2KSY A;  5G2C A;  3U3B A;  1LI5 A;  4FAP B;  2NUT B;  3C8Z A;  4X31 A;  1IW6 A;  2AT9 A;  4ONS A;  4LLE A;  2J7P A;  3I5Q A;  2HZ8 A;  3PXO A;  2NTW A;  4OD4 A;  1PY6 A;  1KU2 A;  1J8M F;  3VF0 A;  4G7O F;  1UFB A;  3HAQ A;  2Z15 A;  1Z7Q c;  1RKE B;  5G28 A;  2J9W A;  1H7I A;  1WTY A;  3DM5 A;  3C18 A;  3EHN A;  2LD6 A;  2OCC C;  4YL3 A;  3R7C A;  3MX3 A;  4G7H F;  2PP4 A;  3ATP A;  2HKV A;  1PD0 A;  1V54 C;  5CIV A;  4WW3 A;  4E7Z A;  3VHZ A;  4BWB A;  1NLX A;  2R02 A;  4JVS A;  5H2O A;  2EPO A;  4XT3 A;  4JUR I;  4XWJ A;  4Z9H A;  5DS6 A;  4BPM A;  2EPN A;  3O6X A;  4XTK A;  2IYL D;  3HNL A;  3MLG A;  1M2V A;  1RMV A;  3A11 A;  3NY8 A;  5T3W A;  1S51 A;  4PXK A;  5KYU B;  4QI1 A;  3X3C A;  3NYM A;  4EBJ A;  5J7A A;  1YVI A;  3JCU Q;  3SEO A;  4G7S B;  1QKR A;  4PJM A;  2FGY A;  4FBZ A;  3C9L A;  3DDL A;  1A7D A;  1M57 C;  4JJG A;  2YCW A;  1OW6 A;  2XLO A;  4HWL A;  5JS5 A;  5B1A C;  1OW7 A;  3X2Q C;  3ZG1 A;  4A4A A;  1OW8 A;  1JV7 A;  3S3B B;  1C8S A;  2R7U A;  4KNW A;  3LAY A;  2DI3 A;  2QLA A;  3LUT B;  1LS4 A;  3S8F B;  1HW1 A;  3HAR A;  2XLM A;  5E3A A;  1GQA A;  2VCB A;  2A6E F;  3S3C B;  3SXM A;  2ZXR A;  1Q0F A;  1TWC A;  2PFD A;  3DQB A;  4KBL A;  2DYS C;  3CEX A;  3SXZ A;  3ASO C;  1MMG A;  5BR5 A;  1E83 A;  2Z55 A;  3LNR A;  3UTV A;  2Q3T A;  4CS7 A;  3HJC A;  1DOW A;  1WGW A;  1E0P A;  2WL8 A;  2F95 A;  4WJ0 A;  4YT4 A;  3RF3 A;  2G62 A;  3U9M A;  4XQ1 A;  3QJV B;  4GP5 B;  2M64 A;  4X0R A;  4ZLD A;  3QJU B;  1ST6 A;  1J8Y F;  2A69 F;  1LE4 A;  4QI0 A;  5ETZ A;  3POV A;  2XL8 A;  1JPJ A;  2BC5 A;  1I5N A;  1PD1 A;  1SR2 A;  4BEY A;  2P6V A;  3UON A;  4H4K C;  2W4M A;  3W8H A;  3S3D B;  3U2M A;  4CIP A;  3REY A;  3OE9 A;  2IXM A;  4U5E E;  2WB7 A;  2WJL A;  2WZF A;  3B9Q A;  1MMD A;  3G4X A;  2YL1 A;  2AWC A;  1A7V A;  2CDQ A;  3B29 A;  1K04 A;  5AX1 A;  1M6T A;  3S9O A;  4DS7 E;  4I1O B;  3T4R A;  2WVO A;  3KKB A;  1R4T A;  1TWH A;  1ZVZ A;  4JRZ A;  2R7R A;  3T6B A;  2C04 A;  5H2N A;  1N1C A;  4A4M A;  1MQV A;  5KYY B;  3RW0 A;  4O7G A;  1G4U S;  2HS5 A;  5IY5 C;  4MQT A;  5B6W A;  1AUE A;  2H7O A;  2QPE B;  2Y3G A;  4E7S A;  1X0K 1;  5ITC A;  1X0I 1;  1TWA A;  3EFO A;  3AG2 C;  1XZQ A;  2XXA B;  2DGJ A;  4BJ1 A;  4ULW A;  4AMJ A;  1WAS A;  5KYW A;  3HAP A;  4MQ9 F;  4C7O B;  2B0H A;  3DXJ F;  1FNT c;  1F50 A;  1QLE C;  5G53 A;  2V3C C;  2Y3B A;  3EH2 A;  2ZXW C;  4DBR A;  3DAF A;  3B0P A;  3X1O A;  2YCY A;  1U89 A;  4DAJ A;  3IPM O;  4MVM A;  4BJ5 A;  4LDK A;  1V74 B;  5FCL A;  2D4U A;  5G2A A;  2LIG A;  4CX9 A;  2M4E A;  2KS9 A;  3RVZ A;  3SXY A;  1O0A A; 
#chains in the Genus database with same CATH homology
 4GP8 B;  2Y01 A;  4ULV A;  2VT4 A;  4CDV A;  4GP4 B;  4D4X A;  3EML A;  3QBI A;  1L0M A;  4UG2 A;  4JEA A;  5G36 A;  3S8G B;  1R84 A;  1PXR A;  4GPO A;  3QAK A;  4EA3 A;  4GBR A;  4IB4 A;  1XJI A;  3VVK A;  5LWE A;  4CJO A;  4EIY A;  3QBG A;  1EHK B;  2R4R A;  3HNK A;  1IW9 A;  1KME A;  3ZEV A;  4D4N A;  3AYM A;  5H2I A;  3VGA A;  1BRX A;  1F88 A;  2JAF A;  4L6R A;  3NMK A;  1XIO A;  5A44 A;  4G70 B;  5C1M A;  2XLH A;  2J4Y A;  1QM8 A;  1M0M A;  5AWZ A;  3M15 A;  4PXF A;  4X1H A;  5AHY A;  3UZC A;  3VW7 A;  1BRR A;  1CGO A;  2I35 A;  2CCY A;  4XTN A;  3SN6 R;  3MBV A;  1L9H A;  2L6X A;  4WAV A;  2Z73 A;  5DYS A;  5FJG A;  4DKL A;  1S54 A;  1KG9 A;  1YZC A;  5ITE A;  4G7R B;  4XT1 A;  1JFP A;  1FBB A;  5B6Y A;  3L1M A;  2YDO A;  1VJM A;  1RCP A;  4G7Q B;  3CAP A;  1AT9 A;  2XLW A;  1KG8 A;  2Y03 A;  4GYC A;  3VRC A;  3U8P A;  4IAR A;  4N6H A;  4MD1 A;  5JSL A;  1M0L A;  3C9M A;  1E12 A;  4MQS A;  3RFM A;  2G87 A;  2XLV A;  1CWQ A;  2XL6 A;  3C63 A;  5EN0 A;  4MD2 A;  1YYX A;  5BR2 A;  4NC3 A;  4U9E A;  3PDS A;  4L35 A;  4X32 A;  2YLD A;  3HAS A;  3NMI A;  5JJE A;  2QPD B;  1QKO A;  4CDY A;  4N4Y B;  5A8E A;  3ZTZ A;  5TGZ A;  2KSY A;  5G2C A;  2YCX A;  4JQ6 A;  3A7K A;  3UTW A;  5JJN A;  4X31 A;  1IW6 A;  2AT9 A;  2YKZ A;  5AHZ A;  1S52 A;  4WGZ A;  5H2J A;  4HYJ A;  5H2M A;  5DHH A;  1JV6 A;  5AGF A;  3PXO A;  4KNF A;  256B A;  3HNI A;  2NTW A;  1IXF A;  5H2K A;  1QKP A;  1PY6 A;  4G71 B;  3NMJ A;  2X72 A;  1GZM A;  4OV0 A;  2ZFE A;  3HAQ A;  1P8I A;  4KLY A;  5G28 A;  1JGJ A;  1AP9 A;  2YL7 A;  3PQR A;  3C62 A;  3DE9 A;  2F93 A;  1LM3 B;  3HAN A;  3NS0 A;  3ZTM A;  5B6X A;  5B2N A;  3NY9 A;  1M0K A;  1S8J A;  1JAF A;  3TOM A;  1XME B;  3QJT B;  1YYJ A;  4WW3 A;  3VHZ A;  4BWB A;  2YDV A;  3ZPQ A;  2J8W A;  3P0G A;  4WGY A;  5H2O A;  4GRV A;  5B0W A;  3OAX A;  3PWH A;  4XT3 A;  2YLG A;  3QVY A;  3D4S A;  1VGO A;  2BRD A;  3HNL A;  1TN5 A;  3QJS B;  1C3W A;  2JAG A;  1S05 A;  5G2D A;  2I20 A;  5JRA A;  3NY8 A;  4DJH A;  4FPD A;  1S51 A;  3FOP A;  1P8U A;  4PXK A;  1E85 A;  2XLE A;  4QI1 A;  3EH5 B;  2ZZL A;  4XTL A;  5JLI A;  3X3C A;  3ZQY A;  1BRD A;  1KGB A;  3V2Y A;  4JR8 A;  5B34 A;  5J7A A;  3X3B A;  4G7S B;  3ZPR A;  5H2P A;  2Y00 A;  4BUO A;  4FBZ A;  4BVN A;  2YL3 A;  3C9L A;  3DDL A;  4BV0 A;  4HYX A;  2YCW A;  2HPY A;  3VI0 A;  2RH1 A;  2XLO A;  4AMI A;  5JT4 A;  3VG9 A;  3TOL A;  3QJQ B;  4HWL A;  2YL0 A;  5B3I A;  5JS5 A;  1P8H A;  4U9D A;  4CDA A;  5B6Z A;  2XM4 A;  3IQ5 A;  1CPQ A;  3FOO A;  4QRY A;  3QBL A;  1BBH A;  1QQ3 A;  2KSB A;  1JV7 A;  5A45 A;  3S3B B;  1C8S A;  2QLA A;  3PBL A;  4LDL A;  3S8F B;  1YZA A;  3ODU A;  1LN6 A;  5F8U A;  3HAR A;  2Y04 A;  5H2H A;  2XLM A;  1GQA A;  5DHG A;  1QPU A;  3OE8 A;  3S3C B;  3EH4 B;  1GU8 A;  3QW1 A;  3DQB A;  4XTO A;  1CGN A;  1EKY A;  5BR5 A;  1E83 A;  2Z55 A;  3EH3 B;  3UTY A;  4CJG A;  3UTV A;  1F4Z A;  3V2W A;  5AX0 A;  3HAO A;  1E0P A;  2F95 A;  3HNJ A;  3ZQV A;  3ZWI A;  3IQ6 A;  1FBK A;  2YCZ A;  3QJV B;  4GP5 B;  2EI4 A;  1DZE A;  4MBS A;  4N4W A;  5JP7 A;  1S8L A;  3QBK A;  1UCQ A;  3QJU B;  2M3G A;  3OE0 A;  3QW0 A;  5ETZ A;  3UG9 A;  5H2L A;  2XL8 A;  5JUA A;  4BEZ A;  2BC5 A;  2NTU A;  4BEY A;  2LNL A;  3M4B A;  4QID A;  2PED A;  2ZIY A;  3UON A;  3KJ6 A;  3NSB A;  3S3D B;  3OE6 A;  5B6V A;  4K5Y A;  4CIP A;  3REY A;  3OE9 A;  4LDO A;  2WJL A;  1H68 A;  3RZE A;  3WQJ A;  2YL1 A;  1X0S A;  1A7V A;  3QDC A;  3UTX A;  5AX1 A;  3ABW A;  1S53 A;  1M6T A;  1MGY A;  4DS7 E;  2Y02 A;  3COD A;  1GUE A;  5JVE A;  2YLI A;  1E86 A;  5H2N A;  2KSA A;  1C8R A;  4JE9 A;  4FA7 B;  3AYN A;  2WJK A;  1Q5I A;  4LDE A;  4A4M A;  1MQV A;  1E84 A;  4XXJ A;  1NBB A;  1CPR A;  2I1X A;  5G54 A;  4MQT A;  5B6W A;  3DE8 A;  5B35 A;  1Q5J A;  2QPE B;  4UHR A;  3M4C A;  3AM6 A;  1X0K 1;  5ITC A;  1X0I 1;  5AZD A;  3UZA A;  5KKH A;  2I21 A;  3QJR B;  5JJJ A;  4Y9H A;  4JKV A;  1H2S A;  4AMJ A;  3QAP A;  3HAP A;  4JEB A;  3COC A;  3NYA A;  4EJ4 A;  4TL3 A;  1APC A;  2R4S A;  1F50 A;  1HZX A;  2XM0 A;  3BVD B;  5G53 A;  1R2N A;  3M79 A;  3QVZ A;  2YCY A;  2J9B A;  4FAA B;  4IAQ A;  4G72 B;  1PXS A;  4DAJ A;  4ER9 A;  3T45 A;  4J4Q A;  1UAZ A;  1BM1 A;  1TN0 A;  5G2A A;  1QHJ A;  2XLD A;  1U19 A;  4CX9 A;  2KS9 A;  1O0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...