4L6RA

Structure of the class b human glucagon g protein coupled receptor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
413
structure length
398
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562 and Glucagon receptor chimera
publication title Structure of the human glucagon class B G-protein-coupled receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 138
structure length 398
sequence length 413
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00002 7tm_2 7 transmembrane receptor (Secretin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4l6rA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4l6rA02
1QPUA 1MGYA 2XL6A 5H2NA 4Y9HA 3QW0A 4DKLA 1S52A 3IQ5A 1KG9A 2F93A 5H2LA 3ZEVA 3V2YA 3NSBA 1BRXA 3ABWA 5C1MA 5H2PA 2XM0A 3QBLA 5G2AA 4L35A 3NMIA 3QBGA 1TN5A 1JFPA 2YDVA 4WW3A 1JGJA 3OE8A 3OE6A 2QPEB 2L6XA 5EN0A 3UZAA 2R4RA 1BRDA 1F4ZA 2YDOA 1XJIA 3RZEA 1RCPA 3HNIA 1CGNA 3NS0A 5FJGA 4MQTA 4BWBA 4MQSA 4QIDA 5JJNA 1BBHA 1EHKB 3HAPA 1IW6A 4GP4B 5TGZA 1F88A 3X3BA 3COCA 3OAXA 4N4WA 3CAPA 3QAPA 1PXSA 2R4SA 3DDLA 2HPYA 3FOPA 2YLIA 3VI0A 5KKHA 5H2HA 2BRDA 4XT1A 1M0LA 2XLVA 1APCA 3C9LA 1AT9A 5A45A 2XLEA 4U9EA 2BC5A 4XXJA 5ITCA 2QLAA 4CJGA 5H2IA 5B6WA 5J7AA 4PXKA 4CDVA 5ETZA 3QAKA 4PXFA 4BEZA 4EA3A 5BR5A 4JE9A 4FA7B 5G36A 3TOMA 3ZPRA 3QBIA 4NC3A 1C8SA 1QM8A 1C8RA 5G53A 1S51A 5B2NA 4AMIA 5AWZA 2RH1A 4WGZA 5AX1A 1CGOA 3DE9A 2YLGA 3KJ6A 1P8IA 3HNKA 1IW9A 1QQ3A 1IXFA 1GQAA 3EMLA 1M6TA 2XLDA 4G71B 3C9MA 1S54A 5AHYA 3UTYA 3VHZA 5H2MA 1S8LA 4UG2A 4X1HA 3A7KA 5G2CA 1A7VA 4DAJA 1FBBA 1LM3B 3C63A 1JAFA 3UZCA 4MD1A 3VVKA 3M4BA 2XL8A 4L6RA 1AP9A 3HNJA 4XT3A 4LDEA 2CCYA 4MD2A 1H2SA 1X0SA 1P8HA 2Y00A 4BUOA 4CJOA 5JJJA 4CX9A 4G7RB 3HAQA 4KNFA 256BA 4OV0A 3RFMA 1PY6A 1TN0A 3M15A 3TOLA 1QHJA 4A4MA 1R84A 2WJKA 1YYXA 1MQVA 3WQJA 1E85A 2KS9A 3HAOA 5A8EA 1JV6A 2Z73A 3QDCA 3V2WA 3VG9A 1VGOA 5B3IA 3BVDB 5DHHA 3PWHA 3S8GB 4WGYA 5H2KA 4D4NA 3PQRA 5JT4A 2Y01A 1QKPA 1L9HA 3ZPQA 4LDLA 4G7QB 3MBVA 4G70B 3D4SA 5AX0A 3S3BB 2G87A 2YCXA 2WJLA 3ODUA 1L0MA 3NYAA 1YYJA 4G7SB 2XLOA 5G28A 4DJHA 4GP8B 3QVZA 1UAZA 3S3CB 1E83A 4QI1A 4U9DA 2YL0A 1CPQA 1E86A 2Y03A 3QBKA 4QRYA 5F8UA 2YLDA 4HYXA 1QKOA 5B0WA 5B6ZA 3C62A 1UCQA 2PEDA 5H2JA 5AZDA 3QJQB 1LN6A 3UTWA 5JSLA 1YZAA 3L1MA 1YZCA 2I21A 2NTWA 2Z55A 5G54A 1M0MA 1S53A 5B35A 3AYNA 1HZXA 1S05A 3EH4B 3QVYA 2KSBA 4GP5B 3PBLA 2LNLA 1EKYA 5JLIA 3VW7A 4GYCA 2Y02A 5DHGA 1CWQA 4JQ6A 4UHRA 1Q5JA 4JR8A 1XIOA 3QJUB 2F95A 3VGAA 5AHZA 1GUEA 3HARA 4WAVA 3M4CA 1DZEA 3U8PA 2Y04A 3FOOA 2EI4A 5H2OA 3UONA 5JS5A 4AMJA 3AYMA 3EH3B 5B34A 1VJMA 4D4XA 3UTXA 5JVEA 3ZWIA 4XTNA 4GRVA 2I1XA 1H68A 3QJVB 3SN6R 3NMJA 1E12A 2I20A 4FPDA 2KSAA 1CPRA 2ZFEA 4EJ4A 4HYJA 3QJSB 3QJRB 1JV7A 1KMEA 1Q5IA 2XLWA 4CDAA 1U19A 4N4YB 4CDYA 2YCYA 5LWEA 1R2NA 4XTLA 1P8UA 4FBZA 3ZQVA 4FAAB 3CODA 2YL3A 2JAFA 3HASA 3UG9A 3T45A 5BR2A 3QW1A 2J4YA 2YCZA 4N6HA 1BRRA 5JP7A 3ZQYA 4X32A 5DYSA 3P0GA 1X0K1 2X72A 1GZMA 4TL3A 2YL7A 3S3DB 2XLHA 1NBBA 4G72B 4JEBA 3QJTB 2M3GA 3PDSA 3AM6A 5AGFA 5JJEA 4JEAA 5JUAA 2JAGA 3S8FB 3VRCA 3IQ6A 2YKZA 3M79A 2NTUA 1KG8A 2YCWA 3ZTMA 2I35A 1E0PA 5B6YA 4LDOA 4HWLA 4XTOA 4CIPA 2ZIYA 1O0AA 4ULVA 5A44A 1F50A 3X3CA 3EH5B 5G2DA 1KGBA 2J9BA 4X31A 3HNLA 4IARA 3DQBA 1BM1A 2AT9A 2KSYA 4GPOA 1C3WA 3PXOA 5ITEA 1E84A 2ZZLA 3NMKA 4MBSA 4GBRA 4J4QA 5B6XA 5JRAA 1GU8A 1S8JA 1FBKA 3NY8A 4BEYA 1X0I1 2XM4A 4ER9A 3OE0A 2YL1A 4JKVA 3HANA 4BV0A 4IAQA 4EIYA 3DE8A 3REYA 3ZTZA 3NY9A 1PXRA 4KLYA 2VT4A 4BVNA 2J8WA 5B6VA 3OE9A 1XMEB 2XLMA 1M0KA 3UTVA 4IB4A 2QPDB 4K5YA
chains in the Genus database with same CATH superfamily
5FZTA 4JURI 3PDMP 1T6UA 3EGDB 4Y9HA 4IWBA 3V7OA 5A69A 3SXYA 4YT8A 1M57C 5D91A 2L6FA 2QTVA 2FAPB 5L0JA 4EWCA 1BRXA 3X1OA 3E9VA 4JC7A 3QBGA 4MVUA 1JFPA 4E17A 3O39A 3OE8A 2A68F 5E2QA 5D92A 5L0GA 1YDIA 5DLJA 2LQGA 2YDOA 3EH2A 1XJIA 4QDLA 4WABA 4H54A 1CGNA 4EUKB 4CS9C 1BBHA 2BE5F 5TGZA 1WOLA 1JPNA 4PJLA 4N4WA 3TJ6A 3QAPA 2CGEA 3LNMB 1JPJA 3U5SA 4O6MA 3VI0A 2KGOA 1RJ9A 5H2HA 5KKHA 4K7BA 4XT1A 5AC4A 3S28A 5A6AA 1AT9A 1V74B 2WZLA 1AUEA 4XXJA 5ITCA 2QLAA 4AL0A 5B6WA 3G4ZA 4PFPA 4C3BA 4X0RA 4AX2A 3OWTA 2A1DD 4PXFA 1D0YA 1G5ZA 3MYFA 2Q9AA 2VC9A 1S51A 4AMIA 1T5OA 5AX1A 3DE9A 4HEAJ 3NDBB 1T9KA 2G3VA 5L0HA 1QQ3A 1QVXA 4QI2A 2XLDA 5F5FA 2WL8A 4J7YA 3UTYA 1DOWA 5H2MA 1M2VA 1U6HA 3LAYA 4MTGA 2VH3A 4HFKB 5HV9A 1ZU4A 4NTBA 3C63A 1JAFA 3M4BA 4LERA 4L6RA 1AP9A 4XPXA 1R5ID 1YVIA 2YEVA 1ORYA 1C03A 4CJOA 2HZ8A 3U3BA 4UDVA 4G7RB 5T3TA 2Y69C 4KNFA 3RFMA 1PY6A 2J0XA 4OD5A 1QHJA 4A4MA 4Q7CA 1XZPA 1MQVA 2IYLD 3WQJA 3HAOA 4U5FE 2RSEB 2R25A 3QDCA 3V2WA 3Q7LA 1WGWA 2Q7RA 1VGOA 2BL2A 3BVDB 2XRHA 5H2KA 4K1OA 4D4NA 4C3DA 1G4US 2V3CC 1QKPA 3ZPQA 4LDLA 4YWQA 3MBVA 5AX0A 2P0NA 2G87A 3GEHA 4CSAC 1NFOA 5G28A 4DJHA 3S3CB 4QI1A 1AVOB 3K7DA 4U9DA 2YL0A 5DS6A 2YLDA 4N6CA 4BJ5A 1FNTc 4CS8A 5H2JA 3VYWA 1YZAA 3CAXA 3TJ5A 4O6YA 3V5ZA 3AYNA 4C7OA 1HZXA 5KYNA 2ZPAA 3EH4B 2KSBA 3C7JA 1FMVA 1TR2A 3PBLA 2CDQA 2EIMC 3NKDA 1HMOA 1PD1A 3VW7A 4GYCA 3V5XA 2L6HA 1CWQA 4JQ6A 2A69F 4U5EE 3IQCA 5TJ5E 2AVKA 3AGUA 3K66A 4YT4A 2F95A 3N0TA 5EHHA 1M2OA 1LS4A 4XWJA 1SR2A 1OW7A 5F5HA 4EKWA 3GM1A 2C03A 3U9MA 5JS5A 3AQBA 4W8KA 4J30B 3WODF 3AYMA 5L0DA 2V26A 5CI8A 4MVSA 5KYXB 4IJJA 4M63A 3NMJA 4JTCB 4PJNA 1NU9C 1LPEA 3M1CB 4EJ4A 4GQHA 1KMEA 2XLWA 5L3VA 4CDAA 4XLPF 1LIHA 2W45A 4K0DA 2YCYA 5LWEA 1IW7F 3FXHA 2FFHA 1V4AA 4XLNF 3HASA 2R03A 1ZHTA 2AP3A 4N6HA 1BRRA 2R7XA 3H65A 2WB7A 3EPVA 2P61A 3WHNA 3PHF2 2H8AA 3U2LA 2PFDA 2X72A 2YL7A 3S3DB 4EBBA 2XLHA 4MW3A 3TQOA 2Y3GA 3UGOA 4JEBA 5DVWA 1Z6AA 2XXAB 5JJEA 5JUAA 2JAGA 3VRCA 1A7DA 4YL0A 1QZXA 2KC3A 5B1AC 3ZTMA 3EGXB 2I35A 1E0PA 1GGQA 3C18A 2EIKC 1LS1A 3LEVA 4LLCA 5B6YA 5BQHA 5L3QA 1I5NA 4ULVA 2QE9A 4DOZA 1F50A 3X2QC 1L3PA 3EH5B 5G2DA 2J9BA 3B0PA 2AT9A 2KSYA 2ZZLA 3NYJA 2NUPB 1S8JA 3NY8A 5B3SC 3ATPA 4E0IA 4MTFA 4C3EA 3KYJA 2IBFA 2YL1A 2ZXWC 4IAQA 3B0UX 1ORSC 2Y3HA 3DE8A 2LFDA 3NY9A 1PXRA 2VT4A 2PNOA 3NYLA 2XLMA 1M0KA 5E33A 4IB4A 2QPDB 4NQFA 4E18A 5H2NA 4Q5SF 5KYYB 2OKUA 4JRZA 1Q0KA 1D1CA 3I5QA 1KG9A 2F93A 3ZEVA 3V2YA 2GWWA 4MW8A 3LLKA 3ABWA 5KYWA 1A41A 4FAPB 2H7VC 4ANJA 4MNDA 2UUHA 3CEXA 1YJGA 2L6XA 2EPNA 2HJ3A 1ZHWA 2R4RA 3E70C 3EHMA 1H9TA 3B29A 1F4ZA 3RZEA 1RCPA 3MFNA 4HE8D 2VCBA 2Q3TA 2CNWD 4Z9IA 1VMAA 2XS8A 3FMSA 5EGYA 2OEVA 3K33A 4MQSA 4QIDA 3LS0A 1IW6A 5F28E 1WATA 3H2UA 3WAQA 2NG1A 4AE4B 3NRHA 3X3BA 3COCA 3OAXA 3HTKC 1PXSA 3DDLA 1LE4A 2ICWG 3I4UA 5KYUB 2HPYA 1Y4CA 2EINC 1M0LA 4GYTA 1NU7D 2XLEA 1YAUO 3U9JA 2XS1A 3UMHA 4PXKA 2ZXPA 4CBEA 4CDVA 5ETZA 4YL1A 4BEZA 4JE9A 2IXNA 3TOMA 5G36A 3C8GD 3ZPRA 4NC3A 3QBIA 1MMDA 1QM8A 3K6BA 5B1BC 3T6JA 5B2NA 4ZLCA 4WGZA 1OCOC 2YLGA 3KJ6A 1J8MF 1IW9A 1XZQA 2MYSA 1GQAA 1A0BA 5L0FA 1HY5A 2KW3C 5T1DB 1EI7A 4G71B 1S54A 1T6QA 5AHYA 3LS1A 3VHZA 3SXZA 4BJ5C 1S8LA 4UG2A 4CS8C 3AJMA 1OW8A 1HW1A 1ZW2A 3EH1A 5G2CA 4DAJA 3HJCA 3OA1A 4BJ1A 3KKBA 3UZCA 1MNDA 1KNYA 3NYMA 2VB6A 2R7SA 2XL8A 1ZYRF 2HMZA 2YRFA 1OKKD 1JR8A 4WJ0A 1X0SA 5COGA 4JCHA 1HE1A 2NSGA 2L9JA 3T6BA 3AG3C 1T6IA 1RJ9B 4DVZA 3L34A 2LIGA 1ZW3A 3MBGA 3GWNA 3SXKA 1E85A 2KS9A 5A8EA 1JV6A 2VCCA 1VLSA 3KMIA 1TWGA 4MVMA 2J9VA 5GPGB 4BEJA 3KPHA 3LESA 4LDKA 4MTOA 4G7QB 3EGDA 4G70B 1VOMA 2J45A 2WJLA 3EFOB 1L0MA 2J46A 1UG7A 1YYJA 2QUPA 2XLOA 3QVZA 1UAZA 2YWAA 4FESA 3C8ZA 1MMGA 4KNWA 2NSFA 3G4XA 3S90A 4MQ9F 4BG0A 1M2VB 1QKOA 2IXOA 4MVQA 1UCQA 2PEDA 1YA7O 1LN6A 3ABKC 2TMVP 3LLIA 1YZCA 2I21A 2NTWA 1TKNA 1S05A 3S29A 3HKKA 5JLIA 2Y39A 2Z15A 1Q5JA 4JR8A 1W2WA 2ZD9A 5DQTA 3U2MA 1XIOA 1TWHA 3VGAA 3MLGA 1FTSA 4P9FA 2LP4A 3M4CA 3U8PA 2Y04A 2EPKX 1WTYA 2CNWA 5H2OA 2KQ9A 2OQMA 1OXBA 4MVOA 3Q6NA 1ZHXA 1BZ4A 2KK1A 1F1MA 3R2PA 1VJMA 4D4XA 3UTXA 2WZFA 4GRVA 1YA9A 3LNRA 3RVZA 3N24A 4U5HA 2HS5A 1WN0A 3GM2A 3IPMO 2ZFEA 2X51A 1JMWA 3QJSB 2OG2A 1O87A 4OD4A 4JW1A 2ASRA 2HUJA 4N4YB 3JTLO 2YZSA 2XL4A 3EZIA 4JJGA 4XTLA 1J8YF 4FAAB 1TFOB 3ZQVA 4FBZA 1A7EA 3DZAA 3W4YA 3QTHA 3I5PA 2KJGA 3C8GA 3W8HA 2EPLX 5JP7A 3ABLC 3ZQYA 5DYSA 3JZ0A 3AGTA 4QI0A 3DI5A 2B0JA 2JPUA 4DXWA 3O55A 5E3AA 4TL3A 4MVRA 4BJTA 2Q9BA 5FCLA 4A4AA 2PX3A 3U8VA 3FAPB 4PACA 5CIVA 2OOCA 4LACB 2Y3BA 4U5DE 5AC5A 3PDSA 4E7SA 3IQ6A 4KBLA 2NTUA 2HV6A 2DI3A 1LKXA 2YVKA 4JZAA 1EQ1A 2OCCC 4LDOA 4HWLA 1ZZPA 2J0WA 2R02A 4BPMA 4YL3A 2R9RB 3ZDLA 3AG4C 1OKKA 1KGBA 4OIPF 3HNLA 4GPOA 1C3WA 3PXOA 4GBRA 4J4QA 2LK4A 1KU2A 2R7VA 2HMQA 4JKVA 5CI9A 5HSWA 2KYHA 3S84A 3GEIA 3JYYA 4EIYA 3ZTZA 2M4EA 4KLYA 2M64A 4BVNA 2JD3A 5B6VA 4G7ZF 1XMEB 3KL4A 4K5YA 3RYLA 2R7TA 4I1MA 4DKLA 2A0BA 2ZXRA 3IQ5A 3NSBA 1SYQA 2HJMA 5C1MA 3V5YA 2QY9A 1OR2A 2XM0A 5H2PA 3A9CA 1VLTA 1LE2A 1FFTC 1TFKB 2YDVA 1JGJA 2W4MA 1OCCC 3OE6A 5EN0A 2EIJC 2G62A 1BRDA 2WVNA 5K0IA 1TQGA 4U5CE 2OEXA 3S0XA 3VF0A 2LD6A 3HNIA 3RQFA 3UNGC 3K1IA 3TD7A 4DS7E 5FJGA 4MQTA 4BWBA 1WWPA 5JJNA 4XPWA 2R05A 3CSKA 2HFIA 4GP4B 2XSEA 3AOUA 1Z63A 4PK4A 4JTDB 1FR0A 3ZSUA 4IAOA 3S27A 3FOPA 2F22A 2BRDA 1APCA 1RKCA 5A45A 2LSEA 4RD9A 3JRMO 3BRJA 3GM3A 3QAKA 3EG9B 4EA3A 3JYHA 4DJ9A 2IOQA 4FA7B 4PJJA 3W8IA 1C8SA 1RKEB 4IRUA 5G53A 1AEPA 1ST6A 1CGOA 2WVOA 1MMAA 3LEOA 5KYWB 1P8IA 3UMKA 4OIQF 1NFNA 1OCZC 1IXFA 3L8IA 2W9YA 3EMLA 1L7CA 1M6TA 2XXAA 4XEKA 3GEEA 3T9OA 1Q0FA 4X1HA 4N06A 3A7KA 1C17M 3U3FA 1A7VA 3GWLA 2NUTA 2G3KA 4MD1A 3SEOA 4IGGA 4LDQA 3HNJA 4E7ZA 4I1OB 3EZHA 4YT5A 3G50A 2CCYA 5BQIA 3DJUB 2W4BA 2Y00A 1N1CA 4BUOA 1LI5A 3BEHA 2MHRA 5JJJA 4PFOA 3HAQA 256BA 4OV0A 4E0HA 3TOLA 2WJKA 1YYXA 1D1BA 3RVYA 1GM5A 2J7PD 4I44A 3S8GB 1Q0MA 4WGYA 3US6A 1RXQA 3PQRA 5L0IA 2Y01A 3DMDA 4U5BE 3RIPA 4P6IC 2P1AA 5KYYA 3NYAA 2EILC 2IXMA 4DVYP 2ZXOA 4G78A 4G7SB 2DGJA 4GP8B 3UR3C 2Q00A 1VTMP 1UFBA 1CPQA 1E86A 3B71A 3F47A 2Y03A 3CQZA 3W2WA 4YN0B 1QSPA 4U5GA 4QRYA 5F8UA 1ORJA 2GAQA 5DS4A 4DRHB 4HYXA 3PMRA 3ECSA 5B0WA 4XEFA 5AZDA 3OEOA 4XEVA 4CS7A 3QJQB 2P7VA 3L1MA 3QZCA 1M56C 3RQGA 1S53A 5A6KA 3DAGA 2R7QA 3NG1A 2RD9A 3AG1C 1NZEA 3QVYA 4GP5B 3JCUQ 1EKYA 4NTAA 4Z9JA 3JSEO 2Y02A 1IZMA 4UHRA 1G4WR 3MX3A 1Z23A 3QJUB 3EJNA 5AHZA 2A6EF 5KYUA 1GUEA 2Q4FA 3HARA 1DZEA 1EA8A 2FGYA 2DYSC 3AQCA 4H4KC 4A2NB 1I4ZA 3EH3B 4LDRA 5JVEA 2L81A 2R7WA 3ZWIA 4XTNA 3DD7A 2I1XA 1H68A 4JTAB 3R7CA 3SYNA 3B9QA 3T4RA 4ULWA 1Z5ZA 5COMA 4EBKA 4FPDA 2J9UA 1GS9A 1CPRA 3VM6A 1JV7A 1Q5IA 1QKRA 1U19A 2EPMX 3ZG1A 2EPOA 3KH2A 2ETSA 1KTMA 2YL3A 4FWVA 1OCRC 3UG9A 3JRTA 1H9GA 3FVYA 2J4YA 3U0CA 1PCXA 2YHSA 3WG7C 1U0BB 2IM8A 4X32A 5DQZA 3P0GA 2AU5A 1GZMA 2HSBA 3DM9B 4KI2A 1OR3A 1NBBA 1NSGB 1Z3IX 3QJTB 3L8JA 5COFA 2M3GA 1K05A 4JVSA 4EBJA 3M79A 2CYDA 1HMDA 1KG8A 2NPUA 2AWCA 2YCWA 5E3CA 4MVZA 3F46A 2LCHA 2ZIYA 1TWAA 5A44A 3K1IC 2QNLA 3X3CA 1OQCA 4IARA 3DQBA 1CGME 3NMKA 4MBSA 1GU8A 1FBKA 1D1AA 2H7OA 1X0I1 2XM4A 2DYRC 4NY3A 3PCVA 3EFOA 1BDJB 3L0IA 3DWWA 4RDAA 4Z9HA 1SZIA 3HANA 3DJNB 1B68A 3GODA 1JRAA 2J7PA 3ASNC 4LLEA 1VYIA 3OE9A 2OU6A 3UTVA 3Q6MA 3C8GB 1QPUA 2R7OA 4KNVA 4B6IA 1MGYA 2XL6A 2H7BA 1HW2A 1XWJA 3QMKA 3QW0A 4YK5A 3SZRA 1S52A 4J32B 1VYKA 5H2LA 3ZC4A 1QLEC 4OINF 2OJED 1BR2A 2WVQA 1NLXA 1OXKA 3ITFA 3QBLA 5G2AA 4BJ6A 4L35A 3NMIA 2L7AA 2UUIA 4YT2A 1TN5A 1OW6A 4WW3A 2QPEB 3UZAA 2WZGA 4ZLDA 4Q4ZF 2PBEA 3ABMC 2E87A 4G7HF 4C7OB 1DOVA 3NS0A 1JOGA 1EHKB 3HAPA 2X0CA 2DB4A 3FDQA 1F88A 4DBQA 4XPYA 4FX5A 4ONSA 3CAPA 2R4SA 5L0CA 2YLIA 1K04A 3SP1A 3EHNA 2XLVA 1FAPB 3C9LA 4U9EA 2BC5A 4MS2A 2JX0A 4CJGA 5H2IA 2A0UA 3RH3A 5J7AA 5BQGA 1MNEA 3DKAA 4G0HA 3SXMA 1O3UA 1G8XA 2MWQA 5BR5A 3JT1A 3VAYA 2D5RB 5DS5A 1PD0A 1C8RA 3LJBA 5AWZA 2RH1A 3RW0A 3SNHA 1V54C 1BR1A 3HNKA 1O5HA 4JIOA 2D4UA 3IHUA 1PV3A 2O9XA 3C9MA 2HSQA 4DBRA 4OIRF 3EQLF 2A6HF 3UMIA 5A6BD 2R7UA 3FHDA 1V55C 1FBBA 5EK0A 1LM3B 1ZHYA 2VCAA 2J9WA 2GA0A 3VVKA 4CS9A 4XT3A 4LDEA 1ZHZA 4MD2A 1H2SA 1P8HA 3W2VA 2VASA 1H6GA 3DM5A 2LFFA 3TK0A 4CX9A 3GORA 4DRIB 3UGPA 4AK9A 1SF8A 1TN0A 3M15A 4RBNA 1R84A 4HFFB 4O6NA 1SMYF 2Z73A 2KSFA 2AWYA 1Z7Qc 2PF4E 3VG9A 4PR9A 5B3IA 2CW0F 5DHHA 3PWHA 3ZIBA 5JT4A 4OIOF 1L9HA 2IXPA 5KYXA 3D4SA 1LVKA 3S3BB 2YCXA 3ODUA 4P9TA 2OJQA 1D0ZA 4R32A 2L6GA 2PP4A 4JJFA 1E83A 1R4TA 1ZU5A 4I3MA 3N2ZB 1S7ZA 3QBKA 1Q0GA 2GDCA 2Q9CA 4XQ1A 3DAFA 5B6ZA 3C62A 4AL1A 3UTWA 4YJWA 5JSLA 4KC9A 2NUTB 2Z55A 5G54A 1M0MA 3AG2C 5B35A 3HLZA 3POVA 3IQTA 3KYIA 2LNLA 1MMNA 5DHGA 1TWCA 3T6GB 3ZVRA 3IEEA 3S9OA 3RKOF 3O10A 2I15A 4GEHA 3EGXA 4WAVA 3JSZA 3FOOA 4CIHA 1Q0DA 2EI4A 1I4YA 3UONA 3O6XA 3RQEA 4XTKA 2YQYA 4AMJA 1FMWA 3K1HA 5B34A 3DXJF 1BR4A 4F4BA 3EG9A 1T01A 3QJVB 2NUPA 3RF3A 1VB5A 3SN6R 1HE9A 3TULA 1E12A 2I20A 2KSAA 1K40A 1RKEA 1VK5A 4CSAA 3MYIA 4HYJA 3QJRB 4PJMA 4CDYA 4DRJB 1FFHA 1R2NA 1P8UA 1YLMA 3CODA 1RMVA 2JAFA 3T45A 5BR2A 1LI7A 3QW1A 3GANA 4O7GA 2YCZA 4EHPA 2I8BA 5A6JA 1Y6DA 1X0K1 3NKEA 1WASA 4O79A 4G72B 3B0VC 2KNHA 4J7TA 4BJ6C 3A11A 3CZ6A 3AM6A 2P6VA 5AGFA 5BUOA 4JEAA 4NTFA 3H2VA 3S8FB 2YKZA 5T3WA 1ZVZA 1NG1A 5A6BA 2Y3DA 4XTOA 4CIPA 4W8PA 1O0AA 1E2XA 3J06A 4JCZA 2B0HA 4X31A 3Q7GA 1BM1A 5ITEA 1E84A 3LUTB 5B6XA 5JRAA 4AE4A 1D0XA 4BEYA 3ASOC 4G7OF 2PX0A 4NCQA 2GFHA 4ER9A 3OE0A 3FAJA 1U89A 4BV0A 2C04A 1C02A 1H7IA 4BEMJ 1YARO 3RFYA 3REYA 2R7RA 2J8WA 5IY5C 2HKVA 2HV7A
chains in the Genus database with same CATH topology
1QPUA 1MGYA 2XL6A 5H2NA 4Y9HA 3QW0A 4DKLA 1S52A 3IQ5A 1KG9A 2F93A 5H2LA 3ZEVA 3V2YA 3NSBA 1BRXA 3ABWA 5C1MA 5H2PA 2XM0A 3QBLA 5G2AA 4L35A 3NMIA 3QBGA 1TN5A 1JFPA 2YDVA 4WW3A 1JGJA 3OE8A 3OE6A 2QPEB 2L6XA 5EN0A 3UZAA 2R4RA 1BRDA 1F4ZA 2YDOA 1XJIA 3RZEA 1RCPA 3HNIA 4DS7E 1CGNA 3NS0A 5FJGA 4MQTA 4BWBA 4MQSA 4QIDA 5JJNA 1BBHA 1EHKB 3HAPA 1IW6A 4GP4B 5TGZA 1F88A 3X3BA 3COCA 3OAXA 4N4WA 3CAPA 3QAPA 1PXSA 2R4SA 3DDLA 2HPYA 3FOPA 2YLIA 3VI0A 5KKHA 5H2HA 2BRDA 4XT1A 1M0LA 2XLVA 1APCA 3C9LA 1AT9A 5A45A 2XLEA 4U9EA 2BC5A 4XXJA 5ITCA 2QLAA 4CJGA 5H2IA 5B6WA 5J7AA 4PXKA 4CDVA 5ETZA 3QAKA 4PXFA 4BEZA 4EA3A 5BR5A 4JE9A 4FA7B 5G36A 3TOMA 3ZPRA 3QBIA 4NC3A 1C8SA 1QM8A 1C8RA 5G53A 1S51A 5B2NA 4AMIA 5AWZA 2RH1A 4WGZA 5AX1A 1CGOA 3DE9A 2YLGA 3KJ6A 1P8IA 3HNKA 1IW9A 1QQ3A 1IXFA 1GQAA 3EMLA 1M6TA 2XLDA 4G71B 3C9MA 1S54A 5AHYA 3UTYA 3VHZA 5H2MA 1S8LA 4UG2A 4X1HA 3A7KA 5G2CA 1A7VA 4DAJA 1FBBA 1LM3B 3C63A 1JAFA 3UZCA 4MD1A 3VVKA 3M4BA 2XL8A 4L6RA 1AP9A 3HNJA 4XT3A 4LDEA 2CCYA 4MD2A 1H2SA 1X0SA 1P8HA 2Y00A 4BUOA 4CJOA 5JJJA 4CX9A 4G7RB 3HAQA 4KNFA 256BA 4OV0A 3RFMA 1PY6A 1TN0A 3M15A 3TOLA 1QHJA 4A4MA 1R84A 2WJKA 1YYXA 1MQVA 3WQJA 1E85A 2KS9A 3HAOA 5A8EA 1JV6A 2Z73A 3QDCA 3V2WA 3VG9A 1VGOA 5B3IA 3BVDB 5DHHA 3PWHA 3S8GB 4WGYA 5H2KA 4D4NA 3PQRA 5JT4A 2Y01A 1QKPA 1L9HA 3ZPQA 4LDLA 4G7QB 3MBVA 4G70B 3D4SA 5AX0A 3S3BB 2G87A 2YCXA 2WJLA 3ODUA 1L0MA 3NYAA 1YYJA 4G7SB 2XLOA 5G28A 4DJHA 4GP8B 3QVZA 1UAZA 3S3CB 1E83A 4QI1A 4U9DA 2YL0A 1CPQA 1E86A 2Y03A 3QBKA 4QRYA 5F8UA 2YLDA 4HYXA 1QKOA 5B0WA 5B6ZA 3C62A 1UCQA 2PEDA 5H2JA 5AZDA 3QJQB 1LN6A 3UTWA 5JSLA 1YZAA 3L1MA 1YZCA 2I21A 2NTWA 2Z55A 5G54A 1M0MA 1S53A 5B35A 3AYNA 1HZXA 1S05A 3EH4B 3QVYA 2KSBA 4GP5B 3PBLA 2LNLA 1EKYA 5JLIA 3VW7A 4GYCA 2Y02A 5DHGA 1CWQA 4JQ6A 4UHRA 1Q5JA 4JR8A 1XIOA 3QJUB 2F95A 3VGAA 5AHZA 1GUEA 3HARA 4WAVA 3M4CA 1DZEA 3U8PA 2Y04A 3FOOA 2EI4A 5H2OA 3UONA 5JS5A 4AMJA 3AYMA 3EH3B 5B34A 1VJMA 4D4XA 3UTXA 5JVEA 3ZWIA 4XTNA 4GRVA 2I1XA 1H68A 3QJVB 3SN6R 3NMJA 1E12A 2I20A 4FPDA 2KSAA 1CPRA 2ZFEA 4EJ4A 4HYJA 3QJSB 3QJRB 1JV7A 1KMEA 1Q5IA 2XLWA 4CDAA 1U19A 4N4YB 4CDYA 2YCYA 5LWEA 1R2NA 4XTLA 1P8UA 4FBZA 3ZQVA 4FAAB 3CODA 2YL3A 2JAFA 3HASA 3UG9A 3T45A 5BR2A 3QW1A 2J4YA 2YCZA 4N6HA 1BRRA 5JP7A 3ZQYA 4X32A 5DYSA 3P0GA 1X0K1 2X72A 1GZMA 4TL3A 2YL7A 3S3DB 2XLHA 1NBBA 4G72B 4JEBA 3QJTB 2M3GA 3PDSA 3AM6A 5AGFA 5JJEA 4JEAA 5JUAA 2JAGA 3S8FB 3VRCA 3IQ6A 2YKZA 3M79A 2NTUA 1KG8A 2YCWA 3ZTMA 2I35A 1E0PA 5B6YA 4LDOA 4HWLA 4XTOA 4CIPA 2ZIYA 1O0AA 4ULVA 5A44A 1F50A 3X3CA 3EH5B 5G2DA 1KGBA 2J9BA 4X31A 3HNLA 4IARA 3DQBA 1BM1A 2AT9A 2KSYA 4GPOA 1C3WA 3PXOA 5ITEA 1E84A 2ZZLA 3NMKA 4MBSA 4GBRA 4J4QA 5B6XA 5JRAA 1GU8A 1S8JA 1FBKA 3NY8A 4BEYA 1X0I1 2XM4A 4ER9A 3OE0A 2YL1A 4JKVA 3HANA 4BV0A 4IAQA 4EIYA 3DE8A 3REYA 3ZTZA 3NY9A 1PXRA 4KLYA 2VT4A 4BVNA 2J8WA 5B6VA 3OE9A 1XMEB 2XLMA 1M0KA 3UTVA 4IB4A 2QPDB 4K5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPU A;  1MGY A;  2XL6 A;  5H2N A;  4Y9H A;  3QW0 A;  4DKL A;  1S52 A;  3IQ5 A;  1KG9 A;  2F93 A;  5H2L A;  3ZEV A;  3V2Y A;  3NSB A;  1BRX A;  3ABW A;  5C1M A;  5H2P A;  2XM0 A;  3QBL A;  5G2A A;  4L35 A;  3NMI A;  3QBG A;  1TN5 A;  1JFP A;  2YDV A;  4WW3 A;  1JGJ A;  3OE8 A;  3OE6 A;  2QPE B;  2L6X A;  5EN0 A;  3UZA A;  2R4R A;  1BRD A;  1F4Z A;  2YDO A;  1XJI A;  3RZE A;  1RCP A;  3HNI A;  1CGN A;  3NS0 A;  5FJG A;  4MQT A;  4BWB A;  4MQS A;  4QID A;  5JJN A;  1BBH A;  1EHK B;  3HAP A;  1IW6 A;  4GP4 B;  5TGZ A;  1F88 A;  3X3B A;  3COC A;  3OAX A;  4N4W A;  3CAP A;  3QAP A;  1PXS A;  2R4S A;  3DDL A;  2HPY A;  3FOP A;  2YLI A;  3VI0 A;  5KKH A;  5H2H A;  2BRD A;  4XT1 A;  1M0L A;  2XLV A;  1APC A;  3C9L A;  1AT9 A;  5A45 A;  2XLE A;  4U9E A;  2BC5 A;  4XXJ A;  5ITC A;  2QLA A;  4CJG A;  5H2I A;  5B6W A;  5J7A A;  4PXK A;  4CDV A;  5ETZ A;  3QAK A;  4PXF A;  4BEZ A;  4EA3 A;  5BR5 A;  4JE9 A;  4FA7 B;  5G36 A;  3TOM A;  3ZPR A;  3QBI A;  4NC3 A;  1C8S A;  1QM8 A;  1C8R A;  5G53 A;  1S51 A;  5B2N A;  4AMI A;  5AWZ A;  2RH1 A;  4WGZ A;  5AX1 A;  1CGO A;  3DE9 A;  2YLG A;  3KJ6 A;  1P8I A;  3HNK A;  1IW9 A;  1QQ3 A;  1IXF A;  1GQA A;  3EML A;  1M6T A;  2XLD A;  4G71 B;  3C9M A;  1S54 A;  5AHY A;  3UTY A;  3VHZ A;  5H2M A;  1S8L A;  4UG2 A;  4X1H A;  3A7K A;  5G2C A;  1A7V A;  4DAJ A;  1FBB A;  1LM3 B;  3C63 A;  1JAF A;  3UZC A;  4MD1 A;  3VVK A;  3M4B A;  2XL8 A;  4L6R A;  1AP9 A;  3HNJ A;  4XT3 A;  4LDE A;  2CCY A;  4MD2 A;  1H2S A;  1X0S A;  1P8H A;  2Y00 A;  4BUO A;  4CJO A;  5JJJ A;  4CX9 A;  4G7R B;  3HAQ A;  4KNF A;  256B A;  4OV0 A;  3RFM A;  1PY6 A;  1TN0 A;  3M15 A;  3TOL A;  1QHJ A;  4A4M A;  1R84 A;  2WJK A;  1YYX A;  1MQV A;  3WQJ A;  1E85 A;  2KS9 A;  3HAO A;  5A8E A;  1JV6 A;  2Z73 A;  3QDC A;  3V2W A;  3VG9 A;  1VGO A;  5B3I A;  3BVD B;  5DHH A;  3PWH A;  3S8G B;  4WGY A;  5H2K A;  4D4N A;  3PQR A;  5JT4 A;  2Y01 A;  1QKP A;  1L9H A;  3ZPQ A;  4LDL A;  4G7Q B;  3MBV A;  4G70 B;  3D4S A;  5AX0 A;  3S3B B;  2G87 A;  2YCX A;  2WJL A;  3ODU A;  1L0M A;  3NYA A;  1YYJ A;  4G7S B;  2XLO A;  5G28 A;  4DJH A;  4GP8 B;  3QVZ A;  1UAZ A;  3S3C B;  1E83 A;  4QI1 A;  4U9D A;  2YL0 A;  1CPQ A;  1E86 A;  2Y03 A;  3QBK A;  4QRY A;  5F8U A;  2YLD A;  4HYX A;  1QKO A;  5B0W A;  5B6Z A;  3C62 A;  1UCQ A;  2PED A;  5H2J A;  5AZD A;  3QJQ B;  1LN6 A;  3UTW A;  5JSL A;  1YZA A;  3L1M A;  1YZC A;  2I21 A;  2NTW A;  2Z55 A;  5G54 A;  1M0M A;  1S53 A;  5B35 A;  3AYN A;  1HZX A;  1S05 A;  3EH4 B;  3QVY A;  2KSB A;  4GP5 B;  3PBL A;  2LNL A;  1EKY A;  5JLI A;  3VW7 A;  4GYC A;  2Y02 A;  5DHG A;  1CWQ A;  4JQ6 A;  4UHR A;  1Q5J A;  4JR8 A;  1XIO A;  3QJU B;  2F95 A;  3VGA A;  5AHZ A;  1GUE A;  3HAR A;  4WAV A;  3M4C A;  1DZE A;  3U8P A;  2Y04 A;  3FOO A;  2EI4 A;  5H2O A;  3UON A;  5JS5 A;  4AMJ A;  3AYM A;  3EH3 B;  5B34 A;  1VJM A;  4D4X A;  3UTX A;  5JVE A;  3ZWI A;  4XTN A;  4GRV A;  2I1X A;  1H68 A;  3QJV B;  3SN6 R;  3NMJ A;  1E12 A;  2I20 A;  4FPD A;  2KSA A;  1CPR A;  2ZFE A;  4EJ4 A;  4HYJ A;  3QJS B;  3QJR B;  1JV7 A;  1KME A;  1Q5I A;  2XLW A;  4CDA A;  1U19 A;  4N4Y B;  4CDY A;  2YCY A;  5LWE A;  1R2N A;  4XTL A;  1P8U A;  4FBZ A;  3ZQV A;  4FAA B;  3COD A;  2YL3 A;  2JAF A;  3HAS A;  3UG9 A;  3T45 A;  5BR2 A;  3QW1 A;  2J4Y A;  2YCZ A;  4N6H A;  1BRR A;  5JP7 A;  3ZQY A;  4X32 A;  5DYS A;  3P0G A;  1X0K 1;  2X72 A;  1GZM A;  4TL3 A;  2YL7 A;  3S3D B;  2XLH A;  1NBB A;  4G72 B;  4JEB A;  3QJT B;  2M3G A;  3PDS A;  3AM6 A;  5AGF A;  5JJE A;  4JEA A;  5JUA A;  2JAG A;  3S8F B;  3VRC A;  3IQ6 A;  2YKZ A;  3M79 A;  2NTU A;  1KG8 A;  2YCW A;  3ZTM A;  2I35 A;  1E0P A;  5B6Y A;  4LDO A;  4HWL A;  4XTO A;  4CIP A;  2ZIY A;  1O0A A;  4ULV A;  5A44 A;  1F50 A;  3X3C A;  3EH5 B;  5G2D A;  1KGB A;  2J9B A;  4X31 A;  3HNL A;  4IAR A;  3DQB A;  1BM1 A;  2AT9 A;  2KSY A;  4GPO A;  1C3W A;  3PXO A;  5ITE A;  1E84 A;  2ZZL A;  3NMK A;  4MBS A;  4GBR A;  4J4Q A;  5B6X A;  5JRA A;  1GU8 A;  1S8J A;  1FBK A;  3NY8 A;  4BEY A;  1X0I 1;  2XM4 A;  4ER9 A;  3OE0 A;  2YL1 A;  4JKV A;  3HAN A;  4BV0 A;  4IAQ A;  4EIY A;  3DE8 A;  3REY A;  3ZTZ A;  3NY9 A;  1PXR A;  4KLY A;  2VT4 A;  4BVN A;  2J8W A;  5B6V A;  3OE9 A;  1XME B;  2XLM A;  1M0K A;  3UTV A;  4IB4 A;  2QPD B;  4K5Y A; 
#chains in the Genus database with same CATH topology
 5FZT A;  4JUR I;  3PDM P;  1T6U A;  3EGD B;  4Y9H A;  4IWB A;  3V7O A;  5A69 A;  3SXY A;  4YT8 A;  1M57 C;  5D91 A;  2L6F A;  2QTV A;  2FAP B;  5L0J A;  4EWC A;  1BRX A;  3X1O A;  3E9V A;  4JC7 A;  3QBG A;  4MVU A;  1JFP A;  4E17 A;  3O39 A;  3OE8 A;  2A68 F;  5E2Q A;  5D92 A;  5L0G A;  1YDI A;  5DLJ A;  2LQG A;  2YDO A;  3EH2 A;  1XJI A;  4QDL A;  4WAB A;  4H54 A;  1CGN A;  4EUK B;  4CS9 C;  1BBH A;  2BE5 F;  5TGZ A;  1WOL A;  1JPN A;  4PJL A;  4N4W A;  3TJ6 A;  3QAP A;  2CGE A;  3LNM B;  1JPJ A;  3U5S A;  4O6M A;  3VI0 A;  2KGO A;  1RJ9 A;  5H2H A;  5KKH A;  4K7B A;  4XT1 A;  5AC4 A;  3S28 A;  5A6A A;  1AT9 A;  1V74 B;  2WZL A;  1AUE A;  4XXJ A;  5ITC A;  2QLA A;  4AL0 A;  5B6W A;  3G4Z A;  4PFP A;  4C3B A;  4X0R A;  4AX2 A;  3OWT A;  2A1D D;  4PXF A;  1D0Y A;  1G5Z A;  3MYF A;  2Q9A A;  2VC9 A;  1S51 A;  4AMI A;  1T5O A;  5AX1 A;  3DE9 A;  4HEA J;  3NDB B;  1T9K A;  2G3V A;  5L0H A;  1QQ3 A;  1QVX A;  4QI2 A;  2XLD A;  5F5F A;  2WL8 A;  4J7Y A;  3UTY A;  1DOW A;  5H2M A;  1M2V A;  1U6H A;  3LAY A;  4MTG A;  2VH3 A;  4HFK B;  5HV9 A;  1ZU4 A;  4NTB A;  3C63 A;  1JAF A;  3M4B A;  4LER A;  4L6R A;  1AP9 A;  4XPX A;  1R5I D;  1YVI A;  2YEV A;  1ORY A;  1C03 A;  4CJO A;  2HZ8 A;  3U3B A;  4UDV A;  4G7R B;  5T3T A;  2Y69 C;  4KNF A;  3RFM A;  1PY6 A;  2J0X A;  4OD5 A;  1QHJ A;  4A4M A;  4Q7C A;  1XZP A;  1MQV A;  2IYL D;  3WQJ A;  3HAO A;  4U5F E;  2RSE B;  2R25 A;  3QDC A;  3V2W A;  3Q7L A;  1WGW A;  2Q7R A;  1VGO A;  2BL2 A;  3BVD B;  2XRH A;  5H2K A;  4K1O A;  4D4N A;  4C3D A;  1G4U S;  2V3C C;  1QKP A;  3ZPQ A;  4LDL A;  4YWQ A;  3MBV A;  5AX0 A;  2P0N A;  2G87 A;  3GEH A;  4CSA C;  1NFO A;  5G28 A;  4DJH A;  3S3C B;  4QI1 A;  1AVO B;  3K7D A;  4U9D A;  2YL0 A;  5DS6 A;  2YLD A;  4N6C A;  4BJ5 A;  1FNT c;  4CS8 A;  5H2J A;  3VYW A;  1YZA A;  3CAX A;  3TJ5 A;  4O6Y A;  3V5Z A;  3AYN A;  4C7O A;  1HZX A;  5KYN A;  2ZPA A;  3EH4 B;  2KSB A;  3C7J A;  1FMV A;  1TR2 A;  3PBL A;  2CDQ A;  2EIM C;  3NKD A;  1HMO A;  1PD1 A;  3VW7 A;  4GYC A;  3V5X A;  2L6H A;  1CWQ A;  4JQ6 A;  2A69 F;  4U5E E;  3IQC A;  5TJ5 E;  2AVK A;  3AGU A;  3K66 A;  4YT4 A;  2F95 A;  3N0T A;  5EHH A;  1M2O A;  1LS4 A;  4XWJ A;  1SR2 A;  1OW7 A;  5F5H A;  4EKW A;  3GM1 A;  2C03 A;  3U9M A;  5JS5 A;  3AQB A;  4W8K A;  4J30 B;  3WOD F;  3AYM A;  5L0D A;  2V26 A;  5CI8 A;  4MVS A;  5KYX B;  4IJJ A;  4M63 A;  3NMJ A;  4JTC B;  4PJN A;  1NU9 C;  1LPE A;  3M1C B;  4EJ4 A;  4GQH A;  1KME A;  2XLW A;  5L3V A;  4CDA A;  4XLP F;  1LIH A;  2W45 A;  4K0D A;  2YCY A;  5LWE A;  1IW7 F;  3FXH A;  2FFH A;  1V4A A;  4XLN F;  3HAS A;  2R03 A;  1ZHT A;  2AP3 A;  4N6H A;  1BRR A;  2R7X A;  3H65 A;  2WB7 A;  3EPV A;  2P61 A;  3WHN A;  3PHF 2;  2H8A A;  3U2L A;  2PFD A;  2X72 A;  2YL7 A;  3S3D B;  4EBB A;  2XLH A;  4MW3 A;  3TQO A;  2Y3G A;  3UGO A;  4JEB A;  5DVW A;  1Z6A A;  2XXA B;  5JJE A;  5JUA A;  2JAG A;  3VRC A;  1A7D A;  4YL0 A;  1QZX A;  2KC3 A;  5B1A C;  3ZTM A;  3EGX B;  2I35 A;  1E0P A;  1GGQ A;  3C18 A;  2EIK C;  1LS1 A;  3LEV A;  4LLC A;  5B6Y A;  5BQH A;  5L3Q A;  1I5N A;  4ULV A;  2QE9 A;  4DOZ A;  1F50 A;  3X2Q C;  1L3P A;  3EH5 B;  5G2D A;  2J9B A;  3B0P A;  2AT9 A;  2KSY A;  2ZZL A;  3NYJ A;  2NUP B;  1S8J A;  3NY8 A;  5B3S C;  3ATP A;  4E0I A;  4MTF A;  4C3E A;  3KYJ A;  2IBF A;  2YL1 A;  2ZXW C;  4IAQ A;  3B0U X;  1ORS C;  2Y3H A;  3DE8 A;  2LFD A;  3NY9 A;  1PXR A;  2VT4 A;  2PNO A;  3NYL A;  2XLM A;  1M0K A;  5E33 A;  4IB4 A;  2QPD B;  4NQF A;  4E18 A;  5H2N A;  4Q5S F;  5KYY B;  2OKU A;  4JRZ A;  1Q0K A;  1D1C A;  3I5Q A;  1KG9 A;  2F93 A;  3ZEV A;  3V2Y A;  2GWW A;  4MW8 A;  3LLK A;  3ABW A;  5KYW A;  1A41 A;  4FAP B;  2H7V C;  4ANJ A;  4MND A;  2UUH A;  3CEX A;  1YJG A;  2L6X A;  2EPN A;  2HJ3 A;  1ZHW A;  2R4R A;  3E70 C;  3EHM A;  1H9T A;  3B29 A;  1F4Z A;  3RZE A;  1RCP A;  3MFN A;  4HE8 D;  2VCB A;  2Q3T A;  2CNW D;  4Z9I A;  1VMA A;  2XS8 A;  3FMS A;  5EGY A;  2OEV A;  3K33 A;  4MQS A;  4QID A;  3LS0 A;  1IW6 A;  5F28 E;  1WAT A;  3H2U A;  3WAQ A;  2NG1 A;  4AE4 B;  3NRH A;  3X3B A;  3COC A;  3OAX A;  3HTK C;  1PXS A;  3DDL A;  1LE4 A;  2ICW G;  3I4U A;  5KYU B;  2HPY A;  1Y4C A;  2EIN C;  1M0L A;  4GYT A;  1NU7 D;  2XLE A;  1YAU O;  3U9J A;  2XS1 A;  3UMH A;  4PXK A;  2ZXP A;  4CBE A;  4CDV A;  5ETZ A;  4YL1 A;  4BEZ A;  4JE9 A;  2IXN A;  3TOM A;  5G36 A;  3C8G D;  3ZPR A;  4NC3 A;  3QBI A;  1MMD A;  1QM8 A;  3K6B A;  5B1B C;  3T6J A;  5B2N A;  4ZLC A;  4WGZ A;  1OCO C;  2YLG A;  3KJ6 A;  1J8M F;  1IW9 A;  1XZQ A;  2MYS A;  1GQA A;  1A0B A;  5L0F A;  1HY5 A;  2KW3 C;  5T1D B;  1EI7 A;  4G71 B;  1S54 A;  1T6Q A;  5AHY A;  3LS1 A;  3VHZ A;  3SXZ A;  4BJ5 C;  1S8L A;  4UG2 A;  4CS8 C;  3AJM A;  1OW8 A;  1HW1 A;  1ZW2 A;  3EH1 A;  5G2C A;  4DAJ A;  3HJC A;  3OA1 A;  4BJ1 A;  3KKB A;  3UZC A;  1MND A;  1KNY A;  3NYM A;  2VB6 A;  2R7S A;  2XL8 A;  1ZYR F;  2HMZ A;  2YRF A;  1OKK D;  1JR8 A;  4WJ0 A;  1X0S A;  5COG A;  4JCH A;  1HE1 A;  2NSG A;  2L9J A;  3T6B A;  3AG3 C;  1T6I A;  1RJ9 B;  4DVZ A;  3L34 A;  2LIG A;  1ZW3 A;  3MBG A;  3GWN A;  3SXK A;  1E85 A;  2KS9 A;  5A8E A;  1JV6 A;  2VCC A;  1VLS A;  3KMI A;  1TWG A;  4MVM A;  2J9V A;  5GPG B;  4BEJ A;  3KPH A;  3LES A;  4LDK A;  4MTO A;  4G7Q B;  3EGD A;  4G70 B;  1VOM A;  2J45 A;  2WJL A;  3EFO B;  1L0M A;  2J46 A;  1UG7 A;  1YYJ A;  2QUP A;  2XLO A;  3QVZ A;  1UAZ A;  2YWA A;  4FES A;  3C8Z A;  1MMG A;  4KNW A;  2NSF A;  3G4X A;  3S90 A;  4MQ9 F;  4BG0 A;  1M2V B;  1QKO A;  2IXO A;  4MVQ A;  1UCQ A;  2PED A;  1YA7 O;  1LN6 A;  3ABK C;  2TMV P;  3LLI A;  1YZC A;  2I21 A;  2NTW A;  1TKN A;  1S05 A;  3S29 A;  3HKK A;  5JLI A;  2Y39 A;  2Z15 A;  1Q5J A;  4JR8 A;  1W2W A;  2ZD9 A;  5DQT A;  3U2M A;  1XIO A;  1TWH A;  3VGA A;  3MLG A;  1FTS A;  4P9F A;  2LP4 A;  3M4C A;  3U8P A;  2Y04 A;  2EPK X;  1WTY A;  2CNW A;  5H2O A;  2KQ9 A;  2OQM A;  1OXB A;  4MVO A;  3Q6N A;  1ZHX A;  1BZ4 A;  2KK1 A;  1F1M A;  3R2P A;  1VJM A;  4D4X A;  3UTX A;  2WZF A;  4GRV A;  1YA9 A;  3LNR A;  3RVZ A;  3N24 A;  4U5H A;  2HS5 A;  1WN0 A;  3GM2 A;  3IPM O;  2ZFE A;  2X51 A;  1JMW A;  3QJS B;  2OG2 A;  1O87 A;  4OD4 A;  4JW1 A;  2ASR A;  2HUJ A;  4N4Y B;  3JTL O;  2YZS A;  2XL4 A;  3EZI A;  4JJG A;  4XTL A;  1J8Y F;  4FAA B;  1TFO B;  3ZQV A;  4FBZ A;  1A7E A;  3DZA A;  3W4Y A;  3QTH A;  3I5P A;  2KJG A;  3C8G A;  3W8H A;  2EPL X;  5JP7 A;  3ABL C;  3ZQY A;  5DYS A;  3JZ0 A;  3AGT A;  4QI0 A;  3DI5 A;  2B0J A;  2JPU A;  4DXW A;  3O55 A;  5E3A A;  4TL3 A;  4MVR A;  4BJT A;  2Q9B A;  5FCL A;  4A4A A;  2PX3 A;  3U8V A;  3FAP B;  4PAC A;  5CIV A;  2OOC A;  4LAC B;  2Y3B A;  4U5D E;  5AC5 A;  3PDS A;  4E7S A;  3IQ6 A;  4KBL A;  2NTU A;  2HV6 A;  2DI3 A;  1LKX A;  2YVK A;  4JZA A;  1EQ1 A;  2OCC C;  4LDO A;  4HWL A;  1ZZP A;  2J0W A;  2R02 A;  4BPM A;  4YL3 A;  2R9R B;  3ZDL A;  3AG4 C;  1OKK A;  1KGB A;  4OIP F;  3HNL A;  4GPO A;  1C3W A;  3PXO A;  4GBR A;  4J4Q A;  2LK4 A;  1KU2 A;  2R7V A;  2HMQ A;  4JKV A;  5CI9 A;  5HSW A;  2KYH A;  3S84 A;  3GEI A;  3JYY A;  4EIY A;  3ZTZ A;  2M4E A;  4KLY A;  2M64 A;  4BVN A;  2JD3 A;  5B6V A;  4G7Z F;  1XME B;  3KL4 A;  4K5Y A;  3RYL A;  2R7T A;  4I1M A;  4DKL A;  2A0B A;  2ZXR A;  3IQ5 A;  3NSB A;  1SYQ A;  2HJM A;  5C1M A;  3V5Y A;  2QY9 A;  1OR2 A;  2XM0 A;  5H2P A;  3A9C A;  1VLT A;  1LE2 A;  1FFT C;  1TFK B;  2YDV A;  1JGJ A;  2W4M A;  1OCC C;  3OE6 A;  5EN0 A;  2EIJ C;  2G62 A;  1BRD A;  2WVN A;  5K0I A;  1TQG A;  4U5C E;  2OEX A;  3S0X A;  3VF0 A;  2LD6 A;  3HNI A;  3RQF A;  3UNG C;  3K1I A;  3TD7 A;  4DS7 E;  5FJG A;  4MQT A;  4BWB A;  1WWP A;  5JJN A;  4XPW A;  2R05 A;  3CSK A;  2HFI A;  4GP4 B;  2XSE A;  3AOU A;  1Z63 A;  4PK4 A;  4JTD B;  1FR0 A;  3ZSU A;  4IAO A;  3S27 A;  3FOP A;  2F22 A;  2BRD A;  1APC A;  1RKC A;  5A45 A;  2LSE A;  4RD9 A;  3JRM O;  3BRJ A;  3GM3 A;  3QAK A;  3EG9 B;  4EA3 A;  3JYH A;  4DJ9 A;  2IOQ A;  4FA7 B;  4PJJ A;  3W8I A;  1C8S A;  1RKE B;  4IRU A;  5G53 A;  1AEP A;  1ST6 A;  1CGO A;  2WVO A;  1MMA A;  3LEO A;  5KYW B;  1P8I A;  3UMK A;  4OIQ F;  1NFN A;  1OCZ C;  1IXF A;  3L8I A;  2W9Y A;  3EML A;  1L7C A;  1M6T A;  2XXA A;  4XEK A;  3GEE A;  3T9O A;  1Q0F A;  4X1H A;  4N06 A;  3A7K A;  1C17 M;  3U3F A;  1A7V A;  3GWL A;  2NUT A;  2G3K A;  4MD1 A;  3SEO A;  4IGG A;  4LDQ A;  3HNJ A;  4E7Z A;  4I1O B;  3EZH A;  4YT5 A;  3G50 A;  2CCY A;  5BQI A;  3DJU B;  2W4B A;  2Y00 A;  1N1C A;  4BUO A;  1LI5 A;  3BEH A;  2MHR A;  5JJJ A;  4PFO A;  3HAQ A;  256B A;  4OV0 A;  4E0H A;  3TOL A;  2WJK A;  1YYX A;  1D1B A;  3RVY A;  1GM5 A;  2J7P D;  4I44 A;  3S8G B;  1Q0M A;  4WGY A;  3US6 A;  1RXQ A;  3PQR A;  5L0I A;  2Y01 A;  3DMD A;  4U5B E;  3RIP A;  4P6I C;  2P1A A;  5KYY A;  3NYA A;  2EIL C;  2IXM A;  4DVY P;  2ZXO A;  4G78 A;  4G7S B;  2DGJ A;  4GP8 B;  3UR3 C;  2Q00 A;  1VTM P;  1UFB A;  1CPQ A;  1E86 A;  3B71 A;  3F47 A;  2Y03 A;  3CQZ A;  3W2W A;  4YN0 B;  1QSP A;  4U5G A;  4QRY A;  5F8U A;  1ORJ A;  2GAQ A;  5DS4 A;  4DRH B;  4HYX A;  3PMR A;  3ECS A;  5B0W A;  4XEF A;  5AZD A;  3OEO A;  4XEV A;  4CS7 A;  3QJQ B;  2P7V A;  3L1M A;  3QZC A;  1M56 C;  3RQG A;  1S53 A;  5A6K A;  3DAG A;  2R7Q A;  3NG1 A;  2RD9 A;  3AG1 C;  1NZE A;  3QVY A;  4GP5 B;  3JCU Q;  1EKY A;  4NTA A;  4Z9J A;  3JSE O;  2Y02 A;  1IZM A;  4UHR A;  1G4W R;  3MX3 A;  1Z23 A;  3QJU B;  3EJN A;  5AHZ A;  2A6E F;  5KYU A;  1GUE A;  2Q4F A;  3HAR A;  1DZE A;  1EA8 A;  2FGY A;  2DYS C;  3AQC A;  4H4K C;  4A2N B;  1I4Z A;  3EH3 B;  4LDR A;  5JVE A;  2L81 A;  2R7W A;  3ZWI A;  4XTN A;  3DD7 A;  2I1X A;  1H68 A;  4JTA B;  3R7C A;  3SYN A;  3B9Q A;  3T4R A;  4ULW A;  1Z5Z A;  5COM A;  4EBK A;  4FPD A;  2J9U A;  1GS9 A;  1CPR A;  3VM6 A;  1JV7 A;  1Q5I A;  1QKR A;  1U19 A;  2EPM X;  3ZG1 A;  2EPO A;  3KH2 A;  2ETS A;  1KTM A;  2YL3 A;  4FWV A;  1OCR C;  3UG9 A;  3JRT A;  1H9G A;  3FVY A;  2J4Y A;  3U0C A;  1PCX A;  2YHS A;  3WG7 C;  1U0B B;  2IM8 A;  4X32 A;  5DQZ A;  3P0G A;  2AU5 A;  1GZM A;  2HSB A;  3DM9 B;  4KI2 A;  1OR3 A;  1NBB A;  1NSG B;  1Z3I X;  3QJT B;  3L8J A;  5COF A;  2M3G A;  1K05 A;  4JVS A;  4EBJ A;  3M79 A;  2CYD A;  1HMD A;  1KG8 A;  2NPU A;  2AWC A;  2YCW A;  5E3C A;  4MVZ A;  3F46 A;  2LCH A;  2ZIY A;  1TWA A;  5A44 A;  3K1I C;  2QNL A;  3X3C A;  1OQC A;  4IAR A;  3DQB A;  1CGM E;  3NMK A;  4MBS A;  1GU8 A;  1FBK A;  1D1A A;  2H7O A;  1X0I 1;  2XM4 A;  2DYR C;  4NY3 A;  3PCV A;  3EFO A;  1BDJ B;  3L0I A;  3DWW A;  4RDA A;  4Z9H A;  1SZI A;  3HAN A;  3DJN B;  1B68 A;  3GOD A;  1JRA A;  2J7P A;  3ASN C;  4LLE A;  1VYI A;  3OE9 A;  2OU6 A;  3UTV A;  3Q6M A;  3C8G B;  1QPU A;  2R7O A;  4KNV A;  4B6I A;  1MGY A;  2XL6 A;  2H7B A;  1HW2 A;  1XWJ A;  3QMK A;  3QW0 A;  4YK5 A;  3SZR A;  1S52 A;  4J32 B;  1VYK A;  5H2L A;  3ZC4 A;  1QLE C;  4OIN F;  2OJE D;  1BR2 A;  2WVQ A;  1NLX A;  1OXK A;  3ITF A;  3QBL A;  5G2A A;  4BJ6 A;  4L35 A;  3NMI A;  2L7A A;  2UUI A;  4YT2 A;  1TN5 A;  1OW6 A;  4WW3 A;  2QPE B;  3UZA A;  2WZG A;  4ZLD A;  4Q4Z F;  2PBE A;  3ABM C;  2E87 A;  4G7H F;  4C7O B;  1DOV A;  3NS0 A;  1JOG A;  1EHK B;  3HAP A;  2X0C A;  2DB4 A;  3FDQ A;  1F88 A;  4DBQ A;  4XPY A;  4FX5 A;  4ONS A;  3CAP A;  2R4S A;  5L0C A;  2YLI A;  1K04 A;  3SP1 A;  3EHN A;  2XLV A;  1FAP B;  3C9L A;  4U9E A;  2BC5 A;  4MS2 A;  2JX0 A;  4CJG A;  5H2I A;  2A0U A;  3RH3 A;  5J7A A;  5BQG A;  1MNE A;  3DKA A;  4G0H A;  3SXM A;  1O3U A;  1G8X A;  2MWQ A;  5BR5 A;  3JT1 A;  3VAY A;  2D5R B;  5DS5 A;  1PD0 A;  1C8R A;  3LJB A;  5AWZ A;  2RH1 A;  3RW0 A;  3SNH A;  1V54 C;  1BR1 A;  3HNK A;  1O5H A;  4JIO A;  2D4U A;  3IHU A;  1PV3 A;  2O9X A;  3C9M A;  2HSQ A;  4DBR A;  4OIR F;  3EQL F;  2A6H F;  3UMI A;  5A6B D;  2R7U A;  3FHD A;  1V55 C;  1FBB A;  5EK0 A;  1LM3 B;  1ZHY A;  2VCA A;  2J9W A;  2GA0 A;  3VVK A;  4CS9 A;  4XT3 A;  4LDE A;  1ZHZ A;  4MD2 A;  1H2S A;  1P8H A;  3W2V A;  2VAS A;  1H6G A;  3DM5 A;  2LFF A;  3TK0 A;  4CX9 A;  3GOR A;  4DRI B;  3UGP A;  4AK9 A;  1SF8 A;  1TN0 A;  3M15 A;  4RBN A;  1R84 A;  4HFF B;  4O6N A;  1SMY F;  2Z73 A;  2KSF A;  2AWY A;  1Z7Q c;  2PF4 E;  3VG9 A;  4PR9 A;  5B3I A;  2CW0 F;  5DHH A;  3PWH A;  3ZIB A;  5JT4 A;  4OIO F;  1L9H A;  2IXP A;  5KYX A;  3D4S A;  1LVK A;  3S3B B;  2YCX A;  3ODU A;  4P9T A;  2OJQ A;  1D0Z A;  4R32 A;  2L6G A;  2PP4 A;  4JJF A;  1E83 A;  1R4T A;  1ZU5 A;  4I3M A;  3N2Z B;  1S7Z A;  3QBK A;  1Q0G A;  2GDC A;  2Q9C A;  4XQ1 A;  3DAF A;  5B6Z A;  3C62 A;  4AL1 A;  3UTW A;  4YJW A;  5JSL A;  4KC9 A;  2NUT B;  2Z55 A;  5G54 A;  1M0M A;  3AG2 C;  5B35 A;  3HLZ A;  3POV A;  3IQT A;  3KYI A;  2LNL A;  1MMN A;  5DHG A;  1TWC A;  3T6G B;  3ZVR A;  3IEE A;  3S9O A;  3RKO F;  3O10 A;  2I15 A;  4GEH A;  3EGX A;  4WAV A;  3JSZ A;  3FOO A;  4CIH A;  1Q0D A;  2EI4 A;  1I4Y A;  3UON A;  3O6X A;  3RQE A;  4XTK A;  2YQY A;  4AMJ A;  1FMW A;  3K1H A;  5B34 A;  3DXJ F;  1BR4 A;  4F4B A;  3EG9 A;  1T01 A;  3QJV B;  2NUP A;  3RF3 A;  1VB5 A;  3SN6 R;  1HE9 A;  3TUL A;  1E12 A;  2I20 A;  2KSA A;  1K40 A;  1RKE A;  1VK5 A;  4CSA A;  3MYI A;  4HYJ A;  3QJR B;  4PJM A;  4CDY A;  4DRJ B;  1FFH A;  1R2N A;  1P8U A;  1YLM A;  3COD A;  1RMV A;  2JAF A;  3T45 A;  5BR2 A;  1LI7 A;  3QW1 A;  3GAN A;  4O7G A;  2YCZ A;  4EHP A;  2I8B A;  5A6J A;  1Y6D A;  1X0K 1;  3NKE A;  1WAS A;  4O79 A;  4G72 B;  3B0V C;  2KNH A;  4J7T A;  4BJ6 C;  3A11 A;  3CZ6 A;  3AM6 A;  2P6V A;  5AGF A;  5BUO A;  4JEA A;  4NTF A;  3H2V A;  3S8F B;  2YKZ A;  5T3W A;  1ZVZ A;  1NG1 A;  5A6B A;  2Y3D A;  4XTO A;  4CIP A;  4W8P A;  1O0A A;  1E2X A;  3J06 A;  4JCZ A;  2B0H A;  4X31 A;  3Q7G A;  1BM1 A;  5ITE A;  1E84 A;  3LUT B;  5B6X A;  5JRA A;  4AE4 A;  1D0X A;  4BEY A;  3ASO C;  4G7O F;  2PX0 A;  4NCQ A;  2GFH A;  4ER9 A;  3OE0 A;  3FAJ A;  1U89 A;  4BV0 A;  2C04 A;  1C02 A;  1H7I A;  4BEM J;  1YAR O;  3RFY A;  3REY A;  2R7R A;  2J8W A;  5IY5 C;  2HKV A;  2HV7 A; 
#chains in the Genus database with same CATH homology
 1QPU A;  1MGY A;  2XL6 A;  5H2N A;  4Y9H A;  3QW0 A;  4DKL A;  1S52 A;  3IQ5 A;  1KG9 A;  2F93 A;  5H2L A;  3ZEV A;  3V2Y A;  3NSB A;  1BRX A;  3ABW A;  5C1M A;  5H2P A;  2XM0 A;  3QBL A;  5G2A A;  4L35 A;  3NMI A;  3QBG A;  1TN5 A;  1JFP A;  2YDV A;  4WW3 A;  1JGJ A;  3OE8 A;  3OE6 A;  2QPE B;  2L6X A;  5EN0 A;  3UZA A;  2R4R A;  1BRD A;  1F4Z A;  2YDO A;  1XJI A;  3RZE A;  1RCP A;  3HNI A;  4DS7 E;  1CGN A;  3NS0 A;  5FJG A;  4MQT A;  4BWB A;  4MQS A;  4QID A;  5JJN A;  1BBH A;  1EHK B;  3HAP A;  1IW6 A;  4GP4 B;  5TGZ A;  1F88 A;  3X3B A;  3COC A;  3OAX A;  4N4W A;  3CAP A;  3QAP A;  1PXS A;  2R4S A;  3DDL A;  2HPY A;  3FOP A;  2YLI A;  3VI0 A;  5KKH A;  5H2H A;  2BRD A;  4XT1 A;  1M0L A;  2XLV A;  1APC A;  3C9L A;  1AT9 A;  5A45 A;  2XLE A;  4U9E A;  2BC5 A;  4XXJ A;  5ITC A;  2QLA A;  4CJG A;  5H2I A;  5B6W A;  5J7A A;  4PXK A;  4CDV A;  5ETZ A;  3QAK A;  4PXF A;  4BEZ A;  4EA3 A;  5BR5 A;  4JE9 A;  4FA7 B;  5G36 A;  3TOM A;  3ZPR A;  3QBI A;  4NC3 A;  1C8S A;  1QM8 A;  1C8R A;  5G53 A;  1S51 A;  5B2N A;  4AMI A;  5AWZ A;  2RH1 A;  4WGZ A;  5AX1 A;  1CGO A;  3DE9 A;  2YLG A;  3KJ6 A;  1P8I A;  3HNK A;  1IW9 A;  1QQ3 A;  1IXF A;  1GQA A;  3EML A;  1M6T A;  2XLD A;  4G71 B;  3C9M A;  1S54 A;  5AHY A;  3UTY A;  3VHZ A;  5H2M A;  1S8L A;  4UG2 A;  4X1H A;  3A7K A;  5G2C A;  1A7V A;  4DAJ A;  1FBB A;  1LM3 B;  3C63 A;  1JAF A;  3UZC A;  4MD1 A;  3VVK A;  3M4B A;  2XL8 A;  4L6R A;  1AP9 A;  3HNJ A;  4XT3 A;  4LDE A;  2CCY A;  4MD2 A;  1H2S A;  1X0S A;  1P8H A;  2Y00 A;  4BUO A;  4CJO A;  5JJJ A;  4CX9 A;  4G7R B;  3HAQ A;  4KNF A;  256B A;  4OV0 A;  3RFM A;  1PY6 A;  1TN0 A;  3M15 A;  3TOL A;  1QHJ A;  4A4M A;  1R84 A;  2WJK A;  1YYX A;  1MQV A;  3WQJ A;  1E85 A;  2KS9 A;  3HAO A;  5A8E A;  1JV6 A;  2Z73 A;  3QDC A;  3V2W A;  3VG9 A;  1VGO A;  5B3I A;  3BVD B;  5DHH A;  3PWH A;  3S8G B;  4WGY A;  5H2K A;  4D4N A;  3PQR A;  5JT4 A;  2Y01 A;  1QKP A;  1L9H A;  3ZPQ A;  4LDL A;  4G7Q B;  3MBV A;  4G70 B;  3D4S A;  5AX0 A;  3S3B B;  2G87 A;  2YCX A;  2WJL A;  3ODU A;  1L0M A;  3NYA A;  1YYJ A;  4G7S B;  2XLO A;  5G28 A;  4DJH A;  4GP8 B;  3QVZ A;  1UAZ A;  3S3C B;  1E83 A;  4QI1 A;  4U9D A;  2YL0 A;  1CPQ A;  1E86 A;  2Y03 A;  3QBK A;  4QRY A;  5F8U A;  2YLD A;  4HYX A;  1QKO A;  5B0W A;  5B6Z A;  3C62 A;  1UCQ A;  2PED A;  5H2J A;  5AZD A;  3QJQ B;  1LN6 A;  3UTW A;  5JSL A;  1YZA A;  3L1M A;  1YZC A;  2I21 A;  2NTW A;  2Z55 A;  5G54 A;  1M0M A;  1S53 A;  5B35 A;  3AYN A;  1HZX A;  1S05 A;  3EH4 B;  3QVY A;  2KSB A;  4GP5 B;  3PBL A;  2LNL A;  1EKY A;  5JLI A;  3VW7 A;  4GYC A;  2Y02 A;  5DHG A;  1CWQ A;  4JQ6 A;  4UHR A;  1Q5J A;  4JR8 A;  1XIO A;  3QJU B;  2F95 A;  3VGA A;  5AHZ A;  1GUE A;  3HAR A;  4WAV A;  3M4C A;  1DZE A;  3U8P A;  2Y04 A;  3FOO A;  2EI4 A;  5H2O A;  3UON A;  5JS5 A;  4AMJ A;  3AYM A;  3EH3 B;  5B34 A;  1VJM A;  4D4X A;  3UTX A;  5JVE A;  3ZWI A;  4XTN A;  4GRV A;  2I1X A;  1H68 A;  3QJV B;  3SN6 R;  3NMJ A;  1E12 A;  2I20 A;  4FPD A;  2KSA A;  1CPR A;  2ZFE A;  4EJ4 A;  4HYJ A;  3QJS B;  3QJR B;  1JV7 A;  1KME A;  1Q5I A;  2XLW A;  4CDA A;  1U19 A;  4N4Y B;  4CDY A;  2YCY A;  5LWE A;  1R2N A;  4XTL A;  1P8U A;  4FBZ A;  3ZQV A;  4FAA B;  3COD A;  2YL3 A;  2JAF A;  3HAS A;  3UG9 A;  3T45 A;  5BR2 A;  3QW1 A;  2J4Y A;  2YCZ A;  4N6H A;  1BRR A;  5JP7 A;  3ZQY A;  4X32 A;  5DYS A;  3P0G A;  1X0K 1;  2X72 A;  1GZM A;  4TL3 A;  2YL7 A;  3S3D B;  2XLH A;  1NBB A;  4G72 B;  4JEB A;  3QJT B;  2M3G A;  3PDS A;  3AM6 A;  5AGF A;  5JJE A;  4JEA A;  5JUA A;  2JAG A;  3S8F B;  3VRC A;  3IQ6 A;  2YKZ A;  3M79 A;  2NTU A;  1KG8 A;  2YCW A;  3ZTM A;  2I35 A;  1E0P A;  5B6Y A;  4LDO A;  4HWL A;  4XTO A;  4CIP A;  2ZIY A;  1O0A A;  4ULV A;  5A44 A;  1F50 A;  3X3C A;  3EH5 B;  5G2D A;  1KGB A;  2J9B A;  4X31 A;  3HNL A;  4IAR A;  3DQB A;  1BM1 A;  2AT9 A;  2KSY A;  4GPO A;  1C3W A;  3PXO A;  5ITE A;  1E84 A;  2ZZL A;  3NMK A;  4MBS A;  4GBR A;  4J4Q A;  5B6X A;  5JRA A;  1GU8 A;  1S8J A;  1FBK A;  3NY8 A;  4BEY A;  1X0I 1;  2XM4 A;  4ER9 A;  3OE0 A;  2YL1 A;  4JKV A;  3HAN A;  4BV0 A;  4IAQ A;  4EIY A;  3DE8 A;  3REY A;  3ZTZ A;  3NY9 A;  1PXR A;  4KLY A;  2VT4 A;  4BVN A;  2J8W A;  5B6V A;  3OE9 A;  1XME B;  2XLM A;  1M0K A;  3UTV A;  4IB4 A;  2QPD B;  4K5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...