4L6RA

Structure of the class b human glucagon g protein coupled receptor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
413
structure length
398
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human glucagon class B G-protein-coupled receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Soluble cytochrome b562 and Glucagon receptor chimera
total genus 138
structure length 398
sequence length 413
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00002 7tm_2 7 transmembrane receptor (Secretin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4l6rA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4l6rA02
2XLVA 5LWEA 2KSBA 3ZPRA 2Y03A 1QPUA 2NTWA 3HNIA 2KSYA 5ITEA 4BEZA 2Y02A 3EH3B 3NY9A 4XTLA 1E86A 3QJSB 1FBBA 2Y01A 4HYXA 1BRRA 2XL8A 1BBHA 1M0MA 4IAQA 2I1XA 3NS0A 1M6TA 1Q5JA 2Z73A 5DHGA 1XMEB 4DKLA 3V2YA 1LN6A 3T45A 1HZXA 1CPQA 4UG2A 3OE8A 1PXSA 4BEYA 2PEDA 1KG9A 3OAXA 3VW7A 1C3WA 3NMIA 4QRYA 1F88A 3RZEA 3P0GA 4JKVA 1LM3B 4G7RB 5B6WA 1QKPA 3C62A 1X0K1 3VGAA 3OE0A 4AMIA 4EIYA 4U9EA 5AX1A 5EN0A 4G72B 2JAFA 3PBLA 3QVZA 2X72A 2BC5A 4N4WA 5B35A 4MD1A 3UTXA 1QKOA 1KGBA 1M0LA 3QJRB 3S3DB 1DZEA 3EH5B 5H2MA 5AHYA 4JR8A 5J7AA 4XTOA 2AT9A 4CDVA 5H2OA 1FBKA 2YDVA 3S3CB 1R84A 5G28A 5H2JA 4JE9A 5G53A 4GP8B 3ZPQA 4GP4B 1E83A 4D4NA 5G36A 4LDEA 1S8JA 2ZZLA 4CX9A 5H2KA 1KG8A 5G54A 1BRDA 2EI4A 1AT9A 1S8LA 3UG9A 3S8FB 5ITCA 3VHZA 4KLYA 1BM1A 3QBIA 5JJNA 4CDYA 1S52A 3ZQYA 4XT1A 3QDCA 5B6ZA 3AYMA 1X0I1 4D4XA 4BWBA 5H2IA 4GPOA 3HASA 4G7SB 4UHRA 3L1MA 1F50A 3DDLA 4GBRA 5H2PA 3C9LA 3QJTB 1QM8A 4QI1A 1JV6A 4MQTA 4BUOA 2YL3A 3QJQB 3SN6R 3UZCA 3PDSA 1VGOA 5H2HA 3ZTMA 2XLOA 1IW9A 5B0WA 2JAGA 3C9MA 1EKYA 2J9BA 2ZFEA 1VJMA 5JJJA 1XIOA 3OE9A 5KKHA 2R4RA 3IQ5A 3QBGA 3DE8A 3WQJA 3QBLA 5B34A 4EA3A 3QAKA 1RCPA 2XLWA 5AWZA 3REYA 4N6HA 2Y04A 1P8IA 5B6VA 2YCZA 2QPDB 2XLMA 5A44A 5A8EA 5JRAA 4WW3A 4ER9A 5G2AA 4PXKA 1H68A 3IQ6A 3NMKA 4GP5B 4NC3A 1AP9A 4GYCA 3M15A 2XLDA 2RH1A 3TOMA 2YL1A 5AHZA 1GZMA 4J4QA 1U19A 4DJHA 4FAAB 3VRCA 4WGYA 1GUEA 2QLAA 1CWQA 4MBSA 256BA 2YLGA 2R4SA 3UTWA 4JEBA 1E84A 4JEAA 1MQVA 2YLIA 2YL7A 1BRXA 1UCQA 3QVYA 5B2NA 3QJVB 1CPRA 3QBKA 1APCA 3MBVA 3ZEVA 4MQSA 5B6XA 3NMJA 3CODA 4U9DA 4CJOA 4CJGA 4HWLA 1JV7A 1L9HA 4LDOA 3M4BA 5JP7A 4X32A 3S8GB 1S05A 2YKZA 1GQAA 2YCXA 3QJUB 2F93A 4G70B 4WGZA 5JUAA 1QQ3A 1E85A 1X0SA 5F8UA 3QAPA 5TGZA 1S53A 4G71B 3UONA 3BVDB 5A45A 1GU8A 2ZIYA 1JGJA 3X3BA 2KS9A 1XJIA 4IARA 5JT4A 2XM4A 3AYNA 1CGOA 4Y9HA 2Y00A 3D4SA 1P8HA 4G7QB 4HYJA 5BR5A 4EJ4A 2I35A 2YCYA 3OE6A 3M79A 1C8SA 2XL6A 2L6XA 4MD2A 2G87A 5C1MA 3UTVA 3HAOA 3UTYA 3DQBA 2J8WA 3HNLA 4ULVA 1S51A 1YYJA 4L6RA 4A4MA 5B6YA 4XXJA 3ODUA 3QW1A 3ZWIA 1CGNA 2YDOA 3FOPA 1YZCA 5AGFA 3U8PA 2BRDA 2LNLA 5AX0A 1QHJA 1PXRA 3TOLA 4QIDA 1PY6A 3VI0A 3QW0A 4X31A 3NYAA 4XT3A 3X3CA 2WJLA 1Q5IA 1IXFA 5FJGA 5G2CA 4FBZA 4CDAA 4LDLA 4WAVA 3HNJA 2WJKA 4FPDA 3UZAA 1JFPA 2XLHA 3C63A 3PQRA 5G2DA 1C8RA 5DYSA 5ETZA 4BV0A 3CAPA 1TN0A 3HNKA 3EMLA 3HAPA 4PXFA 1F4ZA 3HANA 2XM0A 3V2WA 2XLEA 4L35A 1YYXA 1MGYA 1IW6A 4CIPA 2KSAA 1P8UA 1UAZA 3HAQA 5H2LA 3HARA 5B3IA 4N4YB 1YZAA 5BR2A 2I20A 2YL0A 1E0PA 5JLIA 3S3BB 4TL3A 1EHKB 4XTNA 2I21A 3ZQVA 1NBBA 2QPEB 2YLDA 3PWHA 5DHHA 3VG9A 1M0KA 5H2NA 3PXOA 1R2NA 4K5YA 3KJ6A 4BVNA 2NTUA 1L0MA 1A7VA 2YCWA 3NSBA 3EH4B 3ABWA 1TN5A 2Z55A 3DE9A 4KNFA 3RFMA 5JVEA 4GRVA 4X1HA 4AMJA 1JAFA 4OV0A 5JSLA 1KMEA 4DAJA 5AZDA 2F95A 1E12A 3VVKA 3AM6A 1O0AA 4JQ6A 3NY8A 5JS5A 2VT4A 3FOOA 3ZTZA 2HPYA 4FA7B 3COCA 3A7KA 4IB4A 2J4YA 2M3GA 3M4CA 5JJEA 2CCYA 1S54A 1H2SA
chains in the Genus database with same CATH superfamily
5LWEA 4PACA 3ZPRA 4C3BA 1Z6AA 2NTWA 1YAUO 1M2VA 2VC9A 4YN0B 3HNIA 4PFPA 2R7SA 3NY9A 4OIRF 3G4XA 3C8GA 3S27A 1I4ZA 4JCZA 2ICWG 4FAPB 2YHSA 2Y01A 3BEHA 2QTVA 1BBHA 2OG2A 4XPXA 4ZLDA 4IAQA 4E0HA 3E70C 1J8YF 3NS0A 3UMIA 1M6TA 2DGJA 1YA9A 2VB6A 4P9FA 3V2YA 2LSEA 1CPQA 4UG2A 3B29A 3OAXA 3RQFA 3TULA 3JTLO 1F88A 3I5QA 1H7IA 3P0GA 5B6WA 4HFKB 2QNLA 2WB7A 4AMIA 4EIYA 2KYHA 4O6NA 5AX1A 5EN0A 1L3PA 4BJTA 3NG1A 2KNHA 1ZHWA 3VYWA 2HMZA 2X72A 3JYYA 1BZ4A 2HJMA 4N4WA 2GDCA 3O10A 2IXOA 4HEAJ 5D91A 2R7TA 3DJNB 1QKOA 1M0LA 2Q9CA 1I4YA 2C03A 1ORYA 3GEEA 4XTOA 3RFYA 3T6JA 5H2OA 4DRIB 4PJLA 3IQCA 4LDRA 3DAGA 3W8IA 2OJED 4N6CA 5G36A 2R9RB 4CS7A 4LDEA 4O6MA 5G54A 3S8FB 3B0VC 4BPMA 5ITCA 2XXAB 4BG0A 4U5DE 2PF4E 4U5EE 3QDCA 4XT1A 3EHNA 1NU9C 4BJ5A 3BRJA 3U5SA 4GPOA 5COGA 3C8GB 4UHRA 1ST6A 4E18A 3C9LA 3DM5A 4A4AA 3L8IA 2Q4FA 5DS5A 3QJQB 3L8JA 3PDSA 2NUTA 4NTBA 2VCAA 3ZDLA 3ZTMA 3EH2A 2M4EA 2LCHA 2JAGA 3C9MA 3K1HA 2ZFEA 2FGYA 4JURI 2R4RA 1TFOB 1T6UA 2ZXPA 3CZ6A 1OCCC 5F5HA 3QBLA 4RD9A 4EA3A 2XLWA 2Y04A 1P8IA 2AVKA 3N24A 1JPNA 3JYHA 2QPDB 4ER9A 5G2AA 1H68A 5CI9A 2PNOA 1HE1A 1WGWA 3NMKA 4GYCA 2IXMA 2YL1A 1QLEC 1LE4A 4DJHA 1GUEA 1CWQA 2Y39A 2YLGA 3UTWA 3KPHA 2VCBA 5L3QA 1CGME 4U5HA 1ZHZA 3K1IA 3ZEVA 4MQSA 4MVRA 3NMJA 2P7VA 5KYXA 4U9DA 4HWLA 3VAYA 1F1MA 1L9HA 4LDOA 4IGGA 5L3VA 4MTGA 2LD6A 5GPGB 3LEOA 1XZQA 5KYNA 4JJGA 5JP7A 5AC5A 5A6KA 3ASOC 4YK5A 4W8KA 2F93A 2KSFA 2GA0A 3W8HA 3RIPA 5F8UA 2NUTB 1S53A 3UONA 4MVMA 2W4BA 1JGJA 1XJIA 2Q9BA 3TD7A 2Y00A 3D4SA 4G7QB 5A6JA 1ZHXA 1O3UA 2AP3A 3GODA 4EJ4A 1TQGA 2ZXOA 3M79A 4RBNA 3UTVA 3HAOA 2NUPB 2QUPA 4YL3A 4EWCA 1WWPA 1BDJB 3HNLA 4XLPF 5B6YA 3C8ZA 1VB5A 1M2OA 1SYQA 3JT1A 1YZCA 1NFNA 3RH3A 2OCCC 3RW0A 3K33A 4PJMA 2BRDA 2R03A 2L7AA 1YJGA 2NG1A 1IXFA 5FJGA 2J46A 1R4TA 4LDLA 4WAVA 3X2QC 4DBRA 4CIHA 2WJKA 2HFIA 4MW3A 1GS9A 1W2WA 5G2DA 1C8RA 3MBGA 5ETZA 4OINF 4JC7A 1VLSA 3DM9B 3LUTB 2UUIA 4MS2A 2LP4A 4OIPF 1F4ZA 2XM0A 1YYXA 2HUJA 4U5BE 1IW6A 1UAZA 3I4UA 1NFOA 1YZAA 1YARO 2G62A 1E0PA 1HMOA 3AQBA 4XTNA 2I21A 2QPEB 2YLDA 4J7TA 5DHHA 5KYYA 3TK0A 2DB4A 2HKVA 2LK4A 1M0KA 1LS1A 2BE5F 2P61A 5L0DA 4K5YA 2R7XA 3KJ6A 2ETSA 1L0MA 1KTMA 2Z55A 4AE4B 4AL1A 2JPUA 3RFMA 1WASA 3MX3A 5JVEA 2YWAA 3IPMO 5KYWB 5JSLA 1EI7A 3AG4C 4YL1A 4BJ6A 1S7ZA 1E12A 3AM6A 3NY8A 4DOZA 2C04A 3RVZA 2CYDA 3Q7LA 4HFFB 4IB4A 1HMDA 1VLTA 2M64A 1VYIA 4MVQA 4MVSA 2R7OA 2R7VA 2KSBA 1TWGA 2Y03A 3OEOA 2BL2A 2XSEA 4BEZA 4XTLA 1E86A 1TWAA 1K40A 2EPKX 4BJ1A 1FBBA 1LI5A 4B6IA 2WVOA 3RVYA 1Q0KA 3SYNA 2Y3GA 4EUKB 1SR2A 4XPWA 1Q5JA 1VYKA 2OJQA 2Z73A 1WTYA 4RDAA 1XMEB 4DKLA 1JPJA 3JSZA 1LN6A 1HZXA 1PXSA 3MFNA 1OXBA 4PJJA 3VW7A 3U9MA 2LQGA 3NMIA 4QRYA 3U2MA 1LM3B 4M63A 3F46A 3C62A 3G4ZA 2NPUA 1YA7O 1B68A 2KC3A 2JAFA 4DRHB 1RJ9A 4GYTA 4OD5A 1SF8A 1Z5ZA 1U89A 2A69F 4GEHA 2XL4A 2DYRC 2G3VA 5A6BD 2AWCA 2GWWA 2Q00A 3QJRB 5A6AA 5HSWA 5AHYA 4JR8A 2J0WA 3EGDA 4X0RA 3AG3C 2YQYA 2YDVA 2Y3BA 4YT2A 5H2JA 3ABKC 5COFA 5EHHA 2Q7RA 4D4NA 2JX0A 5H2KA 3EQLF 4JIOA 1S8LA 3UG9A 4F4BA 3ZSUA 1H9GA 4KLYA 4JVSA 1ORJA 2XS1A 5DLJA 5TJ5E 4KNWA 2WVQA 3S84A 2A0UA 4JTAB 5B6ZA 3AYMA 3EGXB 4BWBA 5EGYA 4G7SB 1F50A 2LFDA 2J45A 4NCQA 3QJTB 4E17A 4EBKA 1Y4CA 4MQTA 2YL3A 4MVUA 3SN6R 3UZCA 1TFKB 5H2HA 1PV3A 2XLOA 1IW9A 5B0WA 4PJNA 1D1CA 4OD4A 3U9JA 1EKYA 1H9TA 3DZAA 2GFHA 3LNMB 3OE9A 3SXYA 1RXQA 1RKEA 2VASA 4U5GA 3QAKA 3W2VA 2ZXRA 4N6HA 5A6BA 5CI8A 4IRUA 2A6EF 3ZG1A 2XLMA 5A8EA 5JRAA 3DD7A 3IQ6A 2EPMX 4GP5B 3KYIA 5L0IA 5L0FA 2XLDA 3S9OA 4J4QA 1V74B 3W2WA 4WGYA 2QLAA 4MBSA 256BA 4JEBA 4IJJA 3EJNA 1AVOB 3DXJF 1HW1A 1A7EA 2R05A 1MQVA 2YL7A 1NLXA 1G8XA 2LFFA 2P6VA 5E3AA 3QJVB 2NUPA 1APCA 1OKKD 3MLGA 4LDQA 4ULWA 4WJ0A 3VM6A 4CSAA 2F22A 4JTDB 5F28E 1JV7A 2YRFA 2HMQA 2ASRA 3W4YA 3LLIA 3GM1A 4Z9HA 3S8GB 5AC4A 2YCXA 4O6YA 3AG1C 3QJUB 1Q0FA 4WGZA 4CS8A 2KK1A 3FAJA 5JUAA 4AE4A 1QQ3A 1JMWA 5TGZA 2QE9A 2ZIYA 3Q6MA 2KS9A 3AYNA 1E2XA 1CGOA 2AWYA 5DQTA 3FXHA 1QSPA 1OR2A 4HYJA 2YCYA 1FR0A 4BEJA 4PR9A 3V5XA 4KNVA 2PBEA 2J7PD 3UTYA 4JW1A 2J8WA 4C7OB 1YYJA 5HV9A 2L9JA 4KBLA 3AJMA 1ZU5A 2WL8A 3WHNA 3FOPA 5AGFA 1XZPA 3FMSA 3U8PA 2LNLA 2OQMA 4QIDA 5COMA 3B0PA 2UUHA 1D1BA 3QMKA 5G2CA 4FBZA 4CDAA 3HNJA 4FPDA 1JR8A 4R32A 3UZAA 4XEVA 1QKRA 3TJ6A 2G3KA 2D4UA 3GEIA 3CAPA 1TN0A 3HANA 3V2WA 2XLEA 1MGYA 4JJFA 4MTFA 1RMVA 2X0CA 4MNDA 5B3IA 4LACB 2I20A 2R02A 3NRHA 5JLIA 3ASNC 3VF0A 4DXWA 4C3DA 2YVKA 3A9CA 1PD0A 3PCVA 3PWHA 3JRMO 5KYWA 2KGOA 3FDQA 4HE8D 3S0XA 4Q5SF 5BQHA 3VG9A 5H2NA 3ABMC 3DAFA 3PXOA 4E0IA 3SEOA 4BVNA 2NTUA 2WZLA 2YCWA 1KNYA 2DI3A 3EH4B 2HS5A 4YL0A 1VTMP 3DE9A 3JCUQ 1Q0DA 4AMJA 1V55C 2NSGA 1KMEA 4DAJA 3VVKA 3R7CA 5JS5A 2PFDA 3HKKA 1ZU4A 2HPYA 1RJ9B 4FX5A 3A7KA 5KYXB 2MHRA 2CCYA 2KW3C 2XLVA 1QPUA 1I5NA 4BJ5C 2WVNA 1K04A 3U3FA 1V54C 5ITEA 3SP1A 3US6A 3C8GD 3QJSB 1ZHTA 1BRRA 1VOMA 1M0MA 1FFHA 4G7OF 3K7DA 5DS6A 4UDVA 2L6GA 4DVZA 4QI2A 1OW6A 5B3SC 4J7YA 3RYLA 1WOLA 2ZPAA 2P1AA 2PEDA 1C3WA 1TWHA 3RZEA 2CDQA 5BQIA 3SNHA 4MTOA 3LEVA 4A2NB 2L6HA 1FFTC 4G72B 3PBLA 1BR4A 1MNDA 3ECSA 1IZMA 3PHF2 3QVZA 4Z9IA 4I1MA 2IYLD 5B35A 4XLNF 1LVKA 1OCZC 2OEXA 1KGBA 5K0IA 3S3DB 1DZEA 3EH5B 3JZ0A 1U6HA 3RQGA 2NSFA 2EIMC 2AT9A 4CDVA 1FMWA 5FZTA 4G78A 3PDMP 1FBKA 4DBQA 4ANJA 3K1IC 1N1CA 1R84A 4XEKA 1D1AA 4JE9A 1G5ZA 4GP8B 3ZPQA 4GP4B 1E83A 1LIHA 1S8JA 4N06A 4CX9A 1BRDA 1D0XA 2EI4A 3NYLA 3NYJA 3NYMA 3VHZA 3KH2A 1BM1A 3WG7C 1RKCA 5B1BC 4CDYA 1S52A 3B9QA 2J9UA 3ABLC 2IXNA 1Q0MA 1T6IA 2AU5A 1T9KA 1ZW3A 3A11A 1X0I1 2L81A 1OW8A 5H2IA 3HASA 1J8MF 3SXKA 5H2PA 1RKEB 2H8AA 4QI1A 2E87A 4BUOA 4O79A 3O39A 4PFOA 2PX0A 3MYFA 3C18A 4NTFA 2PX3A 3K66A 1VJMA 2OEVA 5JJJA 3T6BA 4Q7CA 3IQ5A 3QBGA 1D0YA 5B34A 4BEMJ 5AWZA 2H7VC 4E7SA 1JOGA 4U5FE 3O6XA 5A44A 3EHMA 2R25A 4ONSA 4PXKA 3EH1A 3EZHA 3K6BA 1AP9A 3PMRA 1KU2A 3M15A 3TOMA 2HZ8A 5AHZA 1GZMA 1MMDA 2Q3TA 1U19A 3AQCA 4FAAB 3VRCA 3T6GB 1UG7A 4GQHA 4E7ZA 2P0NA 1T5OA 3X1OA 1E84A 1QVXA 2O9XA 3S90A 3AGTA 3EG9B 1BRXA 3QVYA 1OCRC 1GM5A 1ORSC 5B2NA 3MBVA 3LNRA 1JRAA 2MYSA 4IWBA 1ZVZA 3N0TA 4CJGA 3WAQA 2X51A 3B0UX 1HY5A 5D92A 2WZGA 3DI5A 3POVA 1SMYF 3M4BA 3WODF 5T3WA 1GQAA 1ZHYA 2J7PA 1HE9A 2KQ9A 2CNWD 4NQFA 1NG1A 1NU7D 1E85A 3QTHA 1O5HA 3Q7GA 4G71B 5A45A 1LI7A 1OKKA 2W45A 1BR2A 5JT4A 2XM4A 2XS8A 1GGQA 1Q0GA 4Q4ZF 4BJ6C 2I35A 3UR3C 3HTKC 3U3BA 1C8SA 2CW0F 1L7CA 2XL6A 2B0JA 2G87A 2IM8A 3JRTA 3LJBA 1Z3IX 4ULVA 1S51A 4L6RA 4A4MA 4P6IC 3KKBA 3NDBB 4LLEA 4XXJA 3ODUA 4JTCB 1CGNA 4I44A 5AX0A 1PXRA 1QHJA 1HW2A 3VI0A 1BR1A 1D0ZA 3KMIA 3H65A 1MMNA 4XT3A 2XRHA 3X3CA 3UNGC 1Q5IA 2H7OA 4Z9JA 2Z15A 3ZVRA 5L0CA 4W8PA 1JFPA 2XLHA 3C63A 3PQRA 5DYSA 2GAQA 2ZXWC 4DVYP 2EPLX 3HNKA 2KJGA 3EMLA 3B71A 4G7HF 5BUOA 3HAQA 5H2LA 1DOVA 3OA1A 4N4YB 2OKUA 1M57C 3LLKA 4KC9A 3S3BB 2QY9A 4TL3A 1EHKB 3G50A 1LS4A 4AK9A 3I5PA 1NBBA 5DVWA 3OWTA 5KYYB 3HLZA 3UMHA 2V26A 4K1OA 1O87A 1T01A 1R2NA 3V5YA 2DYSC 1A7VA 1OR3A 2Y69C 3H2UA 1A0BA 1TR2A 1TN5A 3ABWA 3V7OA 2LIGA 1Z63A 3CQZA 4K0DA 3V5ZA 4X1HA 2HV6A 4OV0A 1C02A 2OOCA 1G4US 4XPYA 5AZDA 3M1CB 2R7QA 2F95A 1O0AA 1YDIA 2CGEA 3SXZA 2W9YA 3FOOA 3ZTZA 4FA7B 1TWCA 3SZRA 2J4YA 2M3GA 1S54A 2Y3DA 1IW7F 3R2PA 3SXMA 4J32B 1A7DA 2KSYA 1T6QA 4KI2A 4LLCA 2Y02A 3EH3B 3FAPB 3U0CA 3GWNA 3J06A 3L0IA 3RKOF 2HSBA 4HYXA 3DKAA 2XL8A 2FAPB 2I1XA 5E2QA 5L0GA 2J9VA 3EG9A 5DHGA 4CS9C 4FESA 3T45A 3OE8A 3GEHA 4BEYA 4AL0A 1KG9A 3KYJA 5DS4A 5CIVA 4JKVA 1MNEA 4G7RB 4JCHA 1QKPA 2HV7A 1X0K1 3CEXA 3VGAA 2YZSA 3IHUA 3OE0A 1PCXA 4NTAA 1C17M 2A1DD 4U9EA 4FWVA 1FTSA 1MMAA 1WATA 2BC5A 4DRJB 2D5RB 4YWQA 4QI0A 4MD1A 2EILC 3UTXA 2OU6A 1OXKA 2IOQA 1DOWA 3CAXA 2VH3A 3IQTA 4G7ZF 2HJ3A 5H2MA 5J7AA 3GM3A 1VK5A 4IAOA 3NKDA 3UGOA 4DS7E 3S28A 3S3CB 4WABA 5G28A 2JD3A 4CSAC 2TMVP 5G53A 2EPOA 4JRZA 5EK0A 3TQOA 2ZZLA 1KG8A 2J9WA 1FMVA 2V3CC 1AT9A 4YT8A 3GANA 3N2ZB 5A69A 3Q6NA 3CSKA 4MW8A 3QBIA 5JJNA 4U5CE 4XWJA 3ZQYA 2J0XA 3UMKA 5T1DB 5IY5C 4O7GA 3O55A 4D4XA 1LE2A 4LDKA 1M56C 4ZLCA 2MWQA 3L1MA 3DDLA 4GBRA 2VCCA 3T4RA 1QM8A 1JV6A 1Y6DA 3ITFA 3EFOA 1QZXA 2HSQA 3H2VA 1VGOA 2Y3HA 2Q9AA 4G0HA 2B0HA 2A0BA 2J9BA 3LS1A 3QZCA 1R5ID 1XIOA 1Z7Qc 5KKHA 1SZIA 2RD9A 4YT4A 3DE8A 3WQJA 3UGPA 3TJ5A 3F47A 1RCPA 1OQCA 4JZAA 3REYA 2YEVA 4I1OB 4OIOF 5B6VA 2YCZA 4EHPA 4WW3A 4CBEA 3E9VA 2EPNA 2ZD9A 3L34A 4NC3A 3RQEA 2XXAA 1NSGB 2RH1A 2A68F 2A6HF 1LPEA 3U2LA 1YVIA 2R4SA 3ZC4A 2I8BA 4H54A 4JEAA 2YLIA 1YLMA 1UCQA 3DWWA 1CPRA 3QBKA 1MMGA 3C7JA 1Z23A 4XQ1A 5B6XA 3CODA 3GORA 4CJOA 5L0HA 1C03A 5F5FA 4AX2A 1OW7A 4OIQF 3LAYA 3EZIA 4X32A 1S05A 2YKZA 4I3MA 4LERA 4G70B 2WZFA 3JSEO 4PK4A 4MQ9F 1X0SA 3RF3A 3LS0A 3QAPA 3GM2A 3BVDB 1GU8A 4K7BA 4QDLA 3X3BA 3AGUA 4IARA 4Y9HA 1P8HA 5L0JA 1ZZPA 5BR5A 3EPVA 3U8VA 3EGXA 1WN0A 3OE6A 4MD2A 2L6XA 3ZIBA 1ZYRF 5C1MA 4J30B 2IBFA 3DQBA 5E3CA 3QW1A 3ZWIA 2RSEB 3FHDA 2YDOA 4XEFA 3GWLA 2W4MA 3AOUA 3TOLA 1PY6A 1VMAA 3QW0A 4X31A 3DJUB 3LESA 1M2VB 3NYAA 2EIJC 1G4WR 5T3TA 2R7UA 2WJLA 3NKEA 4XTKA 1U0BB 5E33A 2L6FA 3AG2C 1EA8A 3EGDB 4BV0A 5B1AC 3MYIA 3HJCA 5KYUA 3FVYA 3EFOB 1AEPA 5FCLA 3HAPA 4PXFA 4L35A 3KL4A 3DMDA 2I15A 4CIPA 2KSAA 1P8UA 1LKXA 4NY3A 1UFBA 1FAPB 3HARA 5BR2A 2YL0A 4H4KC 4YT5A 1TKNA 1H6GA 1ZW2A 2CNWA 3ZQVA 2PP4A 4C3EA 4CS9A 4CS8C 5BQGA 1AUEA 1V4AA 4C7OA 2EIKC 4DJ9A 3NSBA 4YJWA 4KNFA 1K05A 2R7WA 3IEEA 4GRVA 1JAFA 2H7BA 4P9TA 2IXPA 4EBJA 4MVOA 5DQZA 1PD1A 4MVZA 1NZEA 3T9OA 3S29A 1OCOC 4JQ6A 1FNTc 5KYUB 2VT4A 2R7RA 2FFHA 3COCA 4EBBA 1A41A 3ATPA 2EINC 1EQ1A 3M4CA 4EKWA 5JJEA 1XWJA 1H2SA
chains in the Genus database with same CATH topology
2XLVA 5LWEA 2KSBA 3ZPRA 2Y03A 1QPUA 2NTWA 3HNIA 2KSYA 5ITEA 4BEZA 2Y02A 3EH3B 3NY9A 4XTLA 1E86A 3QJSB 1FBBA 2Y01A 4HYXA 1BRRA 2XL8A 1BBHA 1M0MA 4IAQA 2I1XA 3NS0A 1M6TA 1Q5JA 2Z73A 5DHGA 1XMEB 4DKLA 3V2YA 1LN6A 3T45A 1HZXA 1CPQA 4UG2A 3OE8A 1PXSA 4BEYA 2PEDA 1KG9A 3OAXA 3VW7A 1C3WA 3NMIA 4QRYA 1F88A 3RZEA 3P0GA 4JKVA 1LM3B 4G7RB 5B6WA 1QKPA 3C62A 1X0K1 3VGAA 3OE0A 4AMIA 4EIYA 4U9EA 5AX1A 5EN0A 4G72B 2JAFA 3PBLA 3QVZA 2X72A 2BC5A 4N4WA 5B35A 4MD1A 3UTXA 1QKOA 1KGBA 1M0LA 3QJRB 3S3DB 1DZEA 3EH5B 5H2MA 5AHYA 4JR8A 5J7AA 4XTOA 2AT9A 4CDVA 5H2OA 1FBKA 4DS7E 2YDVA 3S3CB 1R84A 5G28A 5H2JA 4JE9A 5G53A 4GP8B 3ZPQA 4GP4B 1E83A 4D4NA 5G36A 4LDEA 1S8JA 2ZZLA 4CX9A 5H2KA 1KG8A 5G54A 1BRDA 2EI4A 1AT9A 1S8LA 3UG9A 3S8FB 5ITCA 3VHZA 4KLYA 1BM1A 3QBIA 5JJNA 4CDYA 1S52A 3ZQYA 4XT1A 3QDCA 5B6ZA 3AYMA 1X0I1 4D4XA 4BWBA 5H2IA 4GPOA 3HASA 4G7SB 4UHRA 3L1MA 1F50A 3DDLA 4GBRA 5H2PA 3C9LA 3QJTB 1QM8A 4QI1A 1JV6A 4MQTA 4BUOA 2YL3A 3QJQB 3SN6R 3UZCA 3PDSA 1VGOA 5H2HA 3ZTMA 2XLOA 1IW9A 5B0WA 2JAGA 3C9MA 1EKYA 2J9BA 2ZFEA 1VJMA 5JJJA 1XIOA 3OE9A 5KKHA 2R4RA 3IQ5A 3QBGA 3DE8A 3WQJA 3QBLA 5B34A 4EA3A 3QAKA 1RCPA 2XLWA 5AWZA 3REYA 4N6HA 2Y04A 1P8IA 5B6VA 2YCZA 2QPDB 2XLMA 5A44A 5A8EA 5JRAA 4WW3A 4ER9A 5G2AA 4PXKA 1H68A 3IQ6A 3NMKA 4GP5B 4NC3A 1AP9A 4GYCA 3M15A 2XLDA 2RH1A 3TOMA 2YL1A 5AHZA 1GZMA 4J4QA 1U19A 4DJHA 4FAAB 3VRCA 4WGYA 1GUEA 2QLAA 1CWQA 4MBSA 256BA 2YLGA 2R4SA 3UTWA 4JEBA 1E84A 4JEAA 1MQVA 2YLIA 2YL7A 1BRXA 1UCQA 3QVYA 5B2NA 3QJVB 1CPRA 3QBKA 1APCA 3MBVA 3ZEVA 4MQSA 5B6XA 3NMJA 3CODA 4U9DA 4CJOA 4CJGA 4HWLA 1JV7A 1L9HA 4LDOA 3M4BA 5JP7A 4X32A 3S8GB 1S05A 2YKZA 1GQAA 2YCXA 3QJUB 2F93A 4G70B 4WGZA 5JUAA 1QQ3A 1E85A 1X0SA 5F8UA 3QAPA 5TGZA 1S53A 4G71B 3UONA 3BVDB 5A45A 1GU8A 2ZIYA 1JGJA 3X3BA 2KS9A 1XJIA 4IARA 5JT4A 2XM4A 3AYNA 1CGOA 4Y9HA 2Y00A 3D4SA 1P8HA 4G7QB 4HYJA 5BR5A 4EJ4A 2I35A 2YCYA 3OE6A 3M79A 1C8SA 2XL6A 2L6XA 4MD2A 2G87A 5C1MA 3UTVA 3HAOA 3UTYA 3DQBA 2J8WA 3HNLA 4ULVA 1S51A 1YYJA 4L6RA 4A4MA 5B6YA 4XXJA 3ODUA 3QW1A 3ZWIA 1CGNA 2YDOA 3FOPA 1YZCA 5AGFA 3U8PA 2BRDA 2LNLA 5AX0A 1QHJA 1PXRA 3TOLA 4QIDA 1PY6A 3VI0A 3QW0A 4X31A 3NYAA 4XT3A 3X3CA 2WJLA 1Q5IA 1IXFA 5FJGA 5G2CA 4FBZA 4CDAA 4LDLA 4WAVA 3HNJA 2WJKA 4FPDA 3UZAA 1JFPA 2XLHA 3C63A 3PQRA 5G2DA 1C8RA 5DYSA 5ETZA 4BV0A 3CAPA 1TN0A 3HNKA 3EMLA 3HAPA 4PXFA 1F4ZA 3HANA 2XM0A 3V2WA 2XLEA 4L35A 1YYXA 1MGYA 1IW6A 4CIPA 2KSAA 1P8UA 1UAZA 3HAQA 5H2LA 3HARA 5B3IA 4N4YB 1YZAA 5BR2A 2I20A 2YL0A 1E0PA 5JLIA 3S3BB 4TL3A 1EHKB 4XTNA 2I21A 3ZQVA 1NBBA 2QPEB 2YLDA 3PWHA 5DHHA 3VG9A 1M0KA 5H2NA 3PXOA 1R2NA 4K5YA 3KJ6A 4BVNA 2NTUA 1L0MA 1A7VA 2YCWA 3NSBA 3EH4B 3ABWA 1TN5A 2Z55A 3DE9A 4KNFA 3RFMA 5JVEA 4GRVA 4X1HA 4AMJA 1JAFA 4OV0A 5JSLA 1KMEA 4DAJA 5AZDA 2F95A 1E12A 3VVKA 3AM6A 1O0AA 4JQ6A 3NY8A 5JS5A 2VT4A 3FOOA 3ZTZA 2HPYA 4FA7B 3COCA 3A7KA 4IB4A 2J4YA 2M3GA 3M4CA 5JJEA 2CCYA 1S54A 1H2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLV A;  5LWE A;  2KSB A;  3ZPR A;  2Y03 A;  1QPU A;  2NTW A;  3HNI A;  2KSY A;  5ITE A;  4BEZ A;  2Y02 A;  3EH3 B;  3NY9 A;  4XTL A;  1E86 A;  3QJS B;  1FBB A;  2Y01 A;  4HYX A;  1BRR A;  2XL8 A;  1BBH A;  1M0M A;  4IAQ A;  2I1X A;  3NS0 A;  1M6T A;  1Q5J A;  2Z73 A;  5DHG A;  1XME B;  4DKL A;  3V2Y A;  1LN6 A;  3T45 A;  1HZX A;  1CPQ A;  4UG2 A;  3OE8 A;  1PXS A;  4BEY A;  2PED A;  1KG9 A;  3OAX A;  3VW7 A;  1C3W A;  3NMI A;  4QRY A;  1F88 A;  3RZE A;  3P0G A;  4JKV A;  1LM3 B;  4G7R B;  5B6W A;  1QKP A;  3C62 A;  1X0K 1;  3VGA A;  3OE0 A;  4AMI A;  4EIY A;  4U9E A;  5AX1 A;  5EN0 A;  4G72 B;  2JAF A;  3PBL A;  3QVZ A;  2X72 A;  2BC5 A;  4N4W A;  5B35 A;  4MD1 A;  3UTX A;  1QKO A;  1KGB A;  1M0L A;  3QJR B;  3S3D B;  1DZE A;  3EH5 B;  5H2M A;  5AHY A;  4JR8 A;  5J7A A;  4XTO A;  2AT9 A;  4CDV A;  5H2O A;  1FBK A;  2YDV A;  3S3C B;  1R84 A;  5G28 A;  5H2J A;  4JE9 A;  5G53 A;  4GP8 B;  3ZPQ A;  4GP4 B;  1E83 A;  4D4N A;  5G36 A;  4LDE A;  1S8J A;  2ZZL A;  4CX9 A;  5H2K A;  1KG8 A;  5G54 A;  1BRD A;  2EI4 A;  1AT9 A;  1S8L A;  3UG9 A;  3S8F B;  5ITC A;  3VHZ A;  4KLY A;  1BM1 A;  3QBI A;  5JJN A;  4CDY A;  1S52 A;  3ZQY A;  4XT1 A;  3QDC A;  5B6Z A;  3AYM A;  1X0I 1;  4D4X A;  4BWB A;  5H2I A;  4GPO A;  3HAS A;  4G7S B;  4UHR A;  3L1M A;  1F50 A;  3DDL A;  4GBR A;  5H2P A;  3C9L A;  3QJT B;  1QM8 A;  4QI1 A;  1JV6 A;  4MQT A;  4BUO A;  2YL3 A;  3QJQ B;  3SN6 R;  3UZC A;  3PDS A;  1VGO A;  5H2H A;  3ZTM A;  2XLO A;  1IW9 A;  5B0W A;  2JAG A;  3C9M A;  1EKY A;  2J9B A;  2ZFE A;  1VJM A;  5JJJ A;  1XIO A;  3OE9 A;  5KKH A;  2R4R A;  3IQ5 A;  3QBG A;  3DE8 A;  3WQJ A;  3QBL A;  5B34 A;  4EA3 A;  3QAK A;  1RCP A;  2XLW A;  5AWZ A;  3REY A;  4N6H A;  2Y04 A;  1P8I A;  5B6V A;  2YCZ A;  2QPD B;  2XLM A;  5A44 A;  5A8E A;  5JRA A;  4WW3 A;  4ER9 A;  5G2A A;  4PXK A;  1H68 A;  3IQ6 A;  3NMK A;  4GP5 B;  4NC3 A;  1AP9 A;  4GYC A;  3M15 A;  2XLD A;  2RH1 A;  3TOM A;  2YL1 A;  5AHZ A;  1GZM A;  4J4Q A;  1U19 A;  4DJH A;  4FAA B;  3VRC A;  4WGY A;  1GUE A;  2QLA A;  1CWQ A;  4MBS A;  256B A;  2YLG A;  2R4S A;  3UTW A;  4JEB A;  1E84 A;  4JEA A;  1MQV A;  2YLI A;  2YL7 A;  1BRX A;  1UCQ A;  3QVY A;  5B2N A;  3QJV B;  1CPR A;  3QBK A;  1APC A;  3MBV A;  3ZEV A;  4MQS A;  5B6X A;  3NMJ A;  3COD A;  4U9D A;  4CJO A;  4CJG A;  4HWL A;  1JV7 A;  1L9H A;  4LDO A;  3M4B A;  5JP7 A;  4X32 A;  3S8G B;  1S05 A;  2YKZ A;  1GQA A;  2YCX A;  3QJU B;  2F93 A;  4G70 B;  4WGZ A;  5JUA A;  1QQ3 A;  1E85 A;  1X0S A;  5F8U A;  3QAP A;  5TGZ A;  1S53 A;  4G71 B;  3UON A;  3BVD B;  5A45 A;  1GU8 A;  2ZIY A;  1JGJ A;  3X3B A;  2KS9 A;  1XJI A;  4IAR A;  5JT4 A;  2XM4 A;  3AYN A;  1CGO A;  4Y9H A;  2Y00 A;  3D4S A;  1P8H A;  4G7Q B;  4HYJ A;  5BR5 A;  4EJ4 A;  2I35 A;  2YCY A;  3OE6 A;  3M79 A;  1C8S A;  2XL6 A;  2L6X A;  4MD2 A;  2G87 A;  5C1M A;  3UTV A;  3HAO A;  3UTY A;  3DQB A;  2J8W A;  3HNL A;  4ULV A;  1S51 A;  1YYJ A;  4L6R A;  4A4M A;  5B6Y A;  4XXJ A;  3ODU A;  3QW1 A;  3ZWI A;  1CGN A;  2YDO A;  3FOP A;  1YZC A;  5AGF A;  3U8P A;  2BRD A;  2LNL A;  5AX0 A;  1QHJ A;  1PXR A;  3TOL A;  4QID A;  1PY6 A;  3VI0 A;  3QW0 A;  4X31 A;  3NYA A;  4XT3 A;  3X3C A;  2WJL A;  1Q5I A;  1IXF A;  5FJG A;  5G2C A;  4FBZ A;  4CDA A;  4LDL A;  4WAV A;  3HNJ A;  2WJK A;  4FPD A;  3UZA A;  1JFP A;  2XLH A;  3C63 A;  3PQR A;  5G2D A;  1C8R A;  5DYS A;  5ETZ A;  4BV0 A;  3CAP A;  1TN0 A;  3HNK A;  3EML A;  3HAP A;  4PXF A;  1F4Z A;  3HAN A;  2XM0 A;  3V2W A;  2XLE A;  4L35 A;  1YYX A;  1MGY A;  1IW6 A;  4CIP A;  2KSA A;  1P8U A;  1UAZ A;  3HAQ A;  5H2L A;  3HAR A;  5B3I A;  4N4Y B;  1YZA A;  5BR2 A;  2I20 A;  2YL0 A;  1E0P A;  5JLI A;  3S3B B;  4TL3 A;  1EHK B;  4XTN A;  2I21 A;  3ZQV A;  1NBB A;  2QPE B;  2YLD A;  3PWH A;  5DHH A;  3VG9 A;  1M0K A;  5H2N A;  3PXO A;  1R2N A;  4K5Y A;  3KJ6 A;  4BVN A;  2NTU A;  1L0M A;  1A7V A;  2YCW A;  3NSB A;  3EH4 B;  3ABW A;  1TN5 A;  2Z55 A;  3DE9 A;  4KNF A;  3RFM A;  5JVE A;  4GRV A;  4X1H A;  4AMJ A;  1JAF A;  4OV0 A;  5JSL A;  1KME A;  4DAJ A;  5AZD A;  2F95 A;  1E12 A;  3VVK A;  3AM6 A;  1O0A A;  4JQ6 A;  3NY8 A;  5JS5 A;  2VT4 A;  3FOO A;  3ZTZ A;  2HPY A;  4FA7 B;  3COC A;  3A7K A;  4IB4 A;  2J4Y A;  2M3G A;  3M4C A;  5JJE A;  2CCY A;  1S54 A;  1H2S A; 
#chains in the Genus database with same CATH topology
 5LWE A;  4PAC A;  3ZPR A;  4C3B A;  1Z6A A;  2NTW A;  1YAU O;  1M2V A;  2VC9 A;  4YN0 B;  3HNI A;  4PFP A;  2R7S A;  3NY9 A;  4OIR F;  3G4X A;  3C8G A;  3S27 A;  1I4Z A;  4JCZ A;  2ICW G;  4FAP B;  2YHS A;  2Y01 A;  3BEH A;  2QTV A;  1BBH A;  2OG2 A;  4XPX A;  4ZLD A;  4IAQ A;  4E0H A;  3E70 C;  1J8Y F;  3NS0 A;  3UMI A;  1M6T A;  2DGJ A;  1YA9 A;  2VB6 A;  4P9F A;  3V2Y A;  2LSE A;  1CPQ A;  4UG2 A;  3B29 A;  3OAX A;  3RQF A;  3TUL A;  3JTL O;  1F88 A;  3I5Q A;  1H7I A;  3P0G A;  5B6W A;  4HFK B;  2QNL A;  2WB7 A;  4AMI A;  4EIY A;  2KYH A;  4O6N A;  5AX1 A;  5EN0 A;  1L3P A;  4BJT A;  3NG1 A;  2KNH A;  1ZHW A;  3VYW A;  2HMZ A;  2X72 A;  3JYY A;  1BZ4 A;  2HJM A;  4N4W A;  2GDC A;  3O10 A;  2IXO A;  4HEA J;  5D91 A;  2R7T A;  3DJN B;  1QKO A;  1M0L A;  2Q9C A;  1I4Y A;  2C03 A;  1ORY A;  3GEE A;  4XTO A;  3RFY A;  3T6J A;  5H2O A;  4DRI B;  4PJL A;  3IQC A;  4LDR A;  3DAG A;  3W8I A;  2OJE D;  4N6C A;  5G36 A;  2R9R B;  4CS7 A;  4LDE A;  4O6M A;  5G54 A;  3S8F B;  3B0V C;  4BPM A;  5ITC A;  2XXA B;  4BG0 A;  4U5D E;  2PF4 E;  4U5E E;  3QDC A;  4XT1 A;  3EHN A;  1NU9 C;  4BJ5 A;  3BRJ A;  3U5S A;  4GPO A;  5COG A;  3C8G B;  4UHR A;  1ST6 A;  4E18 A;  3C9L A;  3DM5 A;  4A4A A;  3L8I A;  2Q4F A;  5DS5 A;  3QJQ B;  3L8J A;  3PDS A;  2NUT A;  4NTB A;  2VCA A;  3ZDL A;  3ZTM A;  3EH2 A;  2M4E A;  2LCH A;  2JAG A;  3C9M A;  3K1H A;  2ZFE A;  2FGY A;  4JUR I;  2R4R A;  1TFO B;  1T6U A;  2ZXP A;  3CZ6 A;  1OCC C;  5F5H A;  3QBL A;  4RD9 A;  4EA3 A;  2XLW A;  2Y04 A;  1P8I A;  2AVK A;  3N24 A;  1JPN A;  3JYH A;  2QPD B;  4ER9 A;  5G2A A;  1H68 A;  5CI9 A;  2PNO A;  1HE1 A;  1WGW A;  3NMK A;  4GYC A;  2IXM A;  2YL1 A;  1QLE C;  1LE4 A;  4DJH A;  1GUE A;  1CWQ A;  2Y39 A;  2YLG A;  3UTW A;  3KPH A;  2VCB A;  5L3Q A;  1CGM E;  4U5H A;  1ZHZ A;  3K1I A;  3ZEV A;  4MQS A;  4MVR A;  3NMJ A;  2P7V A;  5KYX A;  4U9D A;  4HWL A;  3VAY A;  1F1M A;  1L9H A;  4LDO A;  4IGG A;  5L3V A;  4MTG A;  2LD6 A;  5GPG B;  3LEO A;  1XZQ A;  5KYN A;  4JJG A;  5JP7 A;  5AC5 A;  5A6K A;  3ASO C;  4YK5 A;  4W8K A;  2F93 A;  2KSF A;  2GA0 A;  3W8H A;  3RIP A;  5F8U A;  2NUT B;  1S53 A;  3UON A;  4MVM A;  2W4B A;  1JGJ A;  1XJI A;  2Q9B A;  3TD7 A;  2Y00 A;  3D4S A;  4G7Q B;  5A6J A;  1ZHX A;  1O3U A;  2AP3 A;  3GOD A;  4EJ4 A;  1TQG A;  2ZXO A;  3M79 A;  4RBN A;  3UTV A;  3HAO A;  2NUP B;  2QUP A;  4YL3 A;  4EWC A;  1WWP A;  1BDJ B;  3HNL A;  4XLP F;  5B6Y A;  3C8Z A;  1VB5 A;  1M2O A;  1SYQ A;  3JT1 A;  1YZC A;  1NFN A;  3RH3 A;  2OCC C;  3RW0 A;  3K33 A;  4PJM A;  2BRD A;  2R03 A;  2L7A A;  1YJG A;  2NG1 A;  1IXF A;  5FJG A;  2J46 A;  1R4T A;  4LDL A;  4WAV A;  3X2Q C;  4DBR A;  4CIH A;  2WJK A;  2HFI A;  4MW3 A;  1GS9 A;  1W2W A;  5G2D A;  1C8R A;  3MBG A;  5ETZ A;  4OIN F;  4JC7 A;  1VLS A;  3DM9 B;  3LUT B;  2UUI A;  4MS2 A;  2LP4 A;  4OIP F;  1F4Z A;  2XM0 A;  1YYX A;  2HUJ A;  4U5B E;  1IW6 A;  1UAZ A;  3I4U A;  1NFO A;  1YZA A;  1YAR O;  2G62 A;  1E0P A;  1HMO A;  3AQB A;  4XTN A;  2I21 A;  2QPE B;  2YLD A;  4J7T A;  5DHH A;  5KYY A;  3TK0 A;  2DB4 A;  2HKV A;  2LK4 A;  1M0K A;  1LS1 A;  2BE5 F;  2P61 A;  5L0D A;  4K5Y A;  2R7X A;  3KJ6 A;  2ETS A;  1L0M A;  1KTM A;  2Z55 A;  4AE4 B;  4AL1 A;  2JPU A;  3RFM A;  1WAS A;  3MX3 A;  5JVE A;  2YWA A;  3IPM O;  5KYW B;  5JSL A;  1EI7 A;  3AG4 C;  4YL1 A;  4BJ6 A;  1S7Z A;  1E12 A;  3AM6 A;  3NY8 A;  4DOZ A;  2C04 A;  3RVZ A;  2CYD A;  3Q7L A;  4HFF B;  4IB4 A;  1HMD A;  1VLT A;  2M64 A;  1VYI A;  4MVQ A;  4MVS A;  2R7O A;  2R7V A;  2KSB A;  1TWG A;  2Y03 A;  3OEO A;  2BL2 A;  2XSE A;  4BEZ A;  4XTL A;  1E86 A;  1TWA A;  1K40 A;  2EPK X;  4BJ1 A;  1FBB A;  1LI5 A;  4B6I A;  2WVO A;  3RVY A;  1Q0K A;  3SYN A;  2Y3G A;  4EUK B;  1SR2 A;  4XPW A;  1Q5J A;  1VYK A;  2OJQ A;  2Z73 A;  1WTY A;  4RDA A;  1XME B;  4DKL A;  1JPJ A;  3JSZ A;  1LN6 A;  1HZX A;  1PXS A;  3MFN A;  1OXB A;  4PJJ A;  3VW7 A;  3U9M A;  2LQG A;  3NMI A;  4QRY A;  3U2M A;  1LM3 B;  4M63 A;  3F46 A;  3C62 A;  3G4Z A;  2NPU A;  1YA7 O;  1B68 A;  2KC3 A;  2JAF A;  4DRH B;  1RJ9 A;  4GYT A;  4OD5 A;  1SF8 A;  1Z5Z A;  1U89 A;  2A69 F;  4GEH A;  2XL4 A;  2DYR C;  2G3V A;  5A6B D;  2AWC A;  2GWW A;  2Q00 A;  3QJR B;  5A6A A;  5HSW A;  5AHY A;  4JR8 A;  2J0W A;  3EGD A;  4X0R A;  3AG3 C;  2YQY A;  2YDV A;  2Y3B A;  4YT2 A;  5H2J A;  3ABK C;  5COF A;  5EHH A;  2Q7R A;  4D4N A;  2JX0 A;  5H2K A;  3EQL F;  4JIO A;  1S8L A;  3UG9 A;  4F4B A;  3ZSU A;  1H9G A;  4KLY A;  4JVS A;  1ORJ A;  2XS1 A;  5DLJ A;  5TJ5 E;  4KNW A;  2WVQ A;  3S84 A;  2A0U A;  4JTA B;  5B6Z A;  3AYM A;  3EGX B;  4BWB A;  5EGY A;  4G7S B;  1F50 A;  2LFD A;  2J45 A;  4NCQ A;  3QJT B;  4E17 A;  4EBK A;  1Y4C A;  4MQT A;  2YL3 A;  4MVU A;  3SN6 R;  3UZC A;  1TFK B;  5H2H A;  1PV3 A;  2XLO A;  1IW9 A;  5B0W A;  4PJN A;  1D1C A;  4OD4 A;  3U9J A;  1EKY A;  1H9T A;  3DZA A;  2GFH A;  3LNM B;  3OE9 A;  3SXY A;  1RXQ A;  1RKE A;  2VAS A;  4U5G A;  3QAK A;  3W2V A;  2ZXR A;  4N6H A;  5A6B A;  5CI8 A;  4IRU A;  2A6E F;  3ZG1 A;  2XLM A;  5A8E A;  5JRA A;  3DD7 A;  3IQ6 A;  2EPM X;  4GP5 B;  3KYI A;  5L0I A;  5L0F A;  2XLD A;  3S9O A;  4J4Q A;  1V74 B;  3W2W A;  4WGY A;  2QLA A;  4MBS A;  256B A;  4JEB A;  4IJJ A;  3EJN A;  1AVO B;  3DXJ F;  1HW1 A;  1A7E A;  2R05 A;  1MQV A;  2YL7 A;  1NLX A;  1G8X A;  2LFF A;  2P6V A;  5E3A A;  3QJV B;  2NUP A;  1APC A;  1OKK D;  3MLG A;  4LDQ A;  4ULW A;  4WJ0 A;  3VM6 A;  4CSA A;  2F22 A;  4JTD B;  5F28 E;  1JV7 A;  2YRF A;  2HMQ A;  2ASR A;  3W4Y A;  3LLI A;  3GM1 A;  4Z9H A;  3S8G B;  5AC4 A;  2YCX A;  4O6Y A;  3AG1 C;  3QJU B;  1Q0F A;  4WGZ A;  4CS8 A;  2KK1 A;  3FAJ A;  5JUA A;  4AE4 A;  1QQ3 A;  1JMW A;  5TGZ A;  2QE9 A;  2ZIY A;  3Q6M A;  2KS9 A;  3AYN A;  1E2X A;  1CGO A;  2AWY A;  5DQT A;  3FXH A;  1QSP A;  1OR2 A;  4HYJ A;  2YCY A;  1FR0 A;  4BEJ A;  4PR9 A;  3V5X A;  4KNV A;  2PBE A;  2J7P D;  3UTY A;  4JW1 A;  2J8W A;  4C7O B;  1YYJ A;  5HV9 A;  2L9J A;  4KBL A;  3AJM A;  1ZU5 A;  2WL8 A;  3WHN A;  3FOP A;  5AGF A;  1XZP A;  3FMS A;  3U8P A;  2LNL A;  2OQM A;  4QID A;  5COM A;  3B0P A;  2UUH A;  1D1B A;  3QMK A;  5G2C A;  4FBZ A;  4CDA A;  3HNJ A;  4FPD A;  1JR8 A;  4R32 A;  3UZA A;  4XEV A;  1QKR A;  3TJ6 A;  2G3K A;  2D4U A;  3GEI A;  3CAP A;  1TN0 A;  3HAN A;  3V2W A;  2XLE A;  1MGY A;  4JJF A;  4MTF A;  1RMV A;  2X0C A;  4MND A;  5B3I A;  4LAC B;  2I20 A;  2R02 A;  3NRH A;  5JLI A;  3ASN C;  3VF0 A;  4DXW A;  4C3D A;  2YVK A;  3A9C A;  1PD0 A;  3PCV A;  3PWH A;  3JRM O;  5KYW A;  2KGO A;  3FDQ A;  4HE8 D;  3S0X A;  4Q5S F;  5BQH A;  3VG9 A;  5H2N A;  3ABM C;  3DAF A;  3PXO A;  4E0I A;  3SEO A;  4BVN A;  2NTU A;  2WZL A;  2YCW A;  1KNY A;  2DI3 A;  3EH4 B;  2HS5 A;  4YL0 A;  1VTM P;  3DE9 A;  3JCU Q;  1Q0D A;  4AMJ A;  1V55 C;  2NSG A;  1KME A;  4DAJ A;  3VVK A;  3R7C A;  5JS5 A;  2PFD A;  3HKK A;  1ZU4 A;  2HPY A;  1RJ9 B;  4FX5 A;  3A7K A;  5KYX B;  2MHR A;  2CCY A;  2KW3 C;  2XLV A;  1QPU A;  1I5N A;  4BJ5 C;  2WVN A;  1K04 A;  3U3F A;  1V54 C;  5ITE A;  3SP1 A;  3US6 A;  3C8G D;  3QJS B;  1ZHT A;  1BRR A;  1VOM A;  1M0M A;  1FFH A;  4G7O F;  3K7D A;  5DS6 A;  4UDV A;  2L6G A;  4DVZ A;  4QI2 A;  1OW6 A;  5B3S C;  4J7Y A;  3RYL A;  1WOL A;  2ZPA A;  2P1A A;  2PED A;  1C3W A;  1TWH A;  3RZE A;  2CDQ A;  5BQI A;  3SNH A;  4MTO A;  3LEV A;  4A2N B;  2L6H A;  1FFT C;  4G72 B;  3PBL A;  1BR4 A;  1MND A;  3ECS A;  1IZM A;  3PHF 2;  3QVZ A;  4Z9I A;  4I1M A;  2IYL D;  5B35 A;  4XLN F;  1LVK A;  1OCZ C;  2OEX A;  1KGB A;  5K0I A;  3S3D B;  1DZE A;  3EH5 B;  3JZ0 A;  1U6H A;  3RQG A;  2NSF A;  2EIM C;  2AT9 A;  4CDV A;  1FMW A;  5FZT A;  4G78 A;  3PDM P;  1FBK A;  4DBQ A;  4ANJ A;  3K1I C;  1N1C A;  1R84 A;  4XEK A;  1D1A A;  4JE9 A;  1G5Z A;  4GP8 B;  3ZPQ A;  4GP4 B;  1E83 A;  1LIH A;  1S8J A;  4N06 A;  4CX9 A;  1BRD A;  1D0X A;  2EI4 A;  3NYL A;  3NYJ A;  3NYM A;  3VHZ A;  3KH2 A;  1BM1 A;  3WG7 C;  1RKC A;  5B1B C;  4CDY A;  1S52 A;  3B9Q A;  2J9U A;  3ABL C;  2IXN A;  1Q0M A;  1T6I A;  2AU5 A;  1T9K A;  1ZW3 A;  3A11 A;  1X0I 1;  2L81 A;  1OW8 A;  5H2I A;  3HAS A;  1J8M F;  3SXK A;  5H2P A;  1RKE B;  2H8A A;  4QI1 A;  2E87 A;  4BUO A;  4O79 A;  3O39 A;  4PFO A;  2PX0 A;  3MYF A;  3C18 A;  4NTF A;  2PX3 A;  3K66 A;  1VJM A;  2OEV A;  5JJJ A;  3T6B A;  4Q7C A;  3IQ5 A;  3QBG A;  1D0Y A;  5B34 A;  4BEM J;  5AWZ A;  2H7V C;  4E7S A;  1JOG A;  4U5F E;  3O6X A;  5A44 A;  3EHM A;  2R25 A;  4ONS A;  4PXK A;  3EH1 A;  3EZH A;  3K6B A;  1AP9 A;  3PMR A;  1KU2 A;  3M15 A;  3TOM A;  2HZ8 A;  5AHZ A;  1GZM A;  1MMD A;  2Q3T A;  1U19 A;  3AQC A;  4FAA B;  3VRC A;  3T6G B;  1UG7 A;  4GQH A;  4E7Z A;  2P0N A;  1T5O A;  3X1O A;  1E84 A;  1QVX A;  2O9X A;  3S90 A;  3AGT A;  3EG9 B;  1BRX A;  3QVY A;  1OCR C;  1GM5 A;  1ORS C;  5B2N A;  3MBV A;  3LNR A;  1JRA A;  2MYS A;  4IWB A;  1ZVZ A;  3N0T A;  4CJG A;  3WAQ A;  2X51 A;  3B0U X;  1HY5 A;  5D92 A;  2WZG A;  3DI5 A;  3POV A;  1SMY F;  3M4B A;  3WOD F;  5T3W A;  1GQA A;  1ZHY A;  2J7P A;  1HE9 A;  2KQ9 A;  2CNW D;  4NQF A;  1NG1 A;  1NU7 D;  1E85 A;  3QTH A;  1O5H A;  3Q7G A;  4G71 B;  5A45 A;  1LI7 A;  1OKK A;  2W45 A;  1BR2 A;  5JT4 A;  2XM4 A;  2XS8 A;  1GGQ A;  1Q0G A;  4Q4Z F;  4BJ6 C;  2I35 A;  3UR3 C;  3HTK C;  3U3B A;  1C8S A;  2CW0 F;  1L7C A;  2XL6 A;  2B0J A;  2G87 A;  2IM8 A;  3JRT A;  3LJB A;  1Z3I X;  4ULV A;  1S51 A;  4L6R A;  4A4M A;  4P6I C;  3KKB A;  3NDB B;  4LLE A;  4XXJ A;  3ODU A;  4JTC B;  1CGN A;  4I44 A;  5AX0 A;  1PXR A;  1QHJ A;  1HW2 A;  3VI0 A;  1BR1 A;  1D0Z A;  3KMI A;  3H65 A;  1MMN A;  4XT3 A;  2XRH A;  3X3C A;  3UNG C;  1Q5I A;  2H7O A;  4Z9J A;  2Z15 A;  3ZVR A;  5L0C A;  4W8P A;  1JFP A;  2XLH A;  3C63 A;  3PQR A;  5DYS A;  2GAQ A;  2ZXW C;  4DVY P;  2EPL X;  3HNK A;  2KJG A;  3EML A;  3B71 A;  4G7H F;  5BUO A;  3HAQ A;  5H2L A;  1DOV A;  3OA1 A;  4N4Y B;  2OKU A;  1M57 C;  3LLK A;  4KC9 A;  3S3B B;  2QY9 A;  4TL3 A;  1EHK B;  3G50 A;  1LS4 A;  4AK9 A;  3I5P A;  1NBB A;  5DVW A;  3OWT A;  5KYY B;  3HLZ A;  3UMH A;  2V26 A;  4K1O A;  1O87 A;  1T01 A;  1R2N A;  3V5Y A;  2DYS C;  1A7V A;  1OR3 A;  2Y69 C;  3H2U A;  1A0B A;  1TR2 A;  1TN5 A;  3ABW A;  3V7O A;  2LIG A;  1Z63 A;  3CQZ A;  4K0D A;  3V5Z A;  4X1H A;  2HV6 A;  4OV0 A;  1C02 A;  2OOC A;  1G4U S;  4XPY A;  5AZD A;  3M1C B;  2R7Q A;  2F95 A;  1O0A A;  1YDI A;  2CGE A;  3SXZ A;  2W9Y A;  3FOO A;  3ZTZ A;  4FA7 B;  1TWC A;  3SZR A;  2J4Y A;  2M3G A;  1S54 A;  2Y3D A;  1IW7 F;  3R2P A;  3SXM A;  4J32 B;  1A7D A;  2KSY A;  1T6Q A;  4KI2 A;  4LLC A;  2Y02 A;  3EH3 B;  3FAP B;  3U0C A;  3GWN A;  3J06 A;  3L0I A;  3RKO F;  2HSB A;  4HYX A;  3DKA A;  2XL8 A;  2FAP B;  2I1X A;  5E2Q A;  5L0G A;  2J9V A;  3EG9 A;  5DHG A;  4CS9 C;  4FES A;  3T45 A;  3OE8 A;  3GEH A;  4BEY A;  4AL0 A;  1KG9 A;  3KYJ A;  5DS4 A;  5CIV A;  4JKV A;  1MNE A;  4G7R B;  4JCH A;  1QKP A;  2HV7 A;  1X0K 1;  3CEX A;  3VGA A;  2YZS A;  3IHU A;  3OE0 A;  1PCX A;  4NTA A;  1C17 M;  2A1D D;  4U9E A;  4FWV A;  1FTS A;  1MMA A;  1WAT A;  2BC5 A;  4DRJ B;  2D5R B;  4YWQ A;  4QI0 A;  4MD1 A;  2EIL C;  3UTX A;  2OU6 A;  1OXK A;  2IOQ A;  1DOW A;  3CAX A;  2VH3 A;  3IQT A;  4G7Z F;  2HJ3 A;  5H2M A;  5J7A A;  3GM3 A;  1VK5 A;  4IAO A;  3NKD A;  3UGO A;  4DS7 E;  3S28 A;  3S3C B;  4WAB A;  5G28 A;  2JD3 A;  4CSA C;  2TMV P;  5G53 A;  2EPO A;  4JRZ A;  5EK0 A;  3TQO A;  2ZZL A;  1KG8 A;  2J9W A;  1FMV A;  2V3C C;  1AT9 A;  4YT8 A;  3GAN A;  3N2Z B;  5A69 A;  3Q6N A;  3CSK A;  4MW8 A;  3QBI A;  5JJN A;  4U5C E;  4XWJ A;  3ZQY A;  2J0X A;  3UMK A;  5T1D B;  5IY5 C;  4O7G A;  3O55 A;  4D4X A;  1LE2 A;  4LDK A;  1M56 C;  4ZLC A;  2MWQ A;  3L1M A;  3DDL A;  4GBR A;  2VCC A;  3T4R A;  1QM8 A;  1JV6 A;  1Y6D A;  3ITF A;  3EFO A;  1QZX A;  2HSQ A;  3H2V A;  1VGO A;  2Y3H A;  2Q9A A;  4G0H A;  2B0H A;  2A0B A;  2J9B A;  3LS1 A;  3QZC A;  1R5I D;  1XIO A;  1Z7Q c;  5KKH A;  1SZI A;  2RD9 A;  4YT4 A;  3DE8 A;  3WQJ A;  3UGP A;  3TJ5 A;  3F47 A;  1RCP A;  1OQC A;  4JZA A;  3REY A;  2YEV A;  4I1O B;  4OIO F;  5B6V A;  2YCZ A;  4EHP A;  4WW3 A;  4CBE A;  3E9V A;  2EPN A;  2ZD9 A;  3L34 A;  4NC3 A;  3RQE A;  2XXA A;  1NSG B;  2RH1 A;  2A68 F;  2A6H F;  1LPE A;  3U2L A;  1YVI A;  2R4S A;  3ZC4 A;  2I8B A;  4H54 A;  4JEA A;  2YLI A;  1YLM A;  1UCQ A;  3DWW A;  1CPR A;  3QBK A;  1MMG A;  3C7J A;  1Z23 A;  4XQ1 A;  5B6X A;  3COD A;  3GOR A;  4CJO A;  5L0H A;  1C03 A;  5F5F A;  4AX2 A;  1OW7 A;  4OIQ F;  3LAY A;  3EZI A;  4X32 A;  1S05 A;  2YKZ A;  4I3M A;  4LER A;  4G70 B;  2WZF A;  3JSE O;  4PK4 A;  4MQ9 F;  1X0S A;  3RF3 A;  3LS0 A;  3QAP A;  3GM2 A;  3BVD B;  1GU8 A;  4K7B A;  4QDL A;  3X3B A;  3AGU A;  4IAR A;  4Y9H A;  1P8H A;  5L0J A;  1ZZP A;  5BR5 A;  3EPV A;  3U8V A;  3EGX A;  1WN0 A;  3OE6 A;  4MD2 A;  2L6X A;  3ZIB A;  1ZYR F;  5C1M A;  4J30 B;  2IBF A;  3DQB A;  5E3C A;  3QW1 A;  3ZWI A;  2RSE B;  3FHD A;  2YDO A;  4XEF A;  3GWL A;  2W4M A;  3AOU A;  3TOL A;  1PY6 A;  1VMA A;  3QW0 A;  4X31 A;  3DJU B;  3LES A;  1M2V B;  3NYA A;  2EIJ C;  1G4W R;  5T3T A;  2R7U A;  2WJL A;  3NKE A;  4XTK A;  1U0B B;  5E33 A;  2L6F A;  3AG2 C;  1EA8 A;  3EGD B;  4BV0 A;  5B1A C;  3MYI A;  3HJC A;  5KYU A;  3FVY A;  3EFO B;  1AEP A;  5FCL A;  3HAP A;  4PXF A;  4L35 A;  3KL4 A;  3DMD A;  2I15 A;  4CIP A;  2KSA A;  1P8U A;  1LKX A;  4NY3 A;  1UFB A;  1FAP B;  3HAR A;  5BR2 A;  2YL0 A;  4H4K C;  4YT5 A;  1TKN A;  1H6G A;  1ZW2 A;  2CNW A;  3ZQV A;  2PP4 A;  4C3E A;  4CS9 A;  4CS8 C;  5BQG A;  1AUE A;  1V4A A;  4C7O A;  2EIK C;  4DJ9 A;  3NSB A;  4YJW A;  4KNF A;  1K05 A;  2R7W A;  3IEE A;  4GRV A;  1JAF A;  2H7B A;  4P9T A;  2IXP A;  4EBJ A;  4MVO A;  5DQZ A;  1PD1 A;  4MVZ A;  1NZE A;  3T9O A;  3S29 A;  1OCO C;  4JQ6 A;  1FNT c;  5KYU B;  2VT4 A;  2R7R A;  2FFH A;  3COC A;  4EBB A;  1A41 A;  3ATP A;  2EIN C;  1EQ1 A;  3M4C A;  4EKW A;  5JJE A;  1XWJ A;  1H2S A; 
#chains in the Genus database with same CATH homology
 2XLV A;  5LWE A;  2KSB A;  3ZPR A;  2Y03 A;  1QPU A;  2NTW A;  3HNI A;  2KSY A;  5ITE A;  4BEZ A;  2Y02 A;  3EH3 B;  3NY9 A;  4XTL A;  1E86 A;  3QJS B;  1FBB A;  2Y01 A;  4HYX A;  1BRR A;  2XL8 A;  1BBH A;  1M0M A;  4IAQ A;  2I1X A;  3NS0 A;  1M6T A;  1Q5J A;  2Z73 A;  5DHG A;  1XME B;  4DKL A;  3V2Y A;  1LN6 A;  3T45 A;  1HZX A;  1CPQ A;  4UG2 A;  3OE8 A;  1PXS A;  4BEY A;  2PED A;  1KG9 A;  3OAX A;  3VW7 A;  1C3W A;  3NMI A;  4QRY A;  1F88 A;  3RZE A;  3P0G A;  4JKV A;  1LM3 B;  4G7R B;  5B6W A;  1QKP A;  3C62 A;  1X0K 1;  3VGA A;  3OE0 A;  4AMI A;  4EIY A;  4U9E A;  5AX1 A;  5EN0 A;  4G72 B;  2JAF A;  3PBL A;  3QVZ A;  2X72 A;  2BC5 A;  4N4W A;  5B35 A;  4MD1 A;  3UTX A;  1QKO A;  1KGB A;  1M0L A;  3QJR B;  3S3D B;  1DZE A;  3EH5 B;  5H2M A;  5AHY A;  4JR8 A;  5J7A A;  4XTO A;  2AT9 A;  4CDV A;  5H2O A;  1FBK A;  4DS7 E;  2YDV A;  3S3C B;  1R84 A;  5G28 A;  5H2J A;  4JE9 A;  5G53 A;  4GP8 B;  3ZPQ A;  4GP4 B;  1E83 A;  4D4N A;  5G36 A;  4LDE A;  1S8J A;  2ZZL A;  4CX9 A;  5H2K A;  1KG8 A;  5G54 A;  1BRD A;  2EI4 A;  1AT9 A;  1S8L A;  3UG9 A;  3S8F B;  5ITC A;  3VHZ A;  4KLY A;  1BM1 A;  3QBI A;  5JJN A;  4CDY A;  1S52 A;  3ZQY A;  4XT1 A;  3QDC A;  5B6Z A;  3AYM A;  1X0I 1;  4D4X A;  4BWB A;  5H2I A;  4GPO A;  3HAS A;  4G7S B;  4UHR A;  3L1M A;  1F50 A;  3DDL A;  4GBR A;  5H2P A;  3C9L A;  3QJT B;  1QM8 A;  4QI1 A;  1JV6 A;  4MQT A;  4BUO A;  2YL3 A;  3QJQ B;  3SN6 R;  3UZC A;  3PDS A;  1VGO A;  5H2H A;  3ZTM A;  2XLO A;  1IW9 A;  5B0W A;  2JAG A;  3C9M A;  1EKY A;  2J9B A;  2ZFE A;  1VJM A;  5JJJ A;  1XIO A;  3OE9 A;  5KKH A;  2R4R A;  3IQ5 A;  3QBG A;  3DE8 A;  3WQJ A;  3QBL A;  5B34 A;  4EA3 A;  3QAK A;  1RCP A;  2XLW A;  5AWZ A;  3REY A;  4N6H A;  2Y04 A;  1P8I A;  5B6V A;  2YCZ A;  2QPD B;  2XLM A;  5A44 A;  5A8E A;  5JRA A;  4WW3 A;  4ER9 A;  5G2A A;  4PXK A;  1H68 A;  3IQ6 A;  3NMK A;  4GP5 B;  4NC3 A;  1AP9 A;  4GYC A;  3M15 A;  2XLD A;  2RH1 A;  3TOM A;  2YL1 A;  5AHZ A;  1GZM A;  4J4Q A;  1U19 A;  4DJH A;  4FAA B;  3VRC A;  4WGY A;  1GUE A;  2QLA A;  1CWQ A;  4MBS A;  256B A;  2YLG A;  2R4S A;  3UTW A;  4JEB A;  1E84 A;  4JEA A;  1MQV A;  2YLI A;  2YL7 A;  1BRX A;  1UCQ A;  3QVY A;  5B2N A;  3QJV B;  1CPR A;  3QBK A;  1APC A;  3MBV A;  3ZEV A;  4MQS A;  5B6X A;  3NMJ A;  3COD A;  4U9D A;  4CJO A;  4CJG A;  4HWL A;  1JV7 A;  1L9H A;  4LDO A;  3M4B A;  5JP7 A;  4X32 A;  3S8G B;  1S05 A;  2YKZ A;  1GQA A;  2YCX A;  3QJU B;  2F93 A;  4G70 B;  4WGZ A;  5JUA A;  1QQ3 A;  1E85 A;  1X0S A;  5F8U A;  3QAP A;  5TGZ A;  1S53 A;  4G71 B;  3UON A;  3BVD B;  5A45 A;  1GU8 A;  2ZIY A;  1JGJ A;  3X3B A;  2KS9 A;  1XJI A;  4IAR A;  5JT4 A;  2XM4 A;  3AYN A;  1CGO A;  4Y9H A;  2Y00 A;  3D4S A;  1P8H A;  4G7Q B;  4HYJ A;  5BR5 A;  4EJ4 A;  2I35 A;  2YCY A;  3OE6 A;  3M79 A;  1C8S A;  2XL6 A;  2L6X A;  4MD2 A;  2G87 A;  5C1M A;  3UTV A;  3HAO A;  3UTY A;  3DQB A;  2J8W A;  3HNL A;  4ULV A;  1S51 A;  1YYJ A;  4L6R A;  4A4M A;  5B6Y A;  4XXJ A;  3ODU A;  3QW1 A;  3ZWI A;  1CGN A;  2YDO A;  3FOP A;  1YZC A;  5AGF A;  3U8P A;  2BRD A;  2LNL A;  5AX0 A;  1QHJ A;  1PXR A;  3TOL A;  4QID A;  1PY6 A;  3VI0 A;  3QW0 A;  4X31 A;  3NYA A;  4XT3 A;  3X3C A;  2WJL A;  1Q5I A;  1IXF A;  5FJG A;  5G2C A;  4FBZ A;  4CDA A;  4LDL A;  4WAV A;  3HNJ A;  2WJK A;  4FPD A;  3UZA A;  1JFP A;  2XLH A;  3C63 A;  3PQR A;  5G2D A;  1C8R A;  5DYS A;  5ETZ A;  4BV0 A;  3CAP A;  1TN0 A;  3HNK A;  3EML A;  3HAP A;  4PXF A;  1F4Z A;  3HAN A;  2XM0 A;  3V2W A;  2XLE A;  4L35 A;  1YYX A;  1MGY A;  1IW6 A;  4CIP A;  2KSA A;  1P8U A;  1UAZ A;  3HAQ A;  5H2L A;  3HAR A;  5B3I A;  4N4Y B;  1YZA A;  5BR2 A;  2I20 A;  2YL0 A;  1E0P A;  5JLI A;  3S3B B;  4TL3 A;  1EHK B;  4XTN A;  2I21 A;  3ZQV A;  1NBB A;  2QPE B;  2YLD A;  3PWH A;  5DHH A;  3VG9 A;  1M0K A;  5H2N A;  3PXO A;  1R2N A;  4K5Y A;  3KJ6 A;  4BVN A;  2NTU A;  1L0M A;  1A7V A;  2YCW A;  3NSB A;  3EH4 B;  3ABW A;  1TN5 A;  2Z55 A;  3DE9 A;  4KNF A;  3RFM A;  5JVE A;  4GRV A;  4X1H A;  4AMJ A;  1JAF A;  4OV0 A;  5JSL A;  1KME A;  4DAJ A;  5AZD A;  2F95 A;  1E12 A;  3VVK A;  3AM6 A;  1O0A A;  4JQ6 A;  3NY8 A;  5JS5 A;  2VT4 A;  3FOO A;  3ZTZ A;  2HPY A;  4FA7 B;  3COC A;  3A7K A;  4IB4 A;  2J4Y A;  2M3G A;  3M4C A;  5JJE A;  2CCY A;  1S54 A;  1H2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...