3EH4B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 46
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh4B02
1OCRB 2CJ3A 2PPEA 2J4YA 2JFCA 6PAZA 4HCFA 2I85A 4A68A 2FQGA 1NIFA 4YSPA 4L6RA 2YCZA 1X0K1 4WW3A 4ZK8A 2XV3A 3CVBA 6PCYA 3X1GA 1XB3A 3FT0A 4QI1A 4GBRA 3JT2A 4A2EA 2Z55A 3S3DB 1TEGA 2FQDA 4W9ZA 4P5SA 4UAHA 4FPDA 4DP7X 4DPBX 4OV0A 3T9WA 1J5DA 4GP4B 4N8UA 1M9WA 1AR1B 3FQ2A 3HARA 2CALA 2DY2A 2CUAA 3GXUB 1GUEA 2VT4A 1HAWA 2BP0A 3RZEA 2FWLB 4HYXA 3FYIB 4PXFA 4G7SB 3NT0A 4HAKA 1OOWA 1ZV2A 1ET8A 2DYRB 3SBPA 3KW7A 1TN0A 2AFNA 1L9HA 1PLBA 1B3IA 1PLCA 1JZJA 5A45A 1I53A 4Q8BA 2VN3A 1NIBA 3PCYA 1WAEA 3ABWA 4YVUA 1HAUA 2FQEA 1DZEA 4KNUA 2VW4A 1WS7A 1XIOA 3UTVA 2VW6A 3AG1B 1AQ8A 2HX8A 2RH1A 2Q5BA 3IE9A 2XU9A 3NSCA 4NC3A 2XLLA 4QLWA 3IEAA 3VW7A 5ETZA 1NTDA 3V9CA 5JJJA 4BDVB 1C8SA 4AI7A 2EI4A 3AW5A 4YSSA 5JJNA 4UG2A 5A7EA 1CYXA 2KS9A 4A66A 5G2AA 3UTWA 1MG3C 7PAZA 3CODA 4EA3A 2NRDA 1W6WA 4HZ1A 3RYMA 2ZIYA 1RKRA 3QQXA 5F7BA 4EIYA 5KKHA 4GP5B 5G54A 3N2JA 1IW9A 3OE8A 3AM6A 1R2NA 2KSYA 1JGJA 2GC7C 2W8CA 5B7MA 4DKLA 5G2DA 3CZUB 1NPJA 2JXMA 2VM3A 1AT9A 1NINA 3NS0A 4UHRA 2FTAA 2J56A 4KOBA 3AG2B 3D4SA 3L45A 2XV0A 2TSAA 4CSPA 1V54B 4NAJA 5I6PA 3SBRA 1E12A 5AHZA 4GPOA 1SFHA 1SF3A 1GU8A 1NICA 2AZAA 3TBCA 4DP0X 4YSRA 2AT9A 2KSAA 2BWDA 2PPCA 2WJLA 1SHWA 1A4AA 5G2CA 2IDFA 4AKOA 1JOIA 3PAVA 2J5WA 1EZLA 4L35A 3UACA 4W1TA 4YSQA 4AZUA 3NY8A 1AS7A 1P8HA 1ZIAA 4UANA 4KO7A 1O0AA 1AZCA 2YAQA 3CDZB 1RCYA 1JZHA 4JHVA 5F7AA 3SN6R 4CSZA 4NERA 4YVNA 1BXAA 1AANA 3ZDWA 4YSAA 1PY6A 2BO0A 1QNIA 2HX7A 1JV6A 4GRVA 1GS6X 4JHUA 4F7KA 4XT3A 1BYPA 1A4CA 2IDSA 2WSDA 3FYEB 4G71B 2EIJB 3WNJA 4BVNA 5JJEA 5LWEA 2AANA 2HRGA 1JZFA 1SF5A 1BAWA 1ILSA 1SNRA 1CWQA 4HYJA 1OE1A 5TGZA 2XWZA 4UF7C 3CG8A 3WKPA 5B6WA 4YSCA 1WA2X 5ITCA 3REYA 1S53A 1OCOB 2JKWA 1JZIA 3QAPA 1AZUA 2IWFA 2BP0B 2I1XA 5I6NA 4E9RA 1LN6A 4JKNA 2YQBA 3FS9A 2FT7A 1NWPA 2IDUA 2YAOA 1NZRA 1KDJA 2YXWA 5DHHA 2Q9OA 4AKPA 3VGAA 2YAEA 2EIMB 3OMAB 5I5MA 3DIVA 2H3XC 3WKQA 1N70A 1PF3A 1SJMA 3MX0B 3ZX1A 1Q5IA 3AZUA 1ID2A 1IXFA 1KG8A 1S51A 4A67A 3AYNA 2TSBA 3TU6A 5AX1A 1IBYA 1M0LA 4GXFA 3NSDA 4IARA 2IAAC 1ASPA 5I6MA 1JVOA 1OCCB 5BR2A 1AZBA 4N4YB 3G5WA 5DYSA 3CVCA 1IKOP 1J9QA 1PZAA 2HZHA 3ABMB 4XTLA 4KO5A 1BYOA 4WTQA 3UADA 1ZIBA 4BWBA 3FSAA 4MD2A 2J57A 1FBBA 2L6XA 2XUWA 1EHKB 4AX3A 3V2WA 1AP9A 2YDVA 1BRRA 3FU7A 2I20A 4F2FA 3V2YA 4HCGA 2Y03A 3UTYA 4BV0A 4DAJA 2MTAA 4M3HA 3T6VA 3UAAA 3UZAA 1KGBA 1CUOA 3X1EA 4BXVA 5AWZA 2DYSB 4DP1X 1QLEB 5I6LA 2WJKA 4MD1A 4MQTA 4BWUA 5G36A 3HASA 2H5UA 1S8JA 1L9PA 3NJGA 5G53A 2EIKB 1N68A 1XB8A 1SHXA 2XX1A 3QBKA 1PY0A 5FJGA 4HCIA 4QKTA 2OJ1A 4BUOA 1KV7A 2UXVA 2I7SA 4DPCX 2YDOA 2FQFA 8PAZA 4HIPA 4KNFA 1X0SA 1IC0A 1S52A 1ILUA 2BW4A 5B1AB 1L0MA 1P8UA 3DQBA 1AZRA 1OF0A 4X31A 2VMJA 4HALA 3SQRA 2Y00A 1J9RA 3KJ6A 4PXKA 3RFMA 5H2HA 5AFAA 1BQKA 4JQ6A 5PAZA 4FAAB 5LDUA 5DHGA 3GDCA 1UAZA 1JVLA 4M4RB 5EHFA 3PAUA 1P8IA 2PEDA 3UG9A 1BRDA 1E5ZA 1GS8A 1PZBA 3FQ1A 3OD3A 3WG7B 3NJJA 4HHWA 2I35A 2FNWA 4GYBA 4G7RB 2HLEB 3QBGA 2ZWNA 5D4JA 5E9NA 4K5YA 3D12B 2GHZA 3HEIB 4A4MA 2F93A 5I6OA 3S3BB 4BK5C 1FBKA 2VM4A 2BW5A 3UZCA 1CURA 1AG0A 1L9RA 3UONA 1ADWA 4QRYA 1ET7A 4DP6X 5B1JC 2N0MA 5H2PA 1X9RA 2F95A 5I6KA 1J9SA 2YARA 4DPAX 4IB4A 3ABLB 3PAZA 3NP3A 3A7KA 2CCWA 1NIEA 4E9XA 5AX0A 5I28A 4WAVA 2IDQA 4L0PB 1JXGA 4TL3A 1AG6A 1L9QA 5H2JA 3P0GA 1KBWA 1H2SA 1NDTA 2LNLA 1MGYA 3PDSA 4RH4A 2B08A 2BHFA 2P80D 3QJRB 3EHBB 3NJMA 2X87A 7PCYA 3IBOA 4GY4A 3HAOA 1W6LA 3PPSA 3X1FA 1JXFA 1AIZA 2JAFA 4KNTA 4XTOA 2UXFA 5B1JA 5D4IA 4EJ4A 1URIA 5B1BB 2Y1AA 3FU8A 1YLBB 2YXVA 3TBBA 1SFDA 3WIAA 1QKPA 4LDLA 1TEFA 3ERXA 3EH5B 3OMNB 5AHYA 3QAKA 1PLAA 5B7FA 2YAMA 1DZ0A 3NJFA 3WI9A 1VGOA 2BZCA 2UXTA 2QPEB 2I7OA 1GW0A 4F2EA 3NJLA 1WS8A 2DWTA 4E9TA 3FU7B 3ZPQA 1SDDA 4FBZA 3HB3B 1KCBA 3V9EA 2PP7A 1F88A 2JAGA 4Y9HA 3AY2A 3WQJA 3C75A 4XT1A 4YL4A 4E9VA 4YSEA 5ANHA 1KBVA 4MFHA 1L9TA 3NYAA 4YSDA 3BQVA 4K9JA 2PCFA 4A2GA 1AOZA 5A8EA 2Y01A 1RZPA 5B2NA 1XB6A 1L9OA 5F8UA 3AG4B 4E9QA 3NSFA 2PPAA 1M56B 2LLNA 2YAFA 3X3CA 2BP8A 4KLYA 2RACA 5FC9A 5PCYA 1TU2A 1XJIA 1AACA 1E30A 1OV8A 3WNIA 1J9TA 5TK2A 5A44A 4MBSA 2DV6A 1KGYE 3T6ZA 5B3SB 1QM8A 2UX6A 3FPXA 3FPYA 3OAXA 1BXUA 3OE6A 1BXVA 2PLTA 4X32A 4PCYA 3FSZA 4KO9A 1KYAA 4GP8B 4KO6A 2GIMA 3CVDA 2IH9A 4FA7B 2R7EA 1C8RA 3H4HA 5I5IA 1V55B 2YCWA 1AZNA 2EILB 3QDCA 5J7AA 4A2HA 3HAPA 3IN0A 4E9WA 3QBLA 1GY2A 1U19A 2X72A 2NTWA 1CYWA 3EF4A 5B6VA 1X9UA 1ASOA 1NIDA 3NSYA 4YSUA 2CBPA 1ETJA 9PCYA 1BRXA 1MDAA 2WO2B 1OE3A 5C1MA 4DP5X 2P80A 4TXVB 1UATA 3UGEA 4EF3A 3UABA 1JZGA 1KMEA 3C9MA 4Q89A 3VVKA 1AS6A 2PPDA 3OM3B 5B7EA 3TA4D 1GS7A 2GI0A 1R1CA 1E0PA 1JXDA 3FQYA 1PNCA 1QKOA 2HPYA 3C9LA 2R4RA 3EH3B 2XXGA 3SBQA 1R84A 2OV0A 4E9YA 5H2OA 3X2QB 4PAZA 1JV7A 2CAKA 2HRHA 3EMLA 3QJVB 1E5YA 1XMEB 4JKVA 1F56A 1PCSA 4DP9X 3KW8A 3QJQB 1S8LA 1TN5A 3EH4B 5EN0A 4AMJA 2UX7A 2YAHA 4YSTA 4BWTA 1H68A 1E65A 2VSMB 4A2FA 1S54A 5I26A 1NPNA 3NJHA 1M0MA 2BWIA 1MG2C 3ZBMA 2M3GA 4ENZA 2MRYA 2ZONA 1A8ZA 3FU9A 1GZMA 3OQRA 2ZFEA 3NY9A 3VHZA 3DDLA 1IBZA 2E86A 3PQRA 4AMIA 2H47C 3NJNA 2YCYA 1IW6A 4LDOA 2I21A 4IAQA 1AAJA 2X88A 2QDWA 2XVBA 2AZUA 3NYKA 3PXLA 5AKRA 4DP8X 2Z73A 5H2KA 3UTXA 2W88A 4N4WA 5ITEA 1SDDB 4G7QB 3ASNB 3CAPA 3NP4A 3PBLA 2GC4C 2J55A 5IY5B 1J5CA 2ZZLA 1A4BA 2GSMB 5B0WA 2QPDB 1PNDA 5H2IA 3T45A 1QHQA 1TKWA 1VLXA 2A3TA 2FT8A 2WO3B 3X3BA 1GYCA 3ASOB 3ABGA 2BRDA 4KNSA 2IDTA 1E67A 5B6XA 3T71A 3DTUB 1IUZA 3T6XA 3QJSB 3T6WA 2IWEA 3MBVA 4XXJA 1MZZA 2FT6A 5B35A 3H4FA 2Y69B 4NB7A 4DP4X 3X1BA 4XTNA 3OMIB 3ZIYA 3BVDB 2VW7A 2XYBA 4E9SA 3PLYA 1BEXA 2QT6A 1ZDSA 1PXRA 3S8GB 3QBIA 2BP8B 4X4KA 1QHJA 5BR5A 2HX9A 1WA1X 1KG9A 4AKQA 1KDIA 2KSBA 2UXGA 4BWWA 3VG9A 1JERA 1Q5JA 1A3ZA 3IN2A 2FJSA 2PP8A 2XXFA 3MBWB 4QIDA 1MZYA 4G70B 1DYZA 5AZDA 2GBAA 3HANA 1PAZA 2PCYA 2R7EB 2NTUA 1FA4A 5H2NA 4BEZA 1UCQA 3DKHA 2IH8A 2XV2A 4JR8A 4X1HA 2HXAA 1JFPA 4BDVA 3ZPRA 1BQ5A 3ODUA 2XX0A 5H2MA 2QDVA 5TK4A 3HAQA 4HWLA 1FFTB 5D4HA 4DP2X 5G28A 1L9SA 2YAPA 3UAEA 1F4ZA 5H2LA 2VSKB 1BQRA 1HFUA 1M0KA 1CC3A 1M57B 1FWXA 3PWHA 1RZQA 2G87A 3QJUB 1ASQA 1JZEA 3JTBA 1NWOA 1AS8A 4J4QA 2YCXA 4MQSA 1ZDQA 2EINB 3COCA 1A65A 1VJMA 2AVFA 4BXSV 2DWSA 2IWKA 4HHGA 1KCWA 1W8EA 2B3IA 1C3WA 1GSKA 1NIAA 1ZPUA 3N55A 2Y04A 4DJHA 1OCZB 3QPKA 3ZEVA 3TASA 3S8FB 4P5RA 1PXSA 3U25A 1GY1A 1OE2A 1PMYA 1BM1A 3NJIA 2BZ7A 4LDEA 3OE0A 2PPFA 3FSVA 2ZOOA 3OE9A 4GYCA 3X1NA 3S3CB 4BEYA 1F50A 5B6ZA 4YSOA 4WKXA 3VI0A 1ET5A 3ABKB 2PP9A 1T5KA 2GB2A 3CDZA 1GR7A 4N6HA 5I5JA 2OCCB 4G72B 3NSBA 3H56A 4A2DA 5B1KA 3QJTB 3AG3B 3PXOA 3FSWA 5B6YA 1X0I1 1HZXA 3AYMA 3GYRA 3NJKA 2ZXWB 2R4SA 1V10A 4KOCA 5B34A 1PZCA 5AZUA 2Y02A 1WA0X
chains in the Genus database with same CATH superfamily
4Z3FA 2J4YA 3FFDB 1N6VA 3NQIA 1CFVL 1P0SE 4MMXB 1BFTA 3P3TA 6PAZA 4H8VA 3EBAA 1TKWB 1PX8A 2NW2B 4AIOA 3VGDA 5EU6E 4M48L 1UZ8A 5DDHB 3QRFM 1TEGA 2EDFA 1H3VA 4JFXA 4FPDA 4ZI8A 1X4YA 2BDNH 3LKSB 3FF8A 2GIYA 3FQ2A 2CUAA 3TLRA 3LZFL 4IEFB 3N50A 4F1ZA 3DYMA 5F9OL 1NA8A 3QDMA 4U1JB 4WEBH 2Q0ZX 4JRXA 3HJEA 3LZLA 3L3JB 2AFNA 3II2A 3O3DB 2G2PA 1VDGA 1PKOA 2ORBL 1MHCA 2IOOA 5AB0A 1S7SB 1S9VB 1GIGL 2OKMA 1O9ZA 3OXSB 3W2DL 3VX0A 5FLUA 3B9KB 2I9LB 1XIOA 3LZFH 2DOCA 3H9YA 4FQCL 2UWEE 3AG1B 1ERNA 4NNYA 2RH1A 3FOMB 4HUUA 1NGWB 1VADA 3IMUA 3WKYA 5KTEH 4L18A 3WN5A 4IDJH 4YS4A 1UJ3B 5I71C 2WIIA 1IC7H 1OW0C 1LO4L 1XSKA 4NZRL 4WK0B 1A1NA 3NVQA 3RE0A 5E4EB 5A7EA 3D4ZA 3X13A 4PBDA 1RZ8B 1OM3L 2GI7A 2DWDB 4WUKL 1BCIA 3S9DB 3QDGA 4I4WA 1QD0A 1WAPA 2OMYA 1XCTA 2V2XB 4BHUA 5B7MA 5GZOC 2EJ1A 2CUIA 2UZPA 2VM3A 1H8SA 5ESAB 4UM9B 4JGNA 4FXGC 32C2B 3Q8EA 3ROOB 4F3FB 4CSPA 1MVUA 2WGXA 4UNUA 4ALAL 4N2MA 4TUUA 4PJ8B 4DGYL 1KV3A 3LKPA 1FF5A 1BMGA 3A67L 4PCKA 2W1NA 2O30A 1PQZB 5D2LE 4KRPB 3DHJA 2OJZL 5D7LB 3HLAB 2EUXA 3W0WE 5F3FA 2PWEA 3BZFB 3BGAA 3PRZA 4IMLA 4KH9A 2CBOA 4C47A 5B38B 4RMRA 3V4PA 2A6KA 3QIWD 4JHVA 2AJ3A 4QJ4B 1G7MA 1RUQL 4H1LG 5A2AA 2E3VA 4BE5A 3C60C 3E2HB 4MQXD 3LN5A 4Y4KC 2HX7A 4AG4H 3RKDD 1CD0A 1TZHA 3GJFB 4PRIE 1GZPA 2H2PC 3ESNA 2G0KA 4G71B 2EDMA 3EAKA 1KN4L 1JZFA 2J4WH 3GBNL 5I15L 3BFQG 3WS3A 3IMBA 3WJJA 4B60A 1WZ1H 1B90A 5KVEH 2WN3A 4YFLF 3RZCD 4QDGA 1HK6A 3MSPA 4FFVC 4MJIB 1JN6A 5A2KH 3KZ8A 2OR9L 3L5XH 5CXPA 3EXJA 4QXVA 1TO4A 2F08A 4U1GB 5EUKA 3PWNA 2WKOA 4ELKA 5BS0B 1N2RB 2MTPA 4U1IB 3TPUB 3QFJE 1YECL 3N85L 4E41A 1DQVA 3I50H 1BVNT 5K9QG 1L5GB 2VLRA 3GGWB 3REVA 5JMOC 4Z7UA 5DRZA 2OR9H 1SJVA 4LPUA 3STLA 1MCCA 4PJIA 2AJUH 5DRXB 5HDBE 3WKQA 3UO1L 4AJYV 2BNQE 3OLDA 3QYNA 1S51A 1AO7D 1MXDA 3S48A 1SXBA 4QHKI 1PZDA 4QGTA 3TU6A 4NLHA 2Y5TA 4F15B 3ZHDA 1A14H 4U1SB 3O6MH 4WUUB 1ZS8B 3F6JA 4JFOA 4KROC 4WFED 1X9QA 5IK3B 1EHKB 2FWUA 3UX9B 1NGYB 1DO5A 5E2TH 3FU7A 4ZFQA 3FQTA 1I4FA 2G3MA 4HCGA 4P99A 3UTYA 2BIMA 4M3HA 4IQHA 1AD9B 5KBLA 1Z3RA 4ATWA 4G1EA 4Z8FL 2CWRA 4YBLB 3MUGA 7TAAA 5HGDA 4NENA 1B9KA 3L3HB 5MENE 1SLWA 3H7BA 4LIQH 3OJMB 2H5UA 2HN7A 1L9PA 1GTNA 2VDPL 5TPWL 5CWSA 3CU1A 3GC3A 4GW4A 1JYWA 2PWHA 3FU5A 2QPUA 3WV0A 3RB7A 4XN8A 1JMZA 3OGCB 3DQBA 2XQ0A 4X31A 3HN3A 1AKJB 4Z3JA 1GGIH 1MIML 3V0HA 1CZ8H 3BDBA 4AT6B 2EVJA 4WI9A 5HVFB 1P69B 1HIML 1HOEA 2DIAA 4X98B 4APQD 3QEQD 1J8HB 1KGCE 4A6YH 5BW7C 1OTTC 2ZQKA 5JIHA 2I35A 3DV6A 1MUJA 3K72A 4HS6A 3QBGA 1R3JB 3MTXA 3GMPA 1AHWC 3G6AA 3MV7B 3HEIB 3BD3A 3VMPA 2W9DH 4C56B 5TDOA 3TEUA 2ADYA 4JFDA 5TF1L 4HS3B 1RJLB 3RWDA 3TCLA 1HIMH 2KLRA 5DRWA 4BFEA 1GPOL 1UWEH 3QXAB 1FDLL 3O6KH 5BV7L 3RVXD 3MRFA 3EJRA 3VNZA 4RX4D 3VXMD 3ZRCC 3HFMH 3BH9B 2VRQA 4OIIL 5DJCA 4CMHB 4RH4A 3FO0H 2E6PA 3R18A 3TPKA 1TTBA 5CZKA 3DX8A 3CHSA 4P06A 1E8WA 1O6VA 2XPGB 4GW5A 3ARBA 3DBSA 4KJWD 4MKMA 3TBBA 3D39D 3JUYA 1TPXB 5D1QD 4OIIH 4Z18A 4EDXA 1E9QB 3QO0B 3D5OF 4XNZC 5A7BA 3ZYOA 1PLAA 4G6ML 5INDB 4Y5XA 4X0NA 5FOBA 4O02B 3MJ9L 2IVFC 4G6FD 4JFEA 1LE5A 3NJLA 4Z95H 1Z0MA 2QVKA 3WY3A 1G94A 1SDDA 5GS0L 4ADJA 1KCBA 2EO7A 1I8AA 3DPBA 3IDMA 3BE1L 1PKQB 3QB7C 1VGEL 5DVOA 4JFTA 4Y5VC 3X14B 3VM5A 4X7FC 2X4OA 3ULUE 3WLWD 4U6YA 5AW4B 1FL5A 4E9QA 1G7QB 2Q7NA 1LNUA 5GS0H 3C5XA 1PD1A 1IKFH 1RMFH 4WU5B 2QLYA 4UNVA 5EIIA 5KJRL 2JLLA 2VITA 5TK2A 3VQLA 4MBSA 4KDVA 5D7IE 3ULVL 2WUBL 2CPCA 2Y06L 4XB3A 3LH2H 5D2NE 4I1NB 1BXUA 3NIFF 3VD4A 4F1SA 3GIZL 1W72B 5E70A 4GG6A 1IKNA 2Q3XA 3DX9A 1J0ZA 1L0YA 2FWSA 4OGAD 3V10A 2FBOJ 3QFGA 3B7SA 5HGGS 4YLCA 4BIKA 4WDIB 5KJRH 4DOHE 4TVPE 4X5RA 1OF2A 3BHBB 4Q0XH 5B6VA 1DVQA 4FL4B 1KB9J 4XP5L 2WUBH 1FNSL 1VF5C 2XA8H 3VH8A 1A7NH 4FQIL 3C5SB 3TONA 2WBXA 3GIZH 1VHPA 5LGJA 2RD0A 4R5VA 4CSTA 3FQUA 4A7GA 3FB8B 3HVDA 4PJEB 4NZTH 1HQRA 2BNUB 5DVKA 3ISYA 1JZGA 5JHBA 3MGTA 5DQJA 1JZ4A 1BZOA 1GW6A 3GDBA 4TYUA 5I1EH 5EZJB 2YSTA 3B7RL 4P3CL 5IVZB 2ZYSA 1FNSH 2KZBA 3C9LA 4NT6A 3X2QB 3B7YA 3DX3A 2RALA 2ZSVA 1XF3A 3QC5X 4FHJA 4R90H 2LTQB 5CEZD 4N8VG 3AAZB 3B2PA 4IJTA 2JJSA 5ECGA 2D73A 3II3A 2BCMA 2FJGB 2MPAL 2GUOA 3GJEA 1SZNA 3NCXA 4MMXC 4UQ3B 4JPIB 4MB4A 4LPTA 3UZVB 1M05B 1BWWA 4J8RA 5KVMC 3FU9A 3MTRA 1A8ZA 2VERN 35C8H 2NCEA 1ZSDA 1IBZA 2V5YA 4TSAL 1JDCA 2X88A 4M6OL 4LNRA 2MPAH 2WBWB 2ENSA 3CFBA 4DP8X 4KRLB 4JPQA 3BXNA 2ENJA 3BKYL 4RFEA 2C8NA 2R9HD 4IRJC 3ASNB 3PBLA 3N1MC 3GSNH 2P7TB 4UB0H 3S35L 4IHOA 5C0FB 5T1KA 1R19A 4HWEH 2C4FU 3DIDA 2CRYA 5ICYB 4M6OH 5CAYB 1E5AA 1MLCA 2J8HA 1KC5L 3MBEA 3ZIYA 1AQHA 3WUWB 5IQOA 4DGWC 1UJ3C 4HS8H 3PLYA 5EUOE 3S35H 1E4XL 1KXTB 5A2FA 1T7VA 1F4XL 2J6EA 2NY0D 3JTTB 1QSFB 1YY8B 4GRWE 1MFMA 3OKDA 4XBGB 2V9QA 5E4EC 4ZTOH 1G9MH 3DUSB 2P24A 1DO6A 4NQCE 5E7BA 3UL4A 4MNHB 3UTSE 3C9NB 4KK6D 2NSXA 1B4LA 4WNJA 3PYCA 1PZUB 3CSFA 1FFOA 3LXBA 3U9WA 4WHTA 1PAZA 1LDPH 5C08A 1ULVA 1NCAH 4QD2E 1F4XH 4TNVK 4EIUA 2R2HA 1JFPA 4O2FB 3U1PA 3O3BA 4GRMB 3BISA 4HWLA 1JZ6A 5EORL 4PJ8C 2WY3B 5T3ZD 2ITDA 3MRRB 1KELL 1J12A 4HIQA 4OZHA 1GC1L 5AYUH 4H5SA 3QJUB 3RFZB 3FQWA 1AJ7H 4PJ9A 4KRPC 1TMQA 5L8KB 1NGXA 3EYQC 5I1CH 3ZTJH 1A3QA 2IDCA 2WXRA 3GM8A 2BY1A 4FNQA 3MA7A 4WWPA 2KQMA 5ID0B 4N2HA 4NAQA 1CGXA 5ACMA 1KELH 1G6RB 1QFOA 1WZAA 5J4MA 2Q8BH 2BRRH 4A55A 1E43A 2HVJA 1USZA 1DBJH 3FO2B 1QW9A 3FN3A 1BM1A 2FX7H 2RGSA 2ZOKA 5DZAA 4G59C 4RDQG 3S37L 5EU7C 4JREB 4XXCC 2QMKA 2BJML 2AV1B 4DF9A 2PO6B 3UTZA 3K8MA 4UZSA 4BSVB 2AP2A 3X3GH 3OVUB 4L5FE 3VFNA 3WDJA 3KYOB 2EKSB 2B59B 4NZDA 1VIWA 1RIUH 5AW0B 4P07A 1KIRB 2D3VA 4MA3A 3QJTB 1FH5H 5IOKA 4U1GC 3HZ3A 4XB8A 2CR0A 1ND0A 3NJKA 3QCUL 1VEPA 4IIQA 8FABB 2EABA 2IANA 2YKLH 4P46B 1GZQA 2C3XA 2C9RA 4OAWA 2C7FA 2DQIH 2WVVA 5DQ9A 1OAYL 4XCEA 4L6RA 4LCWA 4P5TA 2XV3A 5D5MA 2EADA 1IT9H 2R2EA 3MRLA 4S2SB 3EBGA 2FQDA 2Z31A 3SE3A 3HR5A 1F2XK 1BG9A 3QR2A 3NFPB 2DY2A 1M1SA 1WITA 5EV7A 2ZJSL 2EUZA 2NTFA 1UJTA 1K8DA 3NIFB 2MCG1 4HAKA 1ZWIB 3VRJA 4X8JA 1JE6A 3FB7A 2YA1A 3GHBL 4F33B 3T8MA 1NFIB 4EN3B 3MV8E 4QXUH 4ZFZB 3FT2B 3NA9L 1MI5B 2GTZB 4KTGA 5C0GA 3IXTB 3C60D 3BCDA 3HG1A 3KHQA 4Y4KD 1DZEA 4KNUA 1OO2A 4HLZH 3MLTB 2FSEB 2WXJA 1A4KB 2HX8A 2H2PD 2ZPKH 2Z4TA 4NI3A 1XQ4A 2OAAA 3UBGA 1ZTXL 5E5MB 1CBVH 1MELA 3BW9B 2R1YA 2PXYA 3ILPA 4B7LA 3EYFB 15C8H 1DBBH 3MREB 3RZCA 1IJNA 3G6JA 4M43H 4LFHG 3R8QA 4ZUVA 4FFVD 4A66A 2EDHA 5DI8A 3VWJC 2AQTA 5E2VL 4Y1AE 1JXKA 4O2EB 1C7SA 2UY7B 4ZX4A 1PLGL 1ZTXH 2XFGB 4KHXL 4K7PL 1BQHG 2A4ZA 3AT8A 1EJ8A 4I18B 3QJHA 3ULSB 3TBTA 1RPQA 4OM1H 1Y6MR 3KEHA 5IJKA 2F54D 2MHAB 1Q0YH 5AHZA 1JHLL 1YEGH 1SF3A 1B2WH 4AMXA 1E2WA 1U8OB 4KGLA 1AO7A 3BPCB 1PLGH 3KCPA 4NRZA 3BT0A 4A04A 1G7IB 3D4CA 4I89A 3WN6A 2G5BA 3KPRE 4AKOA 1MCOL 3HTLX 4MXWH 2TAAA 1MREL 3TJEL 2HFTA 3PFUA 2BH0A 1JHLH 4GKZB 4N2KA 5HHVL 3SN6R 4KROD 4PWGA 1OHZA 1YJDH 4PIBA 1AANA 1G7HB 5ICXA 3ZDWA 1HEJC 6FABH 1JV6A 4ANWA 5SWZA 3CQQA 3ZTNH 1BYPA 2AW2A 3FYEB 1AD0A 3RIKA 1GGCL 1MCOH 4EI5C 2FO8A 5MI0B 5FGCB 1MREH 2ATKB 4CMHC 5DMKB 2JELH 1U8KB 1JWSB 5F44A 3BRGC 4OLXL 3I9AA 3V0VA 3OAYH 4ZOCA 4P2QD 1WWCA 3U4BH 1N5YL 5ITCA 1M9SA 1UWGH 2HWZL 3SN6N 3SODB 1RAMA 4LLWA 3HZVA 3P4OA 2ENYA 4MB3A 3SSGA 2J3SA 4NO0A 1W0WB 4HUVB 1R34A 1YPZE 3LAFA 1KXQA 4YR6A 1FV1A 1NZRA 3CH8A 1DR9A 4CNIA 1MW2A 5ACZA 3AABA 1N5YH 2BCKA 5EFIB 4ZAKC 5JIDA 4PVNA 3DIVA 3KLDA 2QKIB 5FB8B 1FZKB 2WLJA 4YHZL 4YHML 5A3IC 4ODXB 4HD5A 2AAAA 2H8PB 3T08A 1QLEL 1OTTD 4XWGH 5F89A 4HHAB 1E7UA 1L9NA 2ZXQA 4L29B 2AEIT 3CVCA 3CZJA 4JQIH 1BYOA 1GVIA 2I26N 4D0DA 4NKQB 4U49A 1W0YT 3CDGB 4WFHE 1EAJA 2E0PA 4QOKA 4X5QA 4AX3A 2I20A 3EO0B 3V2YA 3H6JA 5C0BE 3IFPB 5HVGB 2WPGA 4ANVA 4E42A 2WNXA 3DETC 3FC8A 2COVD 3JVGA 2ZXBA 4B53A 2ESVB 5G5DA 1BLNA 5HGBB 3BH8B 5C09B 4P9HL 1I7RB 4XCFH 3EUUA 2OLDA 3P9LB 3PL6D 1KBPA 3T2PA 3PABA 3WY1A 3QI9A 5I24A 1MLBA 1J0IA 3DX0A 1KN2L 3Q2CA 2FEJA 3JUZA 4FL4C 3RIAF 3BKJL 4DPCX 5ERWB 3BPLC 3RY6A 5I30H 2X44D 1UZGA 3GEFA 2A38A 4K3EH 1IM3B 3BVTA 1Y0LA 1WTLA 4JQVC 3SQRA 1J5OL 1B4JL 2DWEB 5JHDB 1J9RA 4BZ2L 5I1AB 1BQKA 3RHWK 3HRPA 1KN2H 1FZJB 2L8AA 1DJYA 4MYWB 1KPUB 4B9JA 3BKJH 1GS8A 3KMDA 1C5CL 3WG7B 4FXKB 4PG2A 2HLEB 2ZOLB 5H37A 3VCLB 1JWMB 1HILA 2HKHH 2LTQC 2GHZA 4J3OF 4QRPB 1KF9B 4DKEH 2OMWA 5GRUL 3BT2H 1H3UA 4OZ4A 1ICTA 3H9SA 1WBXA 2XZQL 5DJ2B 1T7YA 4PRPB 1AMYA 2B5IB 3TX4A 1RD6A 3ULVE 2CRZA 3L4CA 1GL4B 1G0YR 1KLGB 5F7MC 1V3LA 3IU4H 3T0DA 1ORQA 4XBMA 5CJOH 1BOGB 1KT2A 1X5FA 3FTUA 3FQ4A 1XGTB 3ENEA 2B08A 1DCEA 1OGAA 5GS2D 1BVZA 5T3XL 4XOBA 1JL8A 3NN8A 5GGTL 4FTVD 3IWUA 1E3XA 3TNNB 3VGHA 2HYMA 2VLKD 5DT1H 1NFDE 3PQYD 1OTSC 5LCVH 1I1YA 4PW9A 4W9DC 4AGPA 3D30A 4KMTH 2Z8WC 1ZCRA 2DEWX 4OFKA 5I73B 4YFLI 2CIKB 4JANA 4L8DB 3HG4A 4WU7B 2JI3A 5I8EB 1NC4B 3C5JB 2N7BA 2AXFA 3DDGA 1D6VL 1ZHKA 2DJMA 4J4PA 2V9TA 1TYJA 2E7BA 3AM8C 2F9BT 2QKSA 1A6AA 1UA6H 2YFNA 4G8GB 5FA3A 5C3TA 1HL4A 3SPVA 4RGNE 1IAOB 1YUHB 3AY2A 3SYPA 1J0YA 1NCOA 5FOJA 3V0WH 3BQVA 4KJQD 4A2GA 3GHEH 3UPRA 3T0EC 4YMPA 5BCAA 5A8EA 3BUYA 3SKUD 4PJ7B 5EO0B 5HGAA 3HRZB 5I8OH 2J1YA 4KDTC 2YBGA 5AZ2L 5E8EB 5FCUL 5E8OB 1B88A 1HE7A 4KLYA 2N4IA 4CMMA 3DLQR 2CU9A 4YHLL 1A3LL 2DV6A 3CXFA 4BA0A 4TSCL 2W65A 5DEGA 1UXSA 4FADA 1R24A 3RFZC 4P4RA 3U0WL 4PGBA 4UT9A 5CCJA 3CVHB 5C97A 1MQKL 4PJHA 4YBHA 4O4YH 4KO6A 4NZUH 2VE6A 1C8RA 3GEWB 4KBPA 3KL3A 1SJHA 1UM5H 2BERA 5EBWB 3GMQA 4F2ME 4NCC2 1KLFB 3IJYB 3CFKA 4QRUA 3RU8L 5EIVA 3H42H 3QUXB 3QHTC 4Y8AA 2XT1B 1PZSA 2YMXH 4D0CA 2NSQA 1VKXA 1JPFA 3Q13A 1UATA 1F6AB 3GHPA 3R8BB 2PO6C 4EF3A 3VFRA 3GINA 2IBGA 2NY7L 2FEEL 3N04A 2YJLA 4ZFFB 5DC9B 2A6IB 1PZ3A 4LSUH 4QHUB 5EBLA 1UD6A 3ZGIA 1NGZB 4KV5E 2C3GA 4E9YA 1R84A 1HXYB 3S4SA 1FE8H 5FV2A 1JV7A 2YEZB 1OB1A 1YRKA 2A74B 4HT1L 5HGHA 5DJ6A 4DP9X 4P46C 5KBNC 3L5IA 5DK2B 4IRZH 3QR0A 5GSRB 4BWTA 3LN9A 3K1KC 2Y25A 4UM9D 3RWIB 1YYLL 4IOSD 3HI6H 3O41B 5D6CB 4TUOA 3IF1A 2NY6B 1E27A 4DFHA 5F97E 3TYFB 1RZGB 4JN1L 1V7NH 4PJ8D 2CKBB 3PWPB 3PQRA 1P7KB 4GH7B 4YZFE 2GIXA 3TIDB 3BGFC 4X7DC 3HZYB 2XVBA 5CN2A 1T0NB 2FJHA 5TDNA 5L2KB 2Z73A 4KRPD 4QRBA 5D7LD 2GFBB 3TBWB 4B97A 4ZOEA 4EN3C 1YYLH 4O9HL 1LMKA 4J2XA 3OB0K 1LD9B 3S3JA 3INUL 1PNDA 1QHQA 5L7XL 5H2IA 3VG0H 4PJEE 1TCRB 2DQGH 4JN1H 2FX9L 1N8ZB 3HC4L 4XO4A 3EJQA 2PW2B 1RFDH 2DQFB 5FWRA 1MJJB 2KQNA 4QO1A 4HEME 4PD4K 2LT9A 4QHPA 3ZL4L 5DXWA 4HJGA 4R5TA 3MLWL 1Z3GH 3WE6B 4AYID 1MPAL 4DP4X 4GSRA 5C92A 4O9HH 5KYUA 2XYBA 3TBVA 4LCIH 4HX1A 4NPKA 5DK0B 1ZPLA 2BRQA 3ARPA 4EIGB 4Q6KA 1TU2B 3TBSA 3I9PA 1A9EB 2HX9A 4MJID 4PRNA 1E5UI 2GSGA 2VDLL 4IU2A 4NOFA 3TOPA 4AKQA 4PLJC 4YC2C 1II4E 3G5XA 4IBZA 3MLWH 5LQBH 5HDRA 2PP8A 1RUKH 4P2RB 4QIDA 5BS0D 2DLEA 4MCYA 4BCYA 5EOCJ 2NTUA 1LL1A 5GZOA 2JV6A 1T1ZA 2YR3A 3QG7L 1I1AB 4X4ME 2HB0A 1C5BH 4Z0BH 4BFGA 1VPOL 2XX0A 2V2TA 1CI3M 4V1DB 3AUVA 2CXKA 1RZKH 4YAQA 1NLDH 4JGUA 3VRIB 2CK0L 4KGJA 4AQ8A 4KFMA 4GBXA 1EEZA 1ASQA 3NH7L 4HJUA 2CLRA 4U1KA 1M6OB 1X7QA 3IJEB 2D7QA 4WUUD 4XPGH 5JIMA 4BH7A 1FN4B 2XFXA 2OZ4L 2XVLA 2WK2A 5FW6A 4I48A 1JFQH 1OCZB 2GSIA 4YEEA 4BJLA 1HCYA 2H1LM 2YUZA 3NH7H 2UZIL 3IDXH 4KWUA 3WJMA 1QSFE 2WLIA 3T8XA 3TJHC 1KB5B 4FP8H 3ZKXB 1CDCA 2X1QA 3Q8CA 1N5AA 2PTTB 4NNPH 2WGNB 5CINL 5FKAB 2R27A 3VYOA 1FC2D 1TCMA 5TD4A 4OZFA 4DWHA 2QHRH 4NBZB 1XH2A 3HI5L 5EBMB 3PGCA 5B1KA 2Z4QA 3ZE2E 4U05A 4LDOB 3GYRA 3TYGH 3AREA 4JZJB 2Q6WA 4JFVA 1N0XH 3RL1A 2OCFD 5B34A 1PZCA 5H94A 5CINH 5D96B 4X4YA 1JUFB 1I3RA 1P53A 3MLVL 4XZUB 3FF7A 1AKJD 4ZK8A 3MRJA 1GCFA 2WYIA 3O6FA 2QKIC 3RPIB 2Z55A 3MJ8B 4P5SA 1QLFA 3F05A 4HJJH 5EOQL 4ZUSA 5F9JB 4KTEL 3L6FA 1TFPA 2QLVB 1J8HD 3L3DB 5HHME 3V4PL 4HKBA 3GXPA 1JHKH 5EH1A 3ATFA 3MV7D 2R0KL 1FORL 4ZS6C 4XVJL 4C56D 5JNYB 2VIRB 3SDCA 5I18L 2HCZX 2BS8A 3ILQD 2XWTA 2VLLA 5TE4L 1QRNB 4PY7A 1CICB 4KTEH 4NUPA 1SMDA 4RDBA 1E2ZA 3AITA 4O5LL 4ODHL 1JNNH 2YIHA 3IGLA 4FOMA 4QRQA 2Q5BA 5JOFA 4GAFB 4U3SA 3VFUA 4KJPC 4ACTA 1DSWA 4DJMA 3KYMB 4ZMZA 3UERA 4XNDA 2X2UA 2CHXA 3AGVA 1RIHH 1T20A 4AI7A 2ROYA 1P2CB 1ZY9A 3ESMA 1QSEE 3D18A 2KYIA 5F96L 2Q86B 3CODA 1EGJA 1NMAL 4Z7WA 1CXFA 2VXQH 3ZR6A 5F9AC 3UTTE 5C0CE 2EH7L 4QMEA 5IEKB 3UJJL 3D09A 1IO4C 2JXMA 5L4IA 2A2QT 3DHMA 4H25B 4XMPH 4WAFA 3V0GA 3L3IA 3L45A 1JTOA 4PEEA 4D7PA 5F9DC 1TG8A 4OV5B 4R2GC 1ACXA 2F8XC 4BCZA 2JJTA 1CB4A 3KPOA 3CN1A 3FT3B 2ZF8A 4FXKC 4D9LL 5A3ID 1ZVNA 4Y88A 1BQHB 3A6BL 4Y16C 4PREA 3O4OB 4J23A 2VXVL 5CEYB 1AHWA 2ZKMX 3KD4A 4W1TA 1EHLH 4X4XA 1T89C 3RURA 3W1ZA 5ESVB 4AENB 5D72L 3P9MA 4OQTA 5L6YH 4FFYL 4Q6IA 2B5IC 5E24E 4N0FB 3ARZA 2AXGA 1P5UA 1GS6X 1CL7I 3DSFL 1UD4A 3C87A 4D9LH 1Y18A 5DYOA 2MKWA 4PV8B 1ZS2A 2KBGA 4PGCA 2VXVH 5CS7A 4JPWL 2ZX8A 5AYQA 2VMCA 2FX8H 3LSOB 4FDWA 3WFEL 5FECB 2C4FT 1WG3A 2A9AA 4QNPF 3RB5A 2DMHA 4CVZA 3MOAH 3E1ZA 2PCPB 1OCOB 2ZWKA 3M45A 2HFFA 2XWRA 5FWQA 2R0LH 1EDQA 3S35X 2WXGA 3QYCA 4K5OA 1YEJL 1JWUA 4XPTH 2WSPA 3CD4A 5GISH 4AIZA 1GYAA 3AS3A 2YRLA 3DSNA 1LO2H 3RWJA 3M17A 3HPJB 4FRWA 4J6IA 1HSBA 5DTFA 1PF3A 4ES9A 2WINB 5JZ7C 3JWDH 4TN9A 5GS1C 2W9LA 4N2FA 1M0LA 2FZ3A 1K72A 3NSDA 5JOPE 4HJSA 5DGQA 1JVOA 4NHCL 1UURA 2EP6A 2F7PA 2CCLA 1NCUA 1IEHA 2VXUL 1U91B 3L54A 3Q43A 4R26L 5KW9L 3T6QC 5JR1L 3ZR5A 5CSZB 1OSZA 5SWSB 1S5HA 4OJFH 4MD2A 2J57A 4N22A 1BX2B 1IEAB 2XRAL 2PYED 3HPLA 1FNLA 2V7NB 3IJSB 1UT1A 1CR9L 2Y03A 4JAMB 3LNEA 3O8XC 5J89A 5T3XE 2WXPA 2DICA 1IX2A 43C9B 2JKTM 4NJ9H 4DIXA 3FQNA 5IHWA 3BAEL 5JR1H 4DP1X 5BRZE 3BWSA 5IUCA 4P23B 4BWUA 3UTQB 3P40A 4FTVA 4GKOA 3CV5A 4NOBA 5E08H 2WQ8A 5I8CB 2X70B 4P05A 1KY7A 4LNVA 3SE4C 3PQYA 5BOPA 1SEQL 2QADB 1KV7A 1OTSD 4OCXH 2IMMA 5CCHE 1P1ZA 3T3ME 4APXB 3AB0B 3QUXC 4PRHB 2P47B 5F88B 2O61B 4JE4B 1KBKA 2P48B 4X7TA 1A6WH 4PQXA 3I84A 4PPTA 3ZU8A 3NFNB 2X4PB 5H2HA 1YYML 4KVPA 1S7TB 4XO8A 4HMEA 4ONHA 3S37X 3GMLB 5LDUA 3MRIB 1FGNH 3DX6A 4AYFA 3VD2A 1IGJB 3T4YA 4M61A 2PEDA 2LFEA 2P8LB 4NHUB 3VMOA 5I0ZA 4HHWA 2FNWA 2GEEA 3W9DB 2ZWNA 3ISRA 4D0BB 1KFGA 1DL7L 3AXLA 3U7WH 4KK9D 4V2BA 1BDYA 5I6OA 3LIUA 5LBSA 4P59H 3T0ED 3UONA 1M71A 1YYMH 5JYLA 4FG6C 5B1JC 3GXIA 3GTVA 3GO1L 3KYAA 4ZQKA 3K2KA 1KTDB 1UKQA 4JRYE 4S1SH 1HU8A 2QV4A 4TL3A 4JFZL 5FCSH 2B4CH 4AJ0A 5F93C 1MGYA 5H35B 1B6UA 4XXWC 1U8CA 2ZCKH 3VGAB 4WK2B 3K2IA 1NFKA 2PABA 1MCLA 3HUJB 3RILA 1U30A 2LFGA 3GTNA 5F7WC 4XTOA 4IRJA 1WC7B 1R3HA 3BP6B 1TQCC 3QYMA 4DEUA 1BVNP 1ZVHA 4YHOL 1NANI 1YLBB 5JHDE 2NX5E 4BK8A 3TF4A 4PU2A 1B4TA 2AQPA 2HKFL 4NN5B 1QKPA 5D6DC 3RJOA 3MODH 5DHVA 4HJIA 5FFLA 3ROLB 2WQAA 4HGMA 1NMBL 1DZ0A 4YDJA 3ATAA 5I17B 5AG8A 2I7OA 4F2EA 2OJEB 1KY6A 4G9DB 2PO6D 2W59A 4NCC1 2JJUA 3UH8A 4DEPB 4GT0A 1GYUA 3IRCA 4XPFL 4YH6A 5IREA 4ANUA 1DZBA 1JVKA 2AMUA 1KLUB 3MLPA 1NCGA 1EJFA 4R8WH 2FO4B 2B15A 4Z7OE 1ED3A 5JIIA 4XPAH 1NMBH 2AGJL 4MFHA 1RZ8A 2FR4A 3LNIA 4NPJA 4J3OC 4K9JA 1AOZA 2VXTH 4YWGL 3S8WA 1N67A 2EICA 1DQDH 4IW4C 3S96A 4P46D 2HT4C 1JP5A 1RZJL 1OVZA 2VOTA 5CLWA 3NSFA 1N0LB 1MVYA 2YD5A 1I1AC 5DD0L 2E6JA 4N0RA 4K7PX 2FBJL 4FTDA 5F6IC 1E8XA 2QMJA 4DZBA 5TQ2H 1CF8L 3WFZA 3DRQA 5IB5A 3ECBB 4YWGH 4G9FA 4JKMA 1QBML 5HD8C 3WMPA 1D5MA 3C6LB 4Q2ZB 4ZPVA 4NQTA 4F7TA 1UFGA 2BFVH 5AOJA 4KO9A 3VWKB 4M8QA 2IH9A 3MV9E 2R51A 4WF7A 3A47A 2NUPA 1IGML 4EN3D 5I16B 4XO5A 1DUYB 4N2DA 3Q1EA 1MI5D 4RWYH 3O11B 1V8HA 1QBMH 3IFNL 2G2NA 3LEVL 2CHZA 4UQ9A 3GSUA 3NZHH 3BSHA 4DAGL 4B5ZA 1WWWX 1ZEAL 5HDLA 1V7ML 2J7LA 4MAUH 1RK0B 3UGEA 2J6EL 3ZKXC 4YXKH 1PZ2A 2VR6A 5AW2B 5SWQA 2NW3B 3U46B 3US9A 4JRLA 4OSUH 1T5XB 3V6OA 4PJ7E 4EXPX 1AIFB 4IIZA 4MJIA 4Z3IA 4D2NA 3UC2A 3VXNB 3SE9L 2DM3A 2FK9A 4PLJD 4F24A 1V7MH 4JZJC 2J6EH 3WKMH 2VCOA 3VQMA 1H9VA 4QHMB 1VFOA 3TCXA 5D70L 1MFCH 2WTOA 2ZOTA 5HJ3B 2VSMB 4A2FA 2EE0A 4RMQA 5IHZB 2XWXA 3DROB 2X4RA 5E00B 5CMAA 1H8NA 3MI6A 1TOXA 3QUZB 4R7XA 3EYVB 3V6BR 5HYJB 2H6OA 5GJTH 2ENQA 3RUGE 3NJNA 5KS9B 4XNBA 2DBLH 2OP4L 3E6FB 1WAAA 1FRGL 2ITEA 4LEXL 4A6YB 3L95A 5F71A 5FYJU 4Z7NF 3MMEB 1R3IL 2BVOB 1BMZA 3LN4A 4WUUA 3WNKA 1U8JA 2C9VA 3QZOA 1OP5H 1A4BA 4XX1E 2WO3B 4MD5B 1CICC 1U92A 5D9SB 1P6FA 2BFGA 2J1XA 3AC0A 1O6SA 2EO9A 4RNRB 3PWLA 2XJLA 4XMLL 5EZLA 2GK0B 4WEMB 1D7FA 2PN5A 1QFHA 3UIYA 3QNZA 1CYGA 3QUGA 4GAAA 5AVXB 3QBIA 2Z1PA 3BEWB 4D8PA 3NZ8B 1YC7A 1QHJA 3K7UA 4HZLB 2VDKL 3UBXB 4JN2A 4UOJA 5EN2B 3P4MB 3IKKA 3TV3L 1HOCB 3VG9A 1ZOXA 3VWJA 1A3ZA 3ARRA 4UBDC 3KH4A 1NGQL 1T03H 1AGDA 4L8BA 4PLKC 2LABA 2JB6B 1DYZA 2FECI 4OD3L 4H8WL 3X3FH 3ZUCA 2IH8A 3H2QA 4R84A 4U3HA 3UC0H 1OAQL 3FFCA 3WE1A 2X6BA 3CCHB 2XSKA 1NPUA 5D2NC 3QVAA 3RNKA 1RERA 1V3MA 1U3HA 3LQAH 2IF7A 3UAEA 3FO9B 1CD1B 4FEMA 2BNRA 3ASWA 1RHFA 4HBQA 3OHMB 1BYNA 1UENA 5T33H 5FKPA 3OR6B 1EAPB 1IL1B 1ZT7A 1FAKT 2YS4A 4QF1A 2WQSA 5E1HB 1FJ1A 3ZVVA 5C3LD 2IWKA 3BQUC 4WV1C 1SQ2N 2ZXCA 1NIAA 3KWWA 4RSYA 1N26A 2X3AA 2DEYX 1NMCB 3G3LA 2X0WA 4P4KA 4AIXA 1X9LA 4TQEL 3ECVA 3OKKA 1BECA 2C26A 1M3JA 1OGSA 4X0KA 3FSOA 4DZ8B 4XMWA 1XTLA 2ESVD 4HWZA 4EI5A 4PGJA 4LRNL 2MIZA 1I9IL 5C09D 1Z9OA 1TEYA 2XQBL 3KPTA 3DXAA 1ET5A 4P2RE 2WP3T 1X5AA 4Y5YA 4N6HA 3JV6B 4ZG1A 4JO4L 1JPSL 2KS0A 3H56A 4A2DA 4OBRA 3PXOA 3STZA 3ARFB 4ZFOL 1HZXA 2HUEA 2P3YA 4NO5A 3MRNA 4J3XA 3BJLA 4V1DE 4CU7A 3QAQA 3NIDB 2WD0A 3AUWB 2JB5H 1FFPB 1IM3D 1PS3A 2FQGA 4O02A 4UNTA 4D94A 6PCYA 5HPMA 3O4LB 3V0FA 1BQLH 3BVXA 2EXWC 3JT2A 4YN3A 5ENWA 2XTLA 2Y07H 4ZAKA 2A7BA 3T9WA 1DBAH 2ICEB 4NZJA 2F53A 2VXSL 5AEAA 1UXWB 2CALA 1L9MA 1HXKA 2LU4A 1I7TA 2VT4A 2BP0A 3IJHB 4XXDA 4HXBH 4RMTA 1D5XA 4Z0XA 1EZSA 5C07A 1H0DA 3X14A 4QRPD 3IXAB 3SBPA 4QJ5B 2BOCA 5JYMA 1PLCA 2PCXA 2OX5B 5FO8A 2YPKB 3P0YH 5MHSE 4R96A 2BHZA 4E2OA 4XP9H 1FVDB 3FO1A 5T5NG 3FBQA 4PRPD 2XPYA 3HNTL 2AK4E 2MOGA 5F7EH 2XBZA 3FQRB 1AQ8A 5DEFA 4ORGA 3SQBB 4GSXA 4Z77B 1J8KA 5TQ0L 3OC8A 1JF1B 2FSDA 4P23C 5FGSA 2MNUA 3QQ4A 1DVFA 2BC4A 5AAPA 2OA9A 3BIBX 3P1VA 3WHE0 2IGTA 4EZJA 2NY3B 3BDYH 5KYWA 2QADC 1RKRA 2VDNL 3FN9A 3GSNB 2EYSB 4MVBC 5G54A 3RX8A 1IGTA 1HINH 2DPKA 3NACL 1XCQB 1A2YA 2E7HA 3MXVL 1IGCL 2J56A 3H53A 4X9GA 4POZC 5DUML 1IQWH 1NC4D 4JQVA 4JFFA 2XV0A 3H1ZA 5IJDC 2VRAA 1KEGH 2DTML 3BKMH 4G8GD 1FUNA 4M5YL 3ELQA 3R7QA 3TIEA 4Y2OA 2X4SB 4M02A 5JZ7D 1R0AH 1GJWA 5GGVL 1MQ8A 4KRNA 5C2BH 3TM6A 5DFTA 1DQLL 1H3XA 4I3RL 5F8QC 5IR1B 3KLAA 3CHQA 3JT0A 3BJ91 1BIHA 1U95B 4JKWA 2AXWA 4YSQA 2CM5A 4Z7NB 4OCMC 3UMTA 4L48A 3WL9B 2DTMH 3EDKA 3OZKA 3MNWB 3K4AA 4TNVF 4YX2L 4RRPG 3TWCH 4YSAA 4GEJA 2PYEA 2XY2A 3B9VA 5HYIA 2BP3A 3F58L 4I3RH 1ZLWH 3WLBA 1YG9A 4J3SA 1HKFA 4R6UA 1D7CA 2YGNA 3F7PC 2HRGA 5EO1B 2KDGA 3VGAC 5EO9B 4NO2A 4O00A 5CSGA 3FRPB 4YX2H 2I5YH 1OE1A 3QH3B 1MN4A 3GRBA 1HTYA 4UF7C 1QLRB 2J88L 2QSVA 2VB5A 4CGTA 2C5DC 2YO3A 4PVLA 4WTWA 4ANKA 4ONOA 2GT9B 4LSVL 4XN9A 4ALAC 2Y36L 3CGTA 4NN5C 5DJXB 3NZUA 1AMXA 2NLJB 3QSKB 2J72A 3QUXD 4LO9A 4N8CL 2E59A 4OKDA 5GSVB 1NCBH 5HHNB 4MSWB 1PSKH 3IFLH 2J25A 3TZVB 3V4UL 4DEPC 4X6DA 3VFMA 4HPYL 3AM8A 1Q5IA 1UWXH 3X11B 5JW4R 1TDQA 3HG0A 4WJ5B 1HS6A 4Z7VE 4M5TA 1SBBA 5I6MA 1E9PA 5JO5A 1EIBA 2ZSWB 1OAKH 1R3KA 4LARL 5I1HL 4LLYB 4ZX6A 1N3NB 4F37K 3T0EA 2FB4L 2HJFA 5JXEC 4HQQL 2B20A 5H37H 5FDWB 2XTJB 3P4NB 1I3VA 5FW7A 2CO7A 4NXKA 5DMGC 1CK0L 1BD2E 4WEUD 4UILL 4BV0A 4M1GH 2ZKHL 3MLYH 1JPST 5JW4N 3H9ZA 3Q0HA 5B4MC 2BSBA 1AOHA 4LARH 3OPZH 3PWPD 1MJUL 4PWJA 4CDGC 2DLFL 5HY9B 3OC5A 2F6AA 3WU1A 2GUYA 4NC1C 4MD1A 3VWKC 3RL2B 5L2KD 4OLUH 1DQML 1CK0H 4U7MA 1QR1B 1AFVH 1VZGA 1G1OA 4MA1B 3P77A 1XB8A 2XX1A 2EE9A 4KZEL 4I0CC 3BVWA 1A6ZA 4G8EB 4A63A 8PAZA 4KNFA 1S52A 1GZHC 1ILUA 1K6QH 2AABL 3GXTA 5B1AB 4F27A 3LNDA 4PMEA 3CXHJ 1KYOJ 3KLQA 2Q1EA 3IRPX 3GKWL 3NRQA 1WRFA 3V4LA 3RFMA 4UT6A 1EK3A 5ADPL 5KS9F 3MRMA 3L1EA 4RAUA 5AZEL 5HI5C 1RU9L 3QIBB 4HGWB 5FFOA 4K5PA 5DSCB 4M4RB 3BO8B 4L4TB 2YPVL 4GO6B 4WENB 1A7PH 1F1DA 2AEWA 4DH2A 1XSJA 2OMUB 2WBJB 3HKFA 4GYBA 2AABH 5F1NA 1QAWA 2M83A 1G1CA 3SGDH 3TA3B 2IIJA 1QWNA 1XGQB 4AM0A 4BK5C 1IC1A 4J3OD 1XH0A 3CVIL 4DVBB 4NO3B 5KSUA 4G82A 2G2RB 4QRYA 4PHXA 2VZOA 1ZT4B 2HT4D 4OZIF 3WNLA 1VZHA 4UOW0 3N9GL 2Q20A 1I1AD 3NK3A 3KWXA 3VXRE 2HTKC 1NIEA 4UT9L 1DJSA 4PJXE 1TQVA 3RGHA 1AG6A 3ETTA 4U1LA 3WXVL 2F68X 1XH3A 3HMWL 1UADC 4KK5C 5HD8D 3HZKA 2YEQA 2KPNA 3M07A 1F11A 3MACH 4N90D 1HHGB 4ZS7H 3QWRD 4ODWA 1OARL 4TNWF 2UY6B 1AIZA 4PI2A 4YDIL 3UBHA 2UXFA 1JXFA 5MEPA 3LKNB 2PYFB 5GQBA 3L5HA 4JFHD 1OP3H 1NCWL 3HLKA 5GJSL 5I19L 2HPOA 3FUHA 3I2CH 2YOAA 5IQMA 5IP4A 1CS6A 1HZHL 4NI6A 1AI1L 5DHYB 3R0NA 1VGOA 3VU1A 2BZCA 4MJ4A 1JG9A 5FYLD 4ZYKB 1K8IB 4NGHL 4ZRGA 4ZX5A 5ISZB 5GJSH 2DQEH 5I19H 4KMQA 1IIKA 5T1LA 3LRLA 1QO3A 1UH3A 3C75A 2FL5A 5IQNA 4D8OA 5BV7C 5CLZA 3SE8L 3VI3A 3NYAA 1JAEA 1K4DB 1RURL 4YHKL 1BAFL 2VDRL 1JK8B 3ZT7A 3KNBB 4FZ8L 3P2DA 4TULH 1LO5B 4C58B 3Q01A 1TVHB 3HC3L 1BIIB 2WVSA 1FCCA 4JM2A 4DN3H 2X2HA 2MQGA 1X4ZA 4Q9QH 2A83A 5E99L 1SEBA 1SUJA 3IDIA 5F0PB 2APSA 3MRBA 3BWAA 2G30A 2QJDA 1XJIA 3F7VA 5DR5L 5A6MA 3HUJE 3SE8H 3MRGB 1RURH 4OLYH 2KC0A 2DZEA 2VQ1B 4HK3N 1OKEA 5EPMA 5DO8A 3CLEL 1UG9A 3F7YB 3CFJA 4JFYA 2IGFL 4WCYH 5T3ZH 3CVDA 1CFTB 1ETA1 2GJ6E 1YUKB 4A2HA 3IGAA 5EU4A 2O6PA 1CIUA 3LNFA 3MLZH 2XN9E 2V9RA 4MRBA 4F9PC 4KI5F 1QRND 4ERSL 2JKNA 4BFIB 5GS0C 1X9UA 2WP3O 3EZ8A 5L0QC 1CICD 3GI8H 5IMKB 5C0AB 3CLEH 2A6JA 2P8PB 3W9EB 1OE3A 2R69L 3WYRA 4DP5X 4BFOA 4X5WA 1WO2A 3I75A 4OF0A 4PJ5D 4HBCH 5DZOA 4LSRH 1RQ5A 1LO0L 4WI0B 1T3FB 2AEPL 3AWGA 1RZIB 2FDBP 4Q89A 4WEEA 5KYXB 5B39G 3CSYB 1HHIA 4H1LA 4HIIA 5T5NF 3FQYA 4L3EE 3I9IA 5LDSA 4HIHB 1JNJA 3PWUA 2OV0A 3IGFA 2OXGA 4W70A 1LK3H 2JMRA 3ARFC 1A7RH 3BSGA 3QJVB 1IZKA 4ZNCD 3OAUL 2YEVB 4UBDD 1SOQA 1UC6A 3ULVC 3NA4A 1WEJL 2CSPA 4UM8B 4GKSB 3NCJL 4UQ2B 1LK2B 2AEPH 4HJTA 3UBXI 1H68A 1E65A 2A77L 2GJJA 4HKJA 4XNMA 3HC0A 2YKKA 2VR7A 1SBSL 2BWIA 3L9RB 2IJ0C 3NJHA 4HIJB 4TNFA 3ALWA 2O26U 2UUDK 3RHWF 5IWLC 4LDLB 2ICEC 3EOAB 1JGVL 1MFEH 3OAUH 1FG2A 5A16B 1A64A 4X9BA 3MUZ1 3NCJH 3PXLA 1S78D 1EEYB 3OX8B 5HHQB 5CN1A 2W88A 2Y7OA 5E4IA 1QWUA 4TQPA 5IMOB 3ZTCC 4AEIL 3D05A 2HG5A 2Z35B 4TLKA 3D3VB 5CBEA 1SOXA 4AEEA 3RDTB 1QBBA 1ZRUA 3BN9C 1PDKA 3JSSA 4XNXL 5CJXC 2IWEA 4XXJA 2VC2L 4L4VA 2P5EA 4H0GA 4W93A 4QRRA 4HC1A 4EAEA 1CLZH 4GXUN 5KBKA 1BEXA 1UTDA 3IVKB 2H6PA 1BZ7A 5E9DE 4AEIH 2QQLL 1BZ9A 3S8GB 1Q9KB 2BP8B 3HHSA 3SJVE 2FWOB 2DM7A 1OK0A 1G7PB 3VD3A 3CK0H 1QEXA 1K4CB 2JVUA 3MA9L 4UWQB 1R5VA 2NY3C 2FJFB 5DD6B 4RRPM 1E9OA 2VC2H 5AWNL 3U0PA 2B1HL 4OZFH 3QUYA 4W9EC 2OMNA 3K8LA 1YEKL 1RUMH 3VI4B 1JGDA 2VO5A 2XV2A 4OZIB 1O7DE 1QEWB 4BDVA 2I9TA 3ODUA 1I31A 5TK4A 4W9FC 1KACB 5I23A 5JPNB 3RWGA 4G6AC 5IG7B 1I7UA 1YHPA 2EXWD 4NQDE 1TQSA 1F4ZA 4QIRA 3VAEA 1B0RB 2KUTA 1HFUA 1CC3A 3NUKA 3QPXL 3U2SA 4CA4A 2XACC 4FXKA 1G9MC 1QACA 2P46B 1JWMA 2BXZA 3HZMA 4Y16A 1AS8A 2EINB 1ZDQA 2XXCB 1A65A 2IBBA 4PB9H 5J06A 1JI1A 1QNZL 4RZCA 2IXQB 1JV2B 2BPBA 3FTXA 5FS5A 2F1AA 5SWSD 3CHRA 3IDGB 5A2LH 3BP7A 3GMOA 5B8CA 3GZKA 4L3CB 3REWA 3Q6FB 2DMGA 3QDJB 3U25A 4NRYB 4GSUA 1LEKB 2VR3A 4QWWC 3VDCA 3FSVA 4X6EB 3K6SB 4P23D 1ZV9A 4M5ZL 3ZOAA 3IAGC 1T5KA 1L3WA 3U1SH 4G72B 1F6FB 1B0GB 4GAYA 1KJMB 2QADD 2UZYB 3ZZQA 5EBGA 2CLVB 4MVBD 4O51B 1GC1C 3QXWA 4PRHD 2G4EA 3O2WL 3IYLW 5JMRA 1EGJH 2CIKA 5EU6A 1BVLB 3M8OH 1YEEH 2D0FA 2EE6A 3TO4A 1URLA 4JZOA 3TZVC 4POZD 3CFDA 1IGYB 1XV8A 4CVXA 3T4AB 4TL4A 4A2EA 3I6KA 4YGVB 5JHMA 3FH7A 3FUKA 12E8L 1DDTA 4L8SC 2NNAA 5GS1A 1CXIA 2F5AL 4BUGA 4GI8A 1I82A 4XN5A 4R7LA 5F1IA 3BD5A 1JZJA 5AVZB 3W3BA 2P26A 2XIIA 1LE9A 4TUKL 4EDWH 12E8H 3CH1B 4FGMA 1N6QH 2WKOF 3TT3H 2X4QA 3T8VA 4M6NH 2A9ML 2G60L 5E4AA 1C9SA 3V5HB 1NBYA 3P4LA 4I9WE 4K3JL 3DYOA 4OCSH 3V0IA 3O8XA 5DMIH 4OQTH 4NC3A 1J05A 1U58B 1U3YA 2X7LA 4P3DA 2YPLB 2YMTA 4Y89A 4Z7UF 5IQ7L 2O6FA 4PJIF 1MH5B 5C0JB 2XG5B 3IETA 3O6LH 3Q48A 1H8LA 2VO8A 4E5XA 3NIDE 1BG1A 2XWBB 3EO1A 1VFAB 3P73A 4HIEA 2KT6A 2A9NH 4JY4B 4KK8C 2XG4B 4YDLC 3RYMA 3SE4A 4F7MA 3NCWA 3S2AA 1HEZA 1O5DT 4GUPB 2P5WE 1A6PA 3RRQA 4C83B 4LU5H 5G2DA 3LIZA 3L7FA 3VFPB 3MV01 2F5BL 1H3WM 3P0VL 1THCA 3KVPA 2X4TB 3MGOA 4K94L 4KX8A 5CO1A 5CLXA 1I75A 5F3HA 3S34H 2R2BB 3WIIH 3QIBC 1RJZA 2E9WA 5BJTA 5AENA 5D2LA 2YD1A 4ZFGH 2WBJC 3W0WA 3LS4H 4GQZA 1UD8A 1WFIA 4BSWB 1HXYA 4Z76A 3VFSA 3TA3C 1QATA 3UG4A 1JMXA 1HH6B 1QQDA 5JLZA 1JD7A 4F91B 4NJAH 1DJHA 1O0AA 1AZCA 1KIPB 3QQ9C 5JXED 4PRIA 4XRCB 1XXFC 3UAFA 4GRVA 4UQDA 5DMGD 2DYPB 5I1IL 5CEXA 2FIKA 4U7KA 5IJBC 1CFNA 2G3XA 3HNSH 4WWOA 4N8VA 5B4MD 3C6LD 2B0SL 4OIFA 3N91A 2W81C 1UZ8B 3VWKD 4JFXB 4YUEL 2O5YL 3VXOA 4MD4A 2JKWA 4G7YL 1MCQA 1GOHA 1MCSA 3QFJA 1AZUA 4Z6AT 3UGXA 3RWCA 5LGHL 3QDMB 2JJVA 3WNNA 4JRXB 1I8IA 3EYUL 4LAQL 3TP4A 1MHCB 3OLGA 4YUEH 2BNQA 2X9WA 1A6VH 2EIMB 3FH8A 3WSQH 2VL4A 1MJ8L 1HX0A 2ZUYA 1SJMA 3LB6C 5HI5D 4JFPA 3QEHA 3LV3B 4NNYB 4HUUB 1VADB 2ARJQ 2CCVA 1TJXA 3WN5B 3D50A 4LCYA 5EEVA 4FNPA 2WIIB 1J9QA 1A1NB 1JTPA 3ABMB 3SCMC 4RVBA 1EAOA 5BMFL 4KUZH 1F8TH 4AZ8A 2APVA 1SRDA 5CNHA 4KQ4L 4UU9A 3DK0A 5HJBA 5LBSH 3G04A 3QDGB 3D48R 1A3RH 4I4WB 2OMYB 1XCTB 5MENA 4ZPTA 2HTKD 4I77L 1HHHA 4HEPG 5HYJD 3PUUA 4I0KA 5KVGE 3KXFE 4KK5D 5JW4Q 2VWEE 5KVFL 5DVNA 5BMFH 1MVUB 2CGRH 3FKUS 3F3HA 1ZGLM 2APTA 4HPOH 3ZT5A 3NJGA 1M6OA 3CIQA 5I1GL 1N68A 3LKPB 3CPUA 1FN4A 5DUPL 2AKRA 1R3LA 2BMKA 1WJ3A 2UXVA 2WMPA 2GTWA 2YDOA 4IS6A 2EIZA 1X0SA 3NESA 5TH2A 3L81A 4IMLB 4AQ1C 5AB1A 4TNEA 2A6KB 3V4PB 2ZXDA 2AJ3B 3FDWA 1G7MB 5SX4H 4BKTC 3LN5B 5DHVH 4XGZA 4LQFH 4GAJL 5BO1H 3NSJA 2O5XL 4EE2A 2Z8SA 4GXVH 1MHPL 1PEZA 4G7RB 2KL6A 3AU0A 3NRPA 1EZVX 2EVHA 2XN1A 3WS3B 2XQYK 3B2UC 2NDFA 3UZCA 3BKCL 2ZG2A 4NN6C 4NQEE 4WHYG 4AYGA 4GG6F 2EKJA 4ZW7A 1JN6B 2DJUA 3IDUA 4J3UA 4P9HC 4J12A 3D85A 4GAJH 4YIQA 2XWCA 4BBWA 5EUKB 3PWNB 4XBPA 5D7KD 4ELKB 1W91A 1TJHH 1L0QA 4E9XA 5I28A 5LVEA 2A9CA 1JXGA 1UZ6E 4KQ3L 1AHKA 1NCDH 3BKCH 1HZKA 4E41B 4A7GF 3H6AA 2YFOA 2CXGA 2VLRB 3REVB 5BVJA 2NSMA 4Z7UB 5DRZB 3STLB 4PJIB 3V8CA 5TE7H 4S1DC 2MQCA 4PWEA 3MJ7A 4AMKL 3MNZA 2Y5TB 1SOSA 5D7SL 3G9VA 2J8UF 2DN7A 3RDTC 3HMXH 5GS0D 3VXSE 3OMNB 3QEGH 2QQQA 3QAKA 1VEOA 2GPZA 2K7QA 3WEBA 2ZCLH 4JFOB 3THMH 1FIEA 1JDAA 1YEWA 1GW0A 4PJ5A 1WS8A 2WNKA 1SDYA 3FU7B 3FQTB 4AWJC 1ANUA 1E3FA 1I4FB 2W0KA 4F5CE 4B9GA 1C1EH 4U6VH 3UFIA 4G1EB 4N5UA 2VJXA 4LT7A 3QUML 3S5LG 5IKCA 3BSZA 3MUGB 4UTAA 5HGDB 2R29A 1QI3A 4NENB 3GMMB 5LAPA 3OKNA 2XZZA 3ARFD 4I3SL 2PCFA 3H7BB 4PH8A 4YSDA 1WFJA 3F04A 1MNNA 2DLTA 5T1DH 2YZ1A 4XBEL 5J13B 1MEXL 2HN7B 3SPHA 2Q2EB 4AW4A 5FM4A 4MA8L 2GVYA 5CWSB 4QRFA 2V3DA 1M3IA 3X3CA 4FNLH 5D7IA 3O4LD 2RACA 1JSYA 3GUFA 4GW4B 4AVIA 5JPNC 4OV5A 5D2NA 5EOCL 3DX1A 4ZW5A 1ZLSL 5A2BA 4XC3H 2XNAB 1PFCA 3T6ZA 5ITFA 5FXCH 2KLSA 2UX6A 4XBEH 4BQCA 1J1PH 4FLHA 4M7ZB 1OP9A 3ETBF 4G7VL 1U3JA 2QGCA 4JKKA 1BQHA 4MAZA 2P28B 1B3JA 3OJ2C 2O5ZH 4TPRL 3B3IA 1BJMA 2EILB 2ALWA 1QPPA 2CQVA 3IN0A 1BWMA 3VU2A 2VDML 3QBLA 3MJ6A 1U19A 4RLDA 1OEZW 3BQUA 2CIIA 2VT0A 1F5WA 1LLAA 1MUJB 2JCCE 3DV6B 3K72B 3PREA 4HS6B 1X5HA 4RBPK 4WV1A 3GMPB 2Q8AH 5IGXH 3G6AB 4HLEA 4K5MA 4UCFA 1YEIL 3OR7A 5DD5L 1HE8A 3BN9D 1J1XL 2DAVA 5EC1A 2VKWA 5TDOB 4JFDB 5CZVL 4PV8A 2NY5L 3DOSA 4MCNA 3RWDB 3TCLB 5FYJE 3OQ3B 1C12A 2Q76A 4Y9FA 5DRWB 3LS5H 3SPCA 4HFUL 1T2JA 4NKIL 3N43F 3TEWA 1LO3L 3FAWA 3MRFB 4OFIA 4HWBL 1XD0A 1J86A 4K55A 2HKAA 4N3TA 5DD5H 1YN6A 2NY3D 3AACA 1J1XH 5DJCB 3EMLA 1E5YA 4UT7H 1PCSA 2NY5H 2R56H 1LVEA 1G84A 3JWNE 5E6IC 5CN3A 2UX7A 1OGTA 3DX8B 4Y2DC 1TFHA 1WD9A 5I74B 4GW5B 3ARBB 1X5IA 4OCNC 3T4AC 1V05A 4EDXB 4G6AD 1BZEA 4RMUA 1XAKA 3LDBC 4KHTL 4Y5XB 3A5VA 2BVQA 5FOBB 1E5BA 4JFEB 1I8KA 4FQJL 1TJIL 1LE5B 4IDLA 1FO0A 5E2WL 4N4WA 5C0AE 1SDDB 3APNA 3CAPA 3NP4A 3S88H 1M42A 1BXXA 3DPBB 3IDMB 5SWSA 2B77A 2L0DA 4K2UL 4KI5C 5KUMA 1XGYL 4DQOL 5DWUH 2OK0L 1QKZL 1EBAA 3EYSH 3QJOA 4FHKA 1Q94A 2LLLA 1QFUL 2P44B 3DTUB 2X4OB 2ZCHL 4OJYA 4X42A 4NEHB 4U6YB 4U7SA 3GRWL 5EUOA 4K5NA 1LJMA 1FL5B 4LVHC 1LNUB 4IKNA 5D5MF 2FD6H 5DS2A 1TZAA 4ODVL 4U2YA 4NQCA 5EIIB 1MIEH 1QKZH 1XL4A 2VITB 3UTSA 1XF2A 5BUPA 4UOW1 4TSBL 4JFQA 5IW1A 4YE4H 3F84A 2KZKA 2XXFA 4GG6B 3DX9B 4NQXA 4BINA 4ODVH 2R4RL 4KKCC 3S2CA 2CDGA 1OF2B 3OWRA 1KMGA 4UV4H 3TZVD 4I3GA 5CP7A 2FIRT 1WFMA 5D7EA 4XE0A 3VH8B 4GSQA 3S4SG 4JNXA 4B0MM 3CIAA 3AQZA 4NRXA 3AS0A 4O02H 1M57B 4OM0H 3PWHA 5LGJB 2EE3A 2EYRA 3FQUB 4MRCA 4AQAA 1HQRB 3JV4A 3D3VE 4NCDA 5BVPL 3MGTB 5DQJB 3ZMEA 5HYSG 1MY7A 1KFAL 3G6JF 4K9EL 1DBML 4BGLA 1UOVA 4JUTA 1KCVH 3UTPD 3SKMA 4K8RL 4CSSA 2XTJD 4NT6B 3OKLA 2ZSVB 1XF3B 3U82B 3MDJA 5GRWA 3IWVA 1C16B 3QPKA 2E9GA 4JJ5A 3TASA 1EWHA 4IK6A 3RY5A 1EZUA 3CZFA 2EXTA 4LK4A 1RZKC 2K3TA 3GJEB 3LRSA 1PGRB 2GUOB 2FEEI 1WT5A 4K9EH 3X1NA 2YN3A 5C7XL 4J8RB 2HVBA 3OF6D 4K8RH 1IU1A 3WFCL 3VI4E 4NKOA 5I5JA 2HVKA 3A6CL 1ZSDB 3L9YA 2DQJH 4KC3B 4H7VA 3ZXAC 1Z32X 1BF8A 4I5BA 4UQAA 1U2HA 3WXWH 2XZAL 4KK8D 4LNRB 3CFBB 1V10A 1BBDL 3BXNB 5GRYA 1TF4A 1YMMB 4RFEB 4CBZA 2CJ3A 4MMZA 1QMUA 1I3GL 2DWXA 1OLZA 1X5KA 4Y0GA 3BUQA 1FGVL 5DVMA 1QG3A 4IHOB 5K93A 2R8SH 3A6CH 1AR2A 3FT0A 4G9DA 4PJBE 3ARDC 1OAZL 5FDYA 3QIBD 3P3UA 2XZAH 1J5DA 1MLCB 2EDXA 1E0OB 3IMSA 3LOWA 4L4TD 3MBEB 4FNTA 3WN5C 2NY1C 2WBJD 3MCLH 3MV8A 4HYXA 1AHMA 5FUZL 4ZW8A 2IPTL 1RSYA 3QDJE 3TA3D 1FNAA 2DYRB 5K59F 1EDYA 3HJ0A 4F92B 2GBTA 3OKDB 4DCQA 2P24B 3QQ9D 1N4XL 3PUCA 3MX0A 1JZ5A 2ZCZA 4Y7MA 1FFOB 4H2AA 1NUFA 4JFSA 4WHTB 5KYYA 4XNAA 5C08B 5J6HA 3L17A 1MCKA 4HWUA 1NTDA 2R2HB 5BNXD 3UYOD 2LV4A 3JWOL 5DD1H 5CJQL 3O3BB 4XVSL 3PJSA 1JRHL 3N43B 5GGQH 5EA0H 4Y1AA 2YBRA 5C9JA 2XWEA 1CYXA 2ITDB 2OBGA 4OZHB 5E94A 1MCNA 3NPZB 1PIFA 1W6WA 4H5SB 4KXZH 1RIVH 3FQWB 4PJ9B 3V52L 3N2JA 1NGXB 5CJBA 4JG1L 4PBVC 3D4SA 4B9ZA 1NC2A 2BWQA 3RGVA 4R97C 1E12A 5E8PA 4OCWL 5INCA 2HVJB 4Q74A 4AC2A 1GU8A 4WFFE 5ISZD 3KPRA 3ESPA 3LB6D 5JUEL 2ZOKB 4UQIM 2XWJA 3C8KA 1ZANL 2YD4A 4M4PA 5AKSA 2IDFA 3TC9A 1H9DA 5KVDL 3U9PL 1Z9NA 3UTZB 3KPSE 4J2QA 4L35A 4PJFE 5IQ9A 5SX5H 4IKKA 3VFNB 4D7BA 4JB9L 4OUOA 4HOZA 1ITBB 3LEXA 1E6JH 4FERA 2RCSH 1CGSH 1AGBA 1MHHA 4MA3B 1HKLL 5KSBE 4L8CA 3JWNG 5FHBL 1CD8A 4IIQB 2NZ9C 2IANB 3PGFH 1KTLA 1GZQB 5JJEA 5LWEA 4OAWB 4FQ1L 1MVFA 3PU7A 2WVVB 5DQ9B 5F6HJ 4XCEB 5DJAA 4LCWB 2GQHA 3KHOA 4P5TB 1WUNT 1KJ2L 2R2EB 5D5MB 1IE5A 3QXVA 3MRLB 4TKWA 5T1MA 5GHWL 3QGVA 2Z31B 3CG8A 1WBYA 3HR5B 4BHUI 1Y1UA 2AS5M 1F3DJ 1UOLA 1RZFL 2K70A 1YPZA 4BZ1L 5CR8A 1U41A 2NTFB 4PJCE 1K8DB 1BOYA 1EO8H 5AVVB 2DTSA 3FTVA 3VRJB 3FS9A 4UT6L 4JCLA 4X8JB 3FB7B 4ODSL 3L3GA 5DHHA 2LR4A 5AAWA 4NYLA 2DQHL 1XR9A 2F7QA 5I5MA 4F7PA 1Z9SA 1IJ9A 5C0GB 3HG1B 5F72S 4M6ML 4H26A 1U8IA 5K9OA 4FMFA 3O2DL 5DLLA 4A67A 1A7QL 3KPNA 3CN4A 4UT6H 4DKTA 2V3FA 2F1EA 1O9VA 3MRDA 4ODSH 1NGPL 5LNGA 5EC2A 1IKOP 2PXYB 3ILPB 4ZNEE 5J13C 3Q2NA 3RZCB 4A7SA 3G6JB 4ZUVB 4BEIA 2WTRA 3ZMNA 5C0BA 1VACA 3C5ZA 4L05A 4M6MH 2L6XA 5DI8B 1EJOH 3LKOA 4J3VA 1A7QH 3HIZA 1UM6L 3RP1A 1E6OH 2ICWJ 4GW1A 4AW7A 3UAAA 1A9VA 4FEIA 2Z91A 3ML8A 2FH8A 4M7LH 5J1AA 1FYTE 3HAEA 1QUNA 1YNKL 3QJHB 1WCBA 2B9BA 4M7ZC 4U3XA 1GA2A 4LBAA 1Y1DA 3TBTB 1KTBA 2BSED 5G36A 3L5JA 4QRSA 3SGKA 4NKDA 1IL1A 5ANMA 3OBAA 3VNYA 4DFIA 1OD9A 5ICZA 4S1DD 1AO7B 3MJ9A 3KCPB 4G5ZH 4NRZB 4A7QA 2CJSA 1KYUA 4N2CA 2G5BB 4F9PA 3U48A 1YNKH 1QR4A 3F83A 4X4ZA 5LGYA 3RDTD 1S2EA 5ELIA 3RVUC 1K2DB 1T4WA 4FABL 4U6HA 5ICXB 4P49A 5J9PA 5SWZB 3GRGA 4CN1A 1UAZA 3EJJX 4HUXA 1T7XA 1AD0B 2D7MA 5F7LB 1MWOA 1IBFA 4P2YA 1IV8A 1HH9B 4J1UA 5ICUA 5E9NA 2Q87A 4PJHF 5LWYL 2X53A 5MEQA 4JHBA 3IT8D 3RWHA 3V0VB 1RJCA 1CXEA 5FYKH 1TQWA 2HH0H 3ARBC 4JO3L 4LLWB 3HZVB 3P4OB 5T3XD 5CD5C 1FL6A 2DL9A 1IMHC 1F4YH 3DGDA 4NO0B 1RULL 3MRQA 1T22A 4WAVA 2IDQA 4ORZC 3BPNB 3QHFL 4OFDA 4YR6B 5D1XE 1FV1B 5H2JA 4YDZA 5LWYH 5ACZB 4CNIB 1KBWA 3RWFA 3RZWA 2I60H 1LEGA 5DURB 3QJRB 1KIQA 4WI7A 3MLXL 2BCKB 1NFDA 3NCYP 3I74A 4ZZFA 1YEFH 1TVBA 4CU6A 4YXHH 3ARUA 3FCTA 4KTDL 4NQQA 5F89B 1XF5A 1D7BA 3OHXA 4N2AA 3ZO9A 2C9AA 4PYGA 1KPRA 2ZYIA 3L2LA 1NCNA 3QORC 5E0FA 4D0DB 3W39A 2X1OA 4QOKB 2M8XA 1YQVH 4ETQB 4XOCA 4E42B 4KTDH 4KFZC 5K9JH 2RTTA 5G5DB 1BLNB 4C4UA 4YSEA 2IFFL 4G80A 3KJ6L 2Y0SA 5E23A 3VQ2C 1M2OA 2F1BA 4H1LH 3U30B 1IKNC 3NGBB 3PABB 5C8JA 1CXHA 1WIPA 3QI9B 1MLBB 4ELME 3T3PF 4QTHA 3KS0J 1JPTH 1WBZA 2WLNA 4P5MA 3SDXE 5M7QA 4JRWA 3F64A 2QPFA 2IWGA 2IFFH 2IG2L 4LBEA 1S4IA 4Y9BA 1Y0LB 3FPYA 1S7VA 4G6FB 3EFFA 3GLAA 1QPXA 3L4TA 2AAVA 2YCWA 4F2MA 4UTBL 4DW2L 4F37F 1FNHA 2Y22A 5AW6B 1CLOH 1IQDA 4G6KL 3EXLA 4ETYA 3GI9L 4R5XA 4EKXA 4F8TA 1EUTA 3FZUC 3FUMA 1CL7H 4KI5D 1HILB 5EMYA 3T0WA 5F7YC 2YA2A 4YL9A 2JJSC 2OMWB 4QTIL 4Y19E 3MLRL 4L1DA 4M8VA 4OZ4B 4PJAF 4YPGA 3H9SB 3N42F 4W4OA 4KJYA 1WBXB 3GBEA 2X89D 1XVSA 3OMZA 2DQMA 2YPLD 4XAKD 3O2VH 4GINA 3LXAA 1QPKA 2BX5A 2PPDA 1RZJC 5C0EA 1JYVA 1ORQB 5F1KC 3NTCL 1QLRA 2XXGA 4HC1H 4FULA 1KT2B 2V3EA 4QXGH 3SBQA 4PAZA 1AKPA 4H20H 2HRHA 1PYWA 3MLRH 1MFDH 1XMEB 4JKVA 2NQCA 3C08H 3PIQA 1OGAB 4LLVA 3P3YA 2A4EA 1BQSA 3NN8B 1S8LA 4AMJA 1E2VA 4HJ0D 5D4QA 3BAWA 4C54A 4Y2NA 5AVQB 3RJQB 2WQRA 4KKCD 1MG2C 2G9HA 3NTCH 2XPZA 1I1YB 1BFVH 4Y9CA 4AVKA 1JDDA 1P4BL 1INEH 1J18A 1G7JA 1H5BA 2QR0A 3Q9QA 4JANB 4QPEA 3MBEC 4L8SA 4GG8A 3GSXA 3AXIA 2AXFB 5EU3A 1ZHKB 5IFAL 2YD7A 5ABAA 5FA3B 1A6AB 5I6XB 3SPVB 1MCEA 4C4KT 1RHHA 3O3UN 4NWTL 4DNLA 3RVVC 2FHFA 2QPDB 2A3TA 4YLBA 2YWYA 4HEMA 4AQEA 1CG9A 1OALA 2DQTL 2PKDA 3ABGA 3APDA 3QZMA 1WHOA 2NUTA 1KYOK 4ACPA 3L3KA 2E47A 1M7IA 4OJAA 3BUYB 4KXAA 5HGAB 4AL8L 4CN6A 4YPJA 4D9QE 4C4BA 2NZ1A 1PVHA 3Q5YA 2DMKA 4RAVA 2FYYA 1PL3A 4OFVA 5TFSL 1GHFH 4CMMB 2AJXH 3NIGE 5DEGB 2W65B 5LXGL 1UXSB 1UWFA 2UXGA 1R24B 3CN2A 4P4RB 1JGLL 4XZ4A 4PGBB 5EDXA 4JJOA 3IN2A 4LESA 1XTMA 3L4WA 4PJHB 3V7AE 4EVNA 3K6NA 4XODA 5AUMA 1CE1H 1NSNH 2VE6B 1FA4A 1L3NA 3QDMD 5EU5A 3GSOA 1DVZA 4JRXD 1SJHB 4ZMPA 5E9AA 3EOYG 5IFHL 5FHAH 1NCCL 2IGLA 3ZPRA 3GMQB 3ZIMA 5F2FA 3CFKB 2FBRA 4UTCA 5LXGH 4QRUB 3S3SA 3EGXA 3ARDD 3FXIC 4OBSA 4OB5L 3FT1A 4D0CB 1VKXB 1JPFB 4GQQA 3VFRB 2MFNA 1D5BA 5KN5A 2NY1D 2QFRA 3X12A 1NCCH 3QWOA 2IOMA 5DHEA 1NCJA 5EBLB 2EDWA 5AYTA 3MR9A 3RA7L 3S4SB 4Z7WF 4JDEA 4H8QA 1MW3A 2CR6A 1OB1B 3GWJA 1Q72L 4ZD3H 1LYQA 4IIQC 4KKZA 5HGHB 1GY1A 5DJ6B 3QDGD 3A6OA 2CNYA 3NJIA 3DVNA 2FVNA 4KAQH 2XI9A 2ZOOA 5HYSB 2XZCL 4LKCA 1NOFA 4EO5A 4P5TC 3I9GL 1HDMA 3K3QA 1NL0L 1IM9A