3EH4B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 46
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh4B02
4NC3A 2YCZA 4BUOA 5EHFA 1J5CA 2W8CA 3PAZA 4HIPA 5G36A 3UONA 4YSRA 2ZFEA 4EJ4A 4QLWA 3AYNA 3NJFA 2WO2B 3SBPA 5AZDA 1IC0A 3FQ2A 1TKWA 1JFPA 2EI4A 1XB6A 4JQ6A 2I7OA 2TSAA 3QJQB 4GXFA 4K9JA 2Q9OA 5B1JC 4BVNA 3FYIB 3QJTB 3OMIB 3S8GB 3NYKA 4E9YA 2ZONA 3ABMB 5E9NA 3QDCA 2JAGA 1AT9A 4A4MA 4A2GA 4A2DA 3JTBA 3G5WA 1JV7A 3PBLA 1NIBA 1FA4A 1KDJA 1OOWA 2IAAC 1ADWA 2XV2A 3H56A 4HCIA 1Q5IA 1RZPA 1UCQA 1X9UA 2KSYA 2JXMA 4PXKA 3TBCA 2MRYA 3ZEVA 3FSZA 1HFUA 1GZMA 9PCYA 2X72A 4UG2A 1L9OA 4GBRA 3ABGA 5D4JA 1B3IA 3DKHA 2Y00A 2YDVA 1ZIAA 2JKWA 2BHFA 3A7KA 1CYWA 4XTNA 4KNSA 3TU6A 4QI1A 1JZEA 1E65A 1MDAA 5J7AA 2Y04A 2ZZLA 3NSCA 1IKOP 2F93A 2AVFA 2J55A 2VMJA 2UX6A 3EHBB 3SBRA 2X87A 4A2EA 1SF3A 5I6OA 1UATA 2EINB 4DPAX 5BR2A 1PNCA 2I20A 2VN3A 3X2QB 2YCXA 2FNWA 4GYBA 3JT2A 1IXFA 1BEXA 2VW4A 2QDVA 3OQRA 1W6LA 2IWEA 3AZUA 3OE9A 2BO0A 3SN6R 4BV0A 4A66A 2B3IA 3V2YA 1E30A 1PCSA 2DWTA 3NSYA 4KO9A 4BXVA 1J9TA 5C1MA 2CCWA 4FA7B 1S8JA 4OV0A 5B6VA 1FWXA 2H3XC 2H5UA 2QPEB 3QBKA 2YXVA 1BQRA 1TEGA 1M57B 1ET8A 3NJLA 3WQJA 5TK4A 2PCFA 1GYCA 1JZIA 3FPYA 3OD3A 1LN6A 3UADA 5B1AB 1C3WA 1TEFA 2XXGA 1S52A 4YSQA 1BAWA 4NERA 1A3ZA 2E86A 5G54A 3ASNB 3CAPA 4X32A 2GHZA 1OCOB 1WS8A 2BZ7A 4DP4X 1A8ZA 1BXAA 1KGBA 5JJNA 1X0K1 1EZLA 4BEYA 3X1EA 1XIOA 3H4HA 2ZOOA 1L9SA 3RYMA 2FWLB 3T6XA 2LLNA 3ZBMA 2PCYA 1PZAA 1E12A 4N4YB 1FBBA 1KBWA 2HX7A 2BP0B 3NY9A 1L9HA 4KLYA 5G53A 3ABLB 5B3SB 4HYJA 1AZUA 1S53A 5H2LA 4K5YA 4L35A 4GP8B 2VW6A 3WNJA 4YSSA 2VW7A 1A4BA 3V2WA 2GC7C 2UXGA 1NIDA 4HYXA 4BWBA 3UTXA 1BXUA 1IBYA 3FSAA 4WTQA 4YVUA 6PAZA 2Z73A 2ZWNA 1C8SA 1FFTB 2PP9A 1KDIA 1AANA 3S8FB 1HAUA 4TXVB 4AKQA 1VJMA 1ZDQA 1J9RA 2EIJB 2P80A 1X0I1 1R1CA 2YAOA 1SNRA 3KW8A 5I6NA 2PP8A 3QAKA 1J9QA 4Q89A 3FSWA 3UABA 3T6ZA 4E9XA 3PAUA 1QM8A 5AX0A 3VHZA 5B2NA 1N68A 3DIVA 4F7KA 3NYAA 5ITEA 2IWKA 2YAEA 1AAJA 3TASA 1CYXA 4YSCA 3UAEA 3ZDWA 1NPJA 4DP1X 4XTLA 3NJHA 3BVDB 2BRDA 4N8UA 4DP8X 3PQRA 2IDQA 4BDVB 3CODA 5A44A 2HX9A 2AANA 1AG6A 3UAAA 3NS0A 5B1BB 3UTVA 1QKOA 2FJSA 4DPBX 5B7FA 3CZUB 3GDCA 1PY6A 2I85A 1IUZA 3C9LA 2CBPA 1BQKA 2AZAA 2H47C 4YSTA 2R7EB 3TA4D 4N6HA 2YXWA 4HHGA 2F95A 3IEAA 2I21A 4Q8BA 4BDVA 1C8RA 1AP9A 1KMEA 2DV6A 4MFHA 1V55B 4A2FA 2UXFA 1R84A 3VI0A 7PCYA 2NTUA 3COCA 3OMAB 4GP5B 1ET5A 4KNTA 4JKNA 3UZAA 2R7EA 2KSBA 1OE1A 2WJLA 1DZ0A 3EMLA 1S8LA 4J4QA 1M0KA 1ID2A 2IDFA 5I6MA 1SDDB 1F88A 2YCYA 2VM4A 3IN0A 1PNDA 4A67A 4WAVA 4E9VA 3IN2A 1E5ZA 2PPEA 3QJSB 3CVCA 8PAZA 1JVLA 4FPDA 3ABWA 4KOCA 5PCYA 4CSPA 3OE6A 3QBLA 5AX1A 3NJMA 3WNIA 3WG7B 2GBAA 1F56A 1QHJA 3WKQA 1ILSA 2G87A 3FS9A 3HAOA 2TSBA 3DTUB 1JXDA 1NDTA 1NIEA 1CWQA 1A65A 1SDDA 2VSMB 3CVDA 3WKPA 3HASA 2DWSA 1GSKA 3GXUB 1AZRA 1R2NA 3EH5B 4L6RA 2XUWA 2BW5A 2JFCA 4XXJA 4FAAB 1QNIA 1M0LA 4CSZA 1UAZA 2Y1AA 3D12B 1SFDA 1ZDSA 3QAPA 4G70B 1AS7A 2GIMA 4E9SA 1WA0X 1X9RA 2EIKB 4PCYA 2XU9A 4E9RA 3PXLA 2WJKA 1GY2A 3HARA 1V10A 5F7AA 1NTDA 3RZEA 3EH3B 2BWDA 5I5MA 1GW0A 4MBSA 4IB4A 1MZZA 2GI0A 1DYZA 1JZGA 1JXGA 2IH8A 1SHWA 1ETJA 2FTAA 2IH9A 5G2DA 5TGZA 2QDWA 3EF4A 1NIAA 4QIDA 3PAVA 4AI7A 2OV0A 2FQGA 4PAZA 1OF0A 1AIZA 3CDZB 5H2KA 4KO6A 3MX0B 5I28A 3EH4B 5B6XA 1TN0A 5H2JA 3PLYA 2HRHA 1M56B 5EN0A 1MG2C 2Y03A 2J57A 4HAKA 4XT1A 2NTWA 4W9ZA 2PLTA 1NIFA 1PXRA 4BEZA 1FBKA 4G71B 3HAPA 1AR1B 1VLXA 3CDZA 2X88A 2Y02A 1JXFA 1BYOA 4G7QB 3S3DB 4GPOA 5B0WA 1L9TA 2FT8A 2XV3A 1URIA 3T6VA 1CURA 4QKTA 5I6PA 2PP7A 4FBZA 4L0PB 1CUOA 1KCBA 3HEIB 3X1GA 4YSUA 5DHGA 1QLEB 2XWZA 1PF3A 1X0SA 4KO5A 3P0GA 4DPCX 1KV7A 3X1BA 2R4RA 3HANA 2L6XA 2J5WA 1JVOA 1SFHA 2BWIA 3NY8A 4KNFA 2OCCB 3FQYA 5B35A 1JV6A 3SQRA 4DP6X 4DP0X 3NJIA 5A7EA 3T6WA 4F2FA 2HRGA 2YAPA 1KYAA 2DYSB 4NAJA 1NWOA 4DP7X 2UXTA 3QJVB 1I53A 4E9QA 4TL3A 5G28A 2BP8B 3PCYA 1BXVA 4KO7A 2PEDA 4DAJA 4G7SB 2OJ1A 2VSKB 5FJGA 2CUAA 5I26A 1L9PA 3CVBA 1SF5A 4RH4A 3X3CA 4DKLA 1Q5JA 4P5RA 2CJ3A 1AS8A 5DYSA 5F7BA 4WW3A 3REYA 1PY0A 1WAEA 1J9SA 1KGYE 1JERA 2GC4C 2YARA 3CG8A 3T9WA 1KG9A 3ABKB 1ASPA 2BP8A 4JHVA 2EILB 2PPAA 3U25A 2QPDB 1QHQA 4E9WA 1GS8A 2UX7A 1RKRA 1A4CA 3SBQA 1ZPUA 4XT3A 5G2CA 3AG2B 3T71A 4GYCA 1AS6A 3ZIYA 1O0AA 1P8IA 1ET7A 1H2SA 1HAWA 2N0MA 3NP3A 4BWTA 5LWEA 1NINA 4F2EA 1PXSA 7PAZA 2P80D 4YVNA 2W88A 1QKPA 4LDOA 4AX3A 4EIYA 3AG4B 2ZXWB 4KNUA 4UAHA 3HB3B 3NP4A 3IE9A 2IDUA 2IWFA 1OCZB 3FU7A 4IAQA 1EHKB 2HZHA 1GR7A 2BZCA 2M3GA 1A4AA 4PXFA 1NWPA 2GSMB 4JHUA 3AG3B 1M0MA 1U19A 5AHZA 1E0PA 3PDSA 1HZXA 5DHHA 3OMNB 4YSEA 1RZQA 2XV0A 2YAHA 4EF3A 4ENZA 2HPYA 3X1FA 1F4ZA 1V54B 2YAMA 5AKRA 2DYRB 4BXSV 1L9RA 1ZV2A 5ETZA 4AMIA 3UZCA 5B6YA 5TK2A 2J4YA 1JGJA 1VGOA 1E67A 4YSOA 3VGAA 1JZJA 2ZIYA 2CALA 3NJGA 2XLLA 3OM3B 2VT4A 3TBBA 3HAQA 4Y9HA 4HZ1A 1XMEB 5PAZA 4E9TA 4YSDA 3QBIA 2AZUA 4MD2A 4G72B 4DP2X 3AY2A 1J5DA 4HWLA 3VG9A 3GYRA 2YCWA 1OCCB 1BRRA 1GY1A 2RH1A 4YSAA 5H2OA 2RACA 5ANHA 2XX0A 1ZIBA 5B34A 4DP5X 3FSVA 3QJUB 1S51A 1E5YA 1SHXA 2WSDA 1KG8A 3N55A 3UACA 4MQTA 1PZBA 4MQSA 3NSBA 1OV8A 1GU8A 1N70A 2J56A 3FPXA 3FQ1A 2I7SA 3NJKA 3WIAA 4X31A 4BK5C 3S3BB 5G2AA 4X1HA 4GY4A 4DJHA 3X1NA 4M3HA 5H2HA 1KCWA 2NRDA 1BRXA 5H2PA 2FQDA 2FQFA 3WI9A 5B7MA 5JJJA 2LNLA 2IDTA 5AHYA 5B1KA 6PCYA 4XTOA 2XXFA 4P5SA 1MZYA 3QBGA 2XX1A 2KS9A 4WKXA 4UF7C 1NPNA 3ERXA 4UHRA 1GS6X 1MGYA 5AWZA 4LDEA 5B1JA 3AM6A 4QRYA 1AACA 1BRDA 1AZNA 3T45A 1WA2X 3DDLA 1ASQA 4GRVA 2WO3B 3MBWB 3QQXA 1JZFA 2BW4A 5KKHA 1S54A 1PLCA 2FT7A 5I6KA 2HXAA 3ASOB 5B7EA 5LDUA 2PPFA 2HLEB 3PPSA 2A3TA 2UXVA 2YQBA 4HCFA 2KSAA 2QT6A 1M9WA 4GP4B 1MG3C 5IY5B 2DY2A 2GB2A 1CC3A 3IBOA 5B6ZA 3N2JA 2B08A 4JKVA 3NSFA 5FC9A 5I5IA 5H2NA 4YL4A 4N4WA 1AQ8A 4AKOA 3OE0A 3ZX1A 3KW7A 3PXOA 5ITCA 4IARA 1JOIA 1IW9A 1W8EA 4HCGA 3AW5A 4AZUA 5JJEA 2Q5BA 5H2IA 1AZBA 3RFMA 3UG9A 1BM1A 5A45A 5BR5A 2YAQA 2PPDA 3C75A 3NT0A 1DZEA 4G7RB 1SJMA 2FQEA 3V9CA 1ILUA 3QJRB 5B6WA 1W6WA 1KBVA 3L45A 3VW7A 3OAXA 2R4SA 2FT6A 4BWUA 3V9EA 1YLBB 5AZUA 1PMYA 3FT0A 1PLBA 1RCYA 4UANA 3KJ6A 1PLAA 5A8EA 1OCRB 4A68A 5AFAA 3D4SA 3NSDA 1IW6A 1GUEA 2Y01A 4AMJA 2AFNA 1PAZA 2VM3A 3FYEB 4X4KA 1XB3A 4ZK8A 2PPCA 4HHWA 4DP9X 1NICA 3MBVA 4KOBA 3QPKA 1OE2A 3FU9A 3OE8A 3H4FA 4AKPA 4YSPA 4NB7A 4HALA 3NJJA 2IDSA 1L9QA 1PZCA 2HX8A 2CAKA 1WS7A 1L0MA 3BQVA 3ZPRA 3X3BA 1XJIA 3FU7B 1BQ5A 1BYPA 2BP0A 3FU8A 4M4RB 3ZPQA 1AG0A 3AG1B 2JAFA 1XB8A 4BWWA 3UTWA 1F50A 3PWHA 1WA1X 3ODUA 3DQBA 4JR8A 1ASOA 1JZHA 4MD1A 2EIMB 2XYBA 1AZCA 5D4IA 1P8HA 1GS7A 4A2HA 2XVBA 2YAFA 2I35A 2Z55A 2I1XA 1AOZA 2YDOA 2AT9A 1OE3A 1P8UA 4LDLA 1TN5A 1TU2A 4W1TA 2Y69B 3AYMA 5H2MA 3UTYA 1IBZA 3VVKA 5I6LA 3S3CB 2MTAA 5I5JA 5D4HA 1T5KA 5F8UA 4EA3A 3C9MA 1H68A 3UGEA 3NJNA 1NZRA
chains in the Genus database with same CATH superfamily
1HYSD 3VXOA 1UD8A 4ILDA 3HS8A 4NC3A 4LL4A 2YCZA 3RNQB 1C5BL 2YPVA 1BG9A 1DVFA 3ZLQC 3MRFB 1J5CA 3GI9H 3L2LA 3MV8E 4NRYB 1AGDB 2UWEB 2GSGB 3IXTA 1R0AH 2WXOA 5D8JL 3QIUD 4JFQB 1MCWW 3WN5B 4BH8A 1JFPA 2FEDD 3EFDH 4K2UH 3SO3C 1A14L 2JQZA 3BP5B 1JTPA 1C7SA 1GOGA 2K1MA 2HTLC 5HY9A 4NZRL 4WEBL 5FWRA 4PJAF 3ZTCC 2PTTB 2R0WL 3B2VL 1E6JH 1U92B 4UQBA 4J1UB 5CNHA 3DV6B 4S0TD 5AW3B 5JDSB 3PBLA 1RI8A 2BY2A 3IJ8A 3L08A 1PYWA 4Q0XL 5EO1A 3P4OB 1RZPA 3DO4A 4N2NA 3SY0A 2NW3A 1IE5A 3BZ4A 3A67H 4KRMB 3FU0A 1WFNA 1LEKA 3MREA 5JMRA 4HUUA 2DJMA 3IDNA 5CIPB 5F7HA 1BWMA 1BPVA 4KK8D 3TF4A 4UU9B 1JE6A 1I8IA 1N10A 5D4JA 2F18A 3OXRA 2Y00A 2Y22A 5ESQA 4KKRA 4M1DH 1ZGLM 4KITB 4X4XA 3CXDH 2CD0A 2X7LA 3CBRA 4DF9A 2FR4A 2IF7A 2CKBA 2Y5TB 4KHXL 5EEYA 1I8LA 3WENA 2Y36H 4MAUH 2WWNA 2XWDA 5KVFE 2ZP8A 2WNWA 4PJ8C 3V4PH 3SPJA 3RI5F 4E5XB 5H4ZA 5I6OA 3KYMB 4PWIA 2GJPA 2BOLA 4K23H 4MJ6B 1RZKL 3KZ8A 1JN6B 4X8XA 3IRCA 3RUGA 3WIHH 4C56D 2FNWA 4AEEA 2WLLB 4FQXB 3O9WD 2G75B 5LCVA 3TZVA 4FADA 1BOGA 5FUZH 4AGNA 3T3ME 3N3EA 2VDLB 2HWZL 4MJID 1PIGA 4GW4A 4I1NB 4NUMA 1T0MA 4Z8FH 2YXVA 3CH1B 2R56H 4Q14A 1LLAA 5I23A 3ZE1E 3IKCB 1S9YB 3DARA 2EEAA 3TTYA 1BAWA 4KKQA 3H9SD 3K71B 4PUBH 3ASNB 2BZ7A 3ZDZF 2NTSP 1IVLA 3DX0A 3GBLA 3NIFB 3LZFL 1UWXH 1NKOA 2QKIC 3KPSA 4MA3B 3AMLA 3N40F 2DPKA 3IU3B 4GO9A 3GGWA 5G53A 1R24A 3IDUA 2ADJA 1OXYA 5TDOB 2E6JA 1S7TB 1R5WA 1D7CA 1KB5L 1TQSA 3O3UN 4OZHE 5CMAA 4DOHB 4S1DD 32C2A 3FSAA 1K72A 4MYWB 4N90E 3T5WA 2FGWH 2AEPL 5INDB 3VQ1C 2IAMA 4K3DL 3WIFA 2HSIA 1MJ8L 4I5BB 5E4EB 4LEEA 4P23A 4XP5H 3F84A 4OVVA 5HHVH 4R7LA 5LGKA 1HWHB 1PKQA 2A6KA 4F7KA 4MTMA 2IWKA 4D7BA 5ESAA 5BMFH 2HTKD 1FZOB 2EDHA 4A55A 5GS1B 4GEJA 2C9VA 2X6CA 4ABWA 5HI5D 1VDGA 4OB5H 4GAJL 4JHZA 2OFQA 4OW6A 5C08A 5F7EL 3GRWL 3ARGA 4X5WA 3TEZA 3CHXA 2NSQA 2YO3A 4N8CH 1QQDB 3ATFA 4M48H 2AV1B 2QZQA 2DI7A 1T22B 3D2UA 4YDNA 6CGTA 3V95A 3GB7B 4BFIB 1IEHA 4U6XB 1XEUA 4NHUB 1QD0A 1KLGB 3CZJA 1OT1A 5FA4B 1JZ4A 2UVFA 1GAFH 4FABH 1MHPL 2NT1A 4J2QA 4H8UA 4GUOA 3NRFA 1VPOL 3NMEA 3BC9A 3OJVC 4DPRA 2P4AB 5HYJE 4JN1H 1BQLH 3N04A 4JY6A 1L7TH 3A6CL 3GJFH 4P2OC 1YQVH 5FYJU 3V5KA 1FNEB 4AT6B 2F5BH 2B4CC 5AQ0A 1WWWX 3ZTNH 4ENED 3GSVB 4PP2A 4Z77B 1ID2A 1AP2B 4RWHA 2X4TB 4H8WC 1DUZB 1NCIA 3H8NA 1U33A 3CDCA 1H3XA 1NBZB 3QNZB 4MA8L 4U6VH 1JZ8A 1B4JL 2XI9A 3K2UH 1HHHB 3B3BA 3A4FA 1BF5A 2BNUB 3TA3A 5HP5A 5JZ7C 3W5MA 5CBEA 2BNQA 1UXLA 2F54E 3LDBC 4OGYL 1J05B 2VSMB 3CVDA 4MD5B 3FQRB 1DQVA 1E43A 3HASA 1LO3L 2X3AA 4JX0A 3T2NL 4MB5A 2DF3A 2VB5A 2KZKA 3BFQG 4DO6A 1QNIA 5L0QB 3FRPG 3UYRH 4WFED 4LARH 4L4TE 5IB4B 4HT1H 1VEPA 2E4FA 4ZO8A 4N2EA 5CCHE 4NM4H 2J1KA 4QAMB 1DR9A 25C8L 4OCSL 1AD0A 3RZEA 3U6RB 3RFZB 3ZZSA 4NUGL 1KCRL 4C8XA 4PRIB 4J3TA 1SEQL 4A04A 3EJQA 2DIAA 2FQGA 2F58H 1NOAA 4MMXC 1OF0A 4TNGA 3MX0B 2Q8AH 3HN8A 5HYSB 3RX5A 3STLB 3QHZH 1T1ZB 3SGDI 4F2MA 2HRHA 2ZKHL 5E8EA 4NP4L 3E3QE 1NDMA 1CN4A 4FTVA 4PRPA 1P5UA 3ULUH 4WENB 3ZMNA 2R4SH 4G42A 5C0EA 1NANH 2VQ1A 2Q86A 2X88A 3VTAA 4Q9QL 1UT1A 5A2JH 3V4PA 4I0PA 3UC0H 2Z7ZA 4JBSA 4RBPH 3VCLB 1KCVH 2PR9A 2P46B 3VXSD 2XV3A 3H6AA 4LPXA 1IIIA 5EH1A 2VLLA 3WIHA 1L7IL 2H9GB 2PP7A 1ZRUA 3R4DA 1G7PA 3JSSA 3GSQB 4JM2B 4D0CB 4MDJB 4OLYH 4KKZA 1WWCA 1UKTA 2A9MH 4XP9L 5HXMA 3Q5YA 3SDAD 4GAYA 4AQ1B 4PJXE 2Z9TA 1R3LA 3X14B 1G7QA 1I1FA 3G5ZB 4KNFA 1JGEA 4M62H 5BQDA 2AEIT 2BNRB 3C08L 2CLVB 3NCCB 1II4E 4O9HL 3ZKND 4O2FA 5CEXB 3MJ8B 4MD0A 2XNAA 4JAMA 4HIHB 4X7TB 3S96B 3VRJB 1I3GL 2WLIB 3LKQA 5TD4A 5D6DA 2ZSWA 2XWEA 3WY3A 1BX2B 4CU7A 4KK9D 5B3JF 4DFHA 4R90H 5FJGA 3LPWA 4LNRB 5D2LB 3KCPB 5I71B 3FBQA 3NJVA 1OWRM 3FB8A 3D39B 1QFWL 3BDBA 2AP2A 3REYA 5I8KL 1B9KA 1NUDA 1WIOA 5GSRA 1OGTA 4EQ3A 5BS0E 3MJ9L 1Y0LA 2BVOB 2YPLD 3REVA 4PJ7E 3DWTA 3UC2A 4P2QE 4Y1AE 4HFWA 2AQ3A 1AFVL 1J10A 5G2CA 4MSWB 2A0LC 4KK5C 4YUEL 3G6DL 1I9IH 2X70A 5C97A 3QRGL 4LDOA 1ZKAA 4UT9L 3SPCA 1TZGL 4IBWA 1UB5B 3FU3A 4JFEA 3F65A 3DDGA 2X4SA 5D2NA 4B9ZA 2KL6A 3TEYA 3FB6B 5J56B 3LTVA 5DUPH 3L3OC 4U7SA 5IB3A 3ESPA 1E3ZA 2XV0A 1RU9L 2YPVL 3SE9H 3DX7A 1Q9LA 5C9KA 1MIEH 3GD1C 3VXTB 1G7IA 3J8F7 2HRPH 3ECVA 3MUJA 3SCMC 1UQSA 1IC4L 4ZQKA 4M1CD 4PWJA 4ZRGA 5CGYD 2ZIYA 2BS8A 1JV2B 3C60A 5E8OB 3OGCA 3GINA 2A77H 4TYUA 1DVFD 3TBBA 5IT2L 3NIGB 4U6YB 1R3IH 4N0UB 1GCYA 1IRAY 4N2AA 4UIMB 3BKCH 1GGIH 1NOFA 3M17B 1OAUH 4H7VA 1J11A 1U8JB 5EEXA 1MW2A 3E6HB 5HPMA 4CGTA 2DBLL 3GJFA 3IGKA 5I0XA 4YPGB 2W60B 4D9LH 1O7DE 4LBEB 3FRPA 3HZKA 2L04A 4LQFL 3ZRCC 1JRHI 1W0WB 2XIIA 5AB1A 3UDWA 3RPIA 3OXSB 4NQEE 3L1OH 3ARFB 3JZ7A 4XOBA 5G2AA 1K8IA 3MNWB 3ZHDA 4B9YA 3T0DA 3ISYA 5F3FA 2CKBL 4QXGH 2FZ3A 4JHAL 4RAVB 2HFGL 4G8GB 4IQHA 3BT2L 4KY1L 1JWMA 1M1XA 4LKCA 2J6WA 4EN3A 4Z5RA 4XTOA 2XXFA 3TIDA 3WYRA 2J1WA 3MROA 4PGDB 4G8AC 3VXUB 2OK0H 5D71H 4LLYB 4PB0H 2ESVE 3NACL 2J43A 5KSAA 4QOKB 4Z18A 1I7RB 4YXKH 1I8KB 5DWUL 1T1WB 2E9GA 3T45A 2L7QA 2QSQA 1ASQA 1MHCA 4K7FB 3U30B 4H5SB 2Z34A 3FB7A 3MNDA 1LO2H 1TZHB 5SX5K 1MF2L 4CL7A 3DSFL 2EKSA 1HH9B 1PFCA 4HGMA 4NT6A 3T8MA 5BOJA 1A7RL 2YQBA 4TL4A 2QT6A 2OR8A 3MV8D 3V6ZB 1HIML 4MS6A 4YGVA 4PRHE 2B08A 1QI4A 4E41A 5I0ZA 1T4WA 3MRJA 2VXTL 1GXEA 1SLWA 4J39A 4Y4KC 5HGDB 4EBQL 4HCGA 4PJAE 2D0GA 3CQQA 3LNIA 3VD2A 3LXBA 3MC0A 3MJGX 4ODXA 1JGLH 1IV8A 3DX6A 3NT0A 1QBML 3KM1A 4XMZA 3PWLB 1L9NA 2GFBA 5HDWA 2C4XA 3HLAA 3OAXA 2R4SA 3PABA 4P3DB 5FB8B 4JREC 4HIXH 5JOFA 3K8LA 5A8EA 1MJUL 2OQJB 1IW6A 1VACB 2X4QA 4NSKB 3KPSD 2J25A 4GIOA 4PLKC 2VAAB 3ZQ9A 3DURB 4S10A 2Q87A 2B59A 4B3VA 2OULB 3SDDB 2IDSA 1MI5D 4OZFB 3AB0B 4LXFA 1N2RB 3QUMB 1BZQK 4BQCA 8FABA 2OYMA 4K3EL 4WI0A 1NC2A 3DGGB 1BVLA 4HUWB 4G7VL 5K59F 3P2DA 1PZ5B 4L29B 2IAMD 4K55A 4B9PA 2R2BB 5EZIL 2WVSA 3JWOC 4KROB 1XCWA 3IMVA 2VYRE 1WPCA 2ZAHA 4A2HA 2OXHB 1O7VA 4PB9L 1JZ2A 1ZTMA 4N0CC 3NZSA 4BZYA 2CDEA 3OKYA 3VA6A 2C1PA 2D7TL 4JFYB 4HZLB 3AREA 3THML 1EGJH 1NCGA 3RRQA 1DQLL 3L5IA 1WICA 4NN5B 5DRNA 3QZNA 1T1YA 3W56A 1IO4C 2X2UA 5D4HA 1XZ0B 1NGWB 1YNTB 3UGEA 3LZQA 1FZMA 3I50H 3L3KA 4LU5H 3LKPB 4AGOA 1S7QB 3ARGD 4GSUA 3K6DA 4XO9A 3VXME 3ZDZE 5KSBF 2Z35B 2YD5A 5F9OL 3D2UD 3WFHB 3B8SA 1FE8L 1ZOXA 3LZRA 1EO5A 3G5VB 3HLKA 1F1GA 3WEOA 5TE6L 2DYPA 3P54A 2OW6A 3D69A 2DRUA 3H7BA 3HNTH 4KC3B 4ADGA 5I1HL 1J8RA 1ZLDA 3LV3A 2GYSA 5HDOA 4KHTL 3DJSA 2ETWA 4FTDA 4QNPF 2XIBA 3T4AC 4A4MA 2B4CH 3KJ4B 4GRMA 5FW8A 1K2DA 1AKJB 3PHQB 4CJ0A 2XTJD 3H56A 4KRNA 5L4JA 4A38A 1UCQA 3VX0A 4H8WH 4TVPE 2JXMA 2FSEA 1M1SA 1E9PA 1AXSA 3GI9L 3KVPA 5DVOA 1J88A 4NNPL 5K39A 1WC7B 3BQUC 4BFJA 2BCKB 2BS9A 3EFDL 1R5IA 1RIHH 4K2UL 4F7MB 2NQ3A 4NOBA 3FULA 4M6MH 3B9KD 3ZT7A 3DC0A 2OAAA 3U2JA 2BNQD 1VKXA 4WK4B 1ODUA 1A21A 1DVZA 3ETTA 4X2UA 4YZWA 2EDYA 1IKOP 3UROR 2EC9U 4JFFA 3VFGH 3GF8A 3VSVA 1PIFA 3MYJB 3NCEB 5D7LE 4JDZB 4M7ZB 3A67L 3MXWH 2EAEA 4Z3HA 5ECGA 3HG0A 1T7XA 1BEXA 4KKLC 1W80A 2AKRB 1ZHLA 1W6LA 3K8KA 4MCZA 3QEUA 2YD1A 1ZSDB 1PCSA 4M1DL 3SYOA 1U95A 1WAAF 3EG9A 2X44D 3DXAD 3ECWA 5DI8B 3MZGB 3SKJH 5IESH 1NUNB 4JY5H 4QWWD 4BA8A 4DGVH 4Q7DA 3OD3A 2Y36L 4MAUL 3B8YA 3QISA 3V4PL 2YA2A 1O6VA 3RWCA 3MMEB 4K23L 3NFNB 1A6AA 3WIHL 3EYFB 2A6IA 3HR6A 1KGBA 4F7EA 2Q7AA 3B6SA 1HCYA 2JCCA 3VVVA 3T0BA 4PJ8A 4F15B 3KYAA 3FO1B 3CFKA 3ZT6A 2F9BT 5FUZL 3VWJB 1UVQA 3ETBF 4MHHI 3VH8G 4HYJA 5CUSH 4Z8FL 1S53A 2RMNA 4K5YA 3MV9A 2AXJA 2R56L 3V7AE 4XO4A 4HYXA 1BXUA 1JHLH 1SLVA 4OF6A 4WJKB 3MBEB 3S4SG 4ZW5A 3W9EA 1E40A 5DQ9B 1BLIA 1HI6A 3NK4A 2Z31C 2Y7OA 2YRBA 2EVGA 2VDOB 3O3BA 4GKSB 1NFDF 5FIEA 3ZKXC 1C16B 4QD2E 3PAUA 1QM8A 1AI1H 5J3HC 1KEMH 1IAIH 4LP8A 1XFPA 5FM5M 2E5EA 1IGFH 3UERA 1TF4A 1BD2E 2XXCB 4Y2LA 4W9DC 2C3HA 5T1LA 2QKIA 2HUHA 1N64H 4ZTOH 5C07E 5K9OA 1TVHA 2FGWL 5HHNB 4YXHH 3VM5A 4G83A 1Q9KB 2P8LB 3LS5H 3NS0A 5GRYA 1IFHH 1WUZA 3KYOA 1CBVH 3Q0HA 1UOWA 1P4IH 4XP5L 5HHVL 3LHPL 4X4ME 1P1ZA 1DDHB 1JGVH 1KOAA 1U8CB 5DFVD 4ODTH 2YBRB 2YXWA 3V4VH 3WFDH 4GO8A 3TH3T 3DO7B 3VXRA 3T6QC 5HGBA 2VJ8A 5BMFL 2FL5B 3S5YA 5C2BH 5HHMD 1CXLA 3LCYA 5KBKA 4URTB 4QRFA 2BRRH 5D7IA 1TJIH 1QRNA 1RUQL 2D7OA 2DLGA 3Q2CA 3UBXG 5I19H 4FZ8H 3DBSA 2B9BA 2ORBH 3FUKA 4N8CL 2WUCH 5FYKE 4M48L 4RFNB 1UGKA 1LE9A 3WTUA 1T04A 5SWQB 1NCUA 3CVCA 4TTGA 2I5YH 1OWWA 3K0WA 3BH9B 5LNDA 1IC5H 4WU5B 2X5PA 3BZFB 3CD4A 3EGXB 3JUYA 5B3JE 2NY4D 2NY7H 2ZAIA 4OZGA 3FNKA 1KG0B 1GOHA 1GAFL 2EDRA 4FABL 4ZMQA 2APVA 4CVZA 1QRKA 3TEUA 4JN1L 1BQLL 3I9IA 4HGWA 1L7TL 1YQVL 3GXUB 5FW6A 1PY9A 2F5BL 1MQ8A 1BDYA 5IMKB 3L81A 1T0NA 2Y3NA 5DVNA 3N41B 2MCG1 3D12B 4QJ5B 1AS7A 5E7BA 35C8H 4DUXA 3GIVA 1BBJA 4Y16B 4P2QD 2P24B 3K2UL 3NCJL 1U3NA 2J6EH 5F7DA 3O2DH 3BE1H 3H6JA 4LPCA 4PJ9D 5D72H 1BIHA 5E1QA 4HPHA 1YEWA 4AVIA 4N6RB 3LJ3A 4ZMNA 1REIA 4JFDE 5C09A 1CVRA 4PJHF 1EJOL 2GTWB 3QRFM 3O4OB 1XXDC 2WXNA 5AVZB 2ICEB 1TN0A 3V0DA 2ZJSH 4LARL 4HAKA 4HT1L 43CAB 2P47B 2PLTA 4EN3D 2JLPA 3RL1B 4UT6L 1E4KC 1OAJA 4L1DA 4Y19B 3VB8A 4LVOB 1BYOA 3OC8A 3K6NA 3EFOB 3ZMEA 4JK0D 1NCAL 1MH5A 4J3WA 5AB9A 2Z6FA 3RBSA 4QKTA 2F58L 4FBZA 4XNZB 3B9AA 1NCDH 4BK5A 2Q8AL 2VQTA 2F8XC 3QHZL 1QO3B 2ZUQB 3VFUB 4PLNC 1KV7A 5T1JA 3VH8A 3KDPB 1SFHA 2YEZB 2Z93B 2DWDB 4MMXA 3ULUL 2G30A 2R4SL 4F2FA 2VOTA 5TQ2H 1QMUA 3VG0H 3I74A 4Z3GA 4IBUA 3S4SA 3HHSB 2R1WB 1LO0H 2CG9X 3DVNA 2GBUA 3UC0L 2PW2A 3PCYA 2H2PC 5MI0B 4E36A 2HJFB 3P02A 5L8LB 1C8PA 1UACH 4OFDA 1AD9B 1HILB 2BIIA 4JRXD 4U1HB 3PQYD 3TFKD 1QLFB 3MTXA 5CCKH 4GG8A 5T33H 4UAOC 4OLYL 1RHHA 2JJTA 5CEYA 4AW7A 4NUQA 2DIEA 4U31A 2Y7QB 3IGAB 4MCYB 3GDBA 3QIUB 1RL1A 4NBYB 1AO7E 2UY6B 3D5OF 4M62L 4JN2B 4TL5A 3I02B 1X9LA 3BCFA 3KLLA 3MZTA 3WEAA 4LL9A 2M26A 3C5SA 4L8CB 5F21B 3PWPD 5LWEA 1NC2D 1G7JA 2G2RB 4IU3A 3CLFH 3JWOH 4NPYB 4JFHE 4F80A 4UAHA 2V5TA 4NRZB 1SRDA 4PV9B 2YD6A 3AQZA 4UTAA 4DSYA 1MCHA 1YMMA 2Z91A 1E0PA 5CN2A 4XTRC 4ZMZA 2V3FA 4D9QD 3IMTA 1SVCP 1H9VA 1YC8A 1KCSH 1YEKH 1V54B 3ARED 4QDGA 2MEJB 3QO1A 4YGAB 5D1QE 2Y7MA 4OFIA 3SODB 2MCAA 1I9IL 3AQYA 3KBEA 1GZQA 3FQUB 3MLTB 3NG5A 3GBDA 1M7DB 3F7YA 5I15H 1ZHNA 5SWZA 4G6JH 3BWAB 4C56B 4JR9H 1IILE 3V4VA 2IXQA 3QJOA 4OFPA 1PG7H 2XLLA 3Q5OA 5E6ZA 3O9WB 4ZODA 1WBZB 2PW1A 3MUGB 3UBHA 2OMNA 2QGBA 3C6LA 3RX9A 1A6TB 1H0DB 5DUPL 2N56A 3NQKA 4HUXB 1AQKH 3UTSD 5GGQH 2XWTB 4MJIB 2VLRA 1ZV5A 3L9RB 3WELA 1MIEL 5AKTA 4R4BA 3JV4A 4GBXC 3X12A 5K59E 3RAJH 1P2CA 4OGAC 1MLBB 3FPXA 3L3OA 3H9SB 5AKSA 2BX5A 2XFGB 3ES6A 5FS5A 5ID0B 5A6LA 2OA9A 2CGYA 3L17A 4XVUC 2A77L 3VFOB 5KANI 2E7BA 3P9LB 3SCMA 3ZN6A 1S7WA 4HD9A 3U2SB 1R3IL 4I18C 3BXNB 1FV1A 5JNYA 3QH3A 5B1KA 3MKKA 4X50A 1P4UA 1GGIL 1OAUL 5CZRA 2KLRA 3LNDA 3Q2VA 4WRLA 4FKHA 5CZXD 5F1KC 4PBXA 4F37K 3DV4A 4D9LL 4DK3A 4BSWA 4M02A 3QARA 2F74A 2OZ4A 3EBIA 4JFFD 4Z7QF 4QRSB 3L1OL 5KSBE 1PLCA 4XMXA 5JYLA 1YEGL 5CCGE 4O51B 2HTLD 1KYOK 3QPQD 5ETUA 2J6EA 3O2DA 4QXGL 1KB5B 4R6UA 4MVBD 5HVGB 1MG3C 3DBXB 5ABDE 3TNNB 5DQJB 5DUMH 4UOW0 3HKZA 3PXJA 2OK0L 1D5MA 2ZKWA 4PJ5E 5D71L 4PB0L 4YE4H 2EVJA 1ORQA 3CV5A 1IW9A 1W8EA 4N5ED 1H5BB 3SDXB 3G6JF 5H2IA 4W93A 2X6UA 4QNPE 4YXKL 4N8PA 3INOA 1RSYA 1T5WB 2DH2A 1CWVA 4YHKH 4DTGL 5F93C 4AVJA 1A0QH 1LO2L 4AL8C 5T3XE 4ZJ9A 1IBBA 2B7DT 4X6CB 3PU7A 1INQB 3LS4L 2A9NL 2WB1A 1WRFA 1A1OB 1T2JA 4PJGA 2YRLA 1RIUH 2PPCA 4HHWA 5IFAH 3UTTE 1WHPA 4BE5A 1EFXA 2KLSA 1BCIA 2XVKA 4GS7B 5F1OB 2I07B 3BMVA 1H3PH 3HS0C 5IMOA 1JGLL 3CPLA 1ND0B 1KTKE 3FQXB 3MRMA 3D25A 1AYRA 2BK8A 2BSRB 1GJIA 2JELH 1TFHA 2WZ5A 3B56A 2OMZB 2WJ7A 4GJTB 4LLAA 5I16A 4HIXL 4Q4IA 1B0IA 4JPWH 3BPLC 4P49A 1SEBA 4NEHB 1CDCA 1PQZB 2WD0A 2DLTA 1KMGA 3T0EA 1H6EA 3B34A 3WFCH 4N8VG 2XKNA 1WAAE 1S9XA 2JKSA 1IU1A 2YSSA 5H2MA 1WGOA 3V5HA 3C9MA 1H68A 3E8UH 4LGSB 4TUJB 3QUXA 2O72A 2EYSA 4WW2B 5CEZH 4L8SC 2ICES 4JQIH 3RTLA 3VG9B 1DQDH 2VUYA 3UZEC 4NS0A 4GIPD 3S37X 2JWYA 1DQQA 4NWUL 5DSCA 5B38B 4JCMA 1H8SA 1GZPA 2XWBB 3TN0C 2N01B 3JBG7 4QRAA 5T5FH 4GG6B 4QHKI 3QA3B 2BHUA 4YDVB 4ZTPH 3GMQA 4E9YA 5GJTH 2EXYC 5FA3A 4P57B 5B39G 5CSBA 4EKJA 4YFDB 3L5WB 1JV7A 3F7KA 3I50L 1NIBA 4LU5L 4X80H 5IOKA 2XV2A 2GI7A 1Q5IA 4EJ1C 4XXDA 3CU1A 3KS0J 1NFDE 1HNGA 4JFXA 2W81C 4CVWA 1EAPB 3D0VB 5LB1A 1W72H 3TFBA 5ID1A 2EUVA 1HFUA 3FO2A 4F92B 5JPNC 5G4MA 3DK0A 2X0UA 3N43B 4ELMA 5AVVB 1I9RH 3I75A 3O4LE 1SN5A 2HFFB 3VXSB 3HNTL 2Q7YA 2JKWA 1XF3A 3EGSB 4UBDD 1N0XH 4GUCA 1MY5A 5DUBA 1K6QH 1A6VH 1KC5L 3SDAB 1AGBB 3HN5A 4NM8L 4ZFQA 4NNYA 5C07D 1TZIB 4FG0A 4KBPA 2BMKB 4H8WL 2ENYA 2WKOA 1MKFA 4K0OA 4GYBA 2CK2A 2ARWA 2ITCB 4LOVA 1A9EB 3T4AA 1JNHB 3B2MA 5KYWA 2LU4A 4GSQA 4BRVA 3KXFE 2WXFA 2B3IA 1ICTA 3E3QC 4M6ML 4QR7A 1I1CA 5EOTB 4NQXB 1UEMA 2A9BA 4NCC1 1BQRA 1HC1A 3FCTA 3BQUA 5C09D 3BIKA 43C9A 1JZIA 2XZZA 5IB2A 2VXQH 2Y7LA 1BIIA 3WXWL 2VLJE 4YSQA 3BZEB 1BQSA 5AENA 2GITB 2YPLB 3GRBA 3PP3H 1JPEA 2Y23A 2WQRA 4MA7H 3MXWL 4JDVB 5I17A 4S1SH 2ZPKH 1JHTB 1X5MA 2VR9A 3QDME 5A6MA 1QHPA 2YOAA 2ZX7A 3HC0B 1NEUA 2L0DA 4LCYA 4Y9EA 3KWXA 4M8VA 4KKCC 2PCYA 1IJ9A 4EOWL 1WZLA 5IESL 3SKJL 4ZD3H 3UTQA 1YPZA 4JY5L 2C4FU 3WY4A 4TMPA 1SPDA 5IGXH 4J4PC 5EBWA 4FQ2H 4WTQA 5ERWA 4PRAA 3SQBB 1KYUA 1USQA 4WFHD 2BY3A 1MY7A 3TO4C 3WOVA 3M45A 1A4KB 3QS2A 4H26A 5DS2A 5IJVA 1OGAE 5EO0A 2NYYC 3UG4A 4N9GB 4XZUB 1BFTA 5JIKA 3Q6GH 3LKRB 1FNLA 3CC5B 1RZGB 2EYTA 3EFFA 2ITEA 3MGTB 4IOIB 2F53E 1VRSA 3MV01 5CUSL 5JW4R 4DP8X 4PJHE 5DFTA 4K8RL 1JHLL 1DVFB 4HWBH 5GPRA 5A44A 1MRFH 3TH4T 2N4IA 1S7VB 4MNGE 5G4NA 1G9NH 3EUUA 3IXTB 3IAGC 4N8VA 3UTVA 5D7KE 5E2VL 1BYNA 3DX4A 3PDOA 4X5PA 1IEAA 2Z8RA 1RSFA 2FHFA 2IQAA 2VC2L 5HY9B 1AI1L 3DTXB 5ESVA 3ZE0B 4BFBD 1KEML 4K8RD 1OP5H 1IAIL 1VA9A 3UCRA 4BZ1H 4UTAL 1ANUA 1QSEA 1XIWC 2DM4A 5HYIA 3GBMH 5F0MB 3LOWA 1PYWB 3DECA 3IVKB 2DEXX 3COCA 1N64L 3FQ4A 4ZTOL 1AE6H 2NW3B 1QSFE 2GVYA 3QDJA 5JO5B 5CR1A 4JKNA 1ZT1A 3MREB 4YXHL 4HUUB 2G4GA 4H2CA 5F70A 1RURH 3LS5L 5DO8A 1IFHL 1SXAA 1S8LA 1XHHA 2FLMA 1CBVL 1YMMD 2CO2A 4TNVK 5IJKA 4DCQA 3HG1E 4CNIB 1AMXA 3BPCA 5MHSD 1JGVL 5B39A 1QI5A 2VUOA 3WFDL 3V4VL 5KAQG 2JKIS 5G5DA 3F6LA 3KYNB 2FR4B 5AX1A 1XGPB 2VLKA 4MD4A 5C2BL 1F4HA 1UYWH 2OKMA 4HXAH 4OUUA 4JQIA 3DTUB 3PG2A 1PU0A 4U49A 2BRRL 1A65A 1TJIL 2R0ZH 5SWZD 5MP6H 4M3KB 3RUGB 3TCTA 4FZ8L 4FA8A 1O7DC 4L8BA 4NZTH 3CFIC 2WXMA 2ORBL 2JFCA 2VRAA 5T5FA 4P8QA 1BOGB 3C6LD 1H6FA 3TBVA 4E9RA 4P06A 1ZT7A 2VLRD 4DWHA 1SMAA 1F2QA 2EDOA 3QXTA 4ZOBA 5F7AA 4Z7OB 4R26L 5I0DA 1OLLA 4XNBA 2NY7L 2XXMB 4IB4A 2GI0A 3PGDA 5A2IH 1P7HL 1ZXKA 4WFGE 4QIDA 2OV0A 1UHVA 3HR5B 1W72A 4IBTA 5DJXA 3D30A 3QORD 4BQ9A 5F9JA 1VFMA 2E47A 2BOCA 4OU3A 3KPSB 4TTDC 3RIFK 5KVFH 2OZ4L 4GI8A 2QQNH 1ED3A 3VI3A 2V9QA 3Q06A 35C8L 3QDHA 5DC4B 3GGWB 2RTTA 3ATEA 2G9HA 1MI5B 4KI1A 4IBSA 2ADJB 4PJCB 2J6EL 2EQDA 3O2DL 3BE1L 4S0HA 5D72L 4G7QB 4FJZA 4F7CA 4X5QA 2IAMB 1BVNP 1FG9C 3DUUB 5E6ID 5I6PA 4JFZL 4XH2B 2HT4D 2J8OA 4KJPD 4OLUL 1D6VH 1ETZA 2X0WA 5DRZA 3ARXA 1N6VA 2K4WA 1PKQB 2ZJSL 1HKLL 2X9ZA 2QMJA 2NDGA 3CVHL 3M7OA 5JHDA 5C9JA 4N20A 5ESAB 1ZHKB 5I9QC 5FW7A 2IOMA 1ADQA 4XNQA 2VXQA 3OAZH 5C6TH 2N1KA 1CL7H 4GQQA 3U0TA 5DHXB 1JSYA 4XB3A 2PF6A 3DRTB 3ARGB 5AYTA 4JO4H 5TQ0H 4AL8H 4CRPA 5TJWK 1E4KA 1NCDL 3D2UB 4XR8C 2J5LB 3C8HA 5CU9A 4PJFF 4QHUA 3Q2LA 3QEGH 4MXWH 3HB3C 3F12A 1A7BA 2APTA 2EILB 3KEDA 2QPDB 3LQZB 4IKNA 3ZT5A 3NABH 2WXLA 4BHUI 1E8ZA 4HJGB 1EFXD 1BOYA 1CI3M 1OD7A 3B83A 2W95A 5J8OA 4TSCH 2HFEA 1LO0L 3Q01A 5DF0A 1WDAA 5E0QA 5L4IA 5CFAA 5DMYA 3LVEA 1OP9A 4JY6B 1BGXH 3D3VD 4JPKH 4L23A 3V5KB 4BWTA 2XTJB 1NINA 4Z7QE 4LT7A 3Q2NA 4HWEH 4PP2B 1OF2A 1URLA 4KPHH 5CCKL 3V6FA 5T33L 1T3FA 5E2UH 4LK4A 4JZNA 5EBLA 4M4RA 1LYQA 1YAIA 1F4AA 1GR7A 4EAEA 1EJ8A 3QFJE 1NCWH 5FO2A 4WI3A 1ZAGA 3B9KB 3T0ED 2RFXA 1URZA 4DKAA 1U3JA 4KDVA 4YSEA 5I8CB 1JK9A 2BNQB 4EF3A 3G5YA 4HWBA 4I88A 3G6JE 4PJ5D 5JQIB 3LB6D 4HCRH 3BUTA 1TXKA 4BELD 2V5YA 1VFAA 2WLMA 5CP3H 1UWXK 3CLFL 3AT0A 2AV7A 3A6BH 3JWOL 3QUXD 4QF1A 3OKMA 4LLQA 3A47A 1MHHA 4G5ZH 3CN0A 4YIQA 4RLDA 2Q6WB 4FHBD 4BZ1A 2VDNB 4KQ0A 3QBIA 4PRDA 3AY2A 1AD0B 2D3LA 5DTFA 2YCWA 4NN6B 2ENPA 2OS7A 4PW3A 1C12B 5EBMB 4W9IC 5E70A 3DETD 1KFAH 3MRBA 3DXAB 3MLRH 5FX3A 4HS6A 2P45B 3HNSH 1KCSL 1YEKL 2KZWA 3CZEA 4JY4B 2D03H 3FSVA 4QJ4B 4YHNB 1E2ZA 3H9HA 5MENE 3EHBC 3WFEH 4N0CD 1NMCB 3HE7C 4K5LA 1LWHA 1T66C 3FF8A 4U6TA 2ZG3A 4MGXA 5E8EB 4F2MB 5I15L 4G6JL 1NDMB 3LXAA 4WFFE 4D2NA 4JR9L 1P5UB 1A7NH 5E5UB 5GZOD 1IMHC 3I6GA 1PG7L 4LDEB 4FMVA 1UWGL 4G42B 5BRZE 3VU2A 2VQ1B 2Q86B 5HJ3A 3V4PB 1G7HB 3DOSB 4I0PB 1AQKL 5GGQL 1KB9K 1MFBH 4X8GA 2KS9A 1VGKB 2WN3A 2VLLB 1U3ZA 4J6IA 1CPUA 4LSRH 5AWZA 1G7PB 4UV4H 3S35H 3RAJL 5AD0A 1EXUA 4XOAA 4HJIA 3WCYA 1BVZA 4KX8A 3K2MC 3ZSSA 3LRKA 4KTDH 1R3LB 1UD3A 5CM1A 1I1FB 1JGEB 4GBXA 1P4BH 4LMQE 3VFTA 3VD5A 4Z0BL 4J3BA 5A1AA 4MD0B 5DHVB 2XNAB 4JAMB 4M5YH 2YEQA 3LZNA 3AWGA 4H0GA 3LKQB 2KMWA 3BD5A 4LF3A 2KPNA 4Z7IA 1R19A 1JOIA 4FQJH 2H6UA 2VERA 3F85A 4ODSH 2EECA 5FFOA 4ZXBD 4EXKA 3FB8B 4I18A 2I24N 3BQUD 1DZEA 4KFZC 4L4VE 4G9FE 1E4WH 3VQ2C 3D4ZA 4AH2A 2EZ0C 3MA9H 2O5ZH 3REVB 1XX9C 2HLFD 3KM2A 4N26A 5LWYL 1PLBA 2CH8A 2AQ2A 2DIJA 3QQ9D 3PWUA 4ZAKC 5A2FA 3GMMB 5AFAA 2O61A 4HFWB 4ANVA 5INCA 2KQNA 3VVWA 2X05A 3E2HC 5DUML 3CBKB 5HHMB 4NDMA 3MBVA 4OZ4B 3UP1A 1QKZH 5E2TH 5ANMB 2ZYSA 2VL5A 2HX8A 5I76A 3RWFA 4D0DA 4OZIF 1XH3A 3X3BA 4YHKL 1WLHA 1WQVT 2ADGA 1G6RB 1WFTA 1A0QL 3ZPQA 1AG0A 1QR1B 2X4SB 2F5AH 1CO1A 4X9GA 4BKLA 4HH8A 4YHZH 1MCSA 4JR8A 4LSTH 1I9EA 2O26U 4FYRA 3DX7B 3V6BR 2XVBA 1A22B 3PNWA 1RIUL 2NY4B 2UZIH 1B0RA 5IFAL 3HHMA 2AT9A 5GGSB 4DJMA 4LOEA 4DS7E 4ZFGH 1UQSB 4ZQKB 3HUJB 3KXFD 4BSVA 5EN3A 3KWWA 3IM1A 4NCC2 1FI8C 1H3PL 3FONB 4Y5XC 2F7IA 4OZHA 4QJ3B 3DJRA 4Y2OB 1CICA 2ENSA 4FQCL 3OGCB 1TKWB 5G4OA 3GLAA 5TE4H 3FL7A 2JELL 3PE9A 4QRUA 5D96C 5IVXF 2Z1PA 4JS7A 5AUMA 4HJUA 1KIPA 3HS0A 4L5FE 4LDCA 2VR4A 5LJYH 4U1MA 3P4MB 4JPWL 2I9TA 2GKIA 5LG1A 3ZKSD 2VABB 1QG3A 4P2QB 1EX0A 4LL1A 1LEGA 5J12B 4A7GF 1JFQL 3GJFB 5C6WH 1Z5LA 3DMMA 2AABH 4X5XA 3WFCL 3NCWA 3VFSA 2I7OA 1GZHC 2TSAA 4MLIA 1QSED 4K9JA 3VRIA 2Q9OA 3C6SB 3RPIB 4UTBH 2O5NA 1K8IB 1TJGH 3JYCA 4QYAA 3E8UL 3QDJD 4I77H 4O2EA 4AYMC 1F6FB 9CGTA 5J3HD 2DB8A 2BIPA 2YZ8A 3O3DA 2FZ3B 5AAWC 1XGUA 5F3HA 4N0FA 5CEZL 1Y7VA 2AJUL 5HDBB 4JQIL 4LKCB 1M1XB 2MKLC 4EN3B 5DEFA 1L6ZA 4ETYA 4B7LA 3KH4A 1E3FA 3MROB 1RIVH 4HCRA 1HTYA 4FNRA 4IIQA 4JB9H 3FSZA 4CILA 3CJJA 4IW4C 5KSAB 1TOXA 1ZCRA 4RNRB 5CP3A 3QCUL 2C7UA 4MB4A 5T5FL 2VLKD 4ZTPL 3UZEA 1MHCB 2CHZA 3K4ZA 1RUAH 1VSCA 3FB7B 5HYJA 5GJTL 1T21A 4X83A 2W80C 4WHYH 3RGVA 3SGEI 3T2PA 1MVUA 3P4LA 4XXCC 2NQCA 2CRIA 4X80L 2IIJA 3V0VA 3T1FA 5KEZA 2WIMA 1MUJB 3X11A 2EJ1A 4E41B 1F45A 3MRJB 3FO9A 1W72L 3LPOA 4OV6F 5D5MF 3PAYA 5AW8B 4B60A 3KPQA 1I9RL 1X4XA 1EJFA 4ODXB 4LVHB 2KDYA 3ARTA 3BVXA 4CW1A 3RGBA 4RDQF 4JRXB 1CLVA 3CTTA 3PQYB 1NCCH 1FWXA 4JGUA 4JKLA 3PABB 2Z8WC 3QZOA 1U8PA 5JPNA 1K6QL 2VSDA 1A6VL 4IOSA 4WHYG 4JFVA 5KYYB 4QY8A 3LEYH 1C3WA 1LGVA 4W4OC 4ODUA 4HGKC 4NERA 1WUNT 5FGCE 2DOCA 1KIRA 3MOBL 1YEHH 5AOJA 3L7EA 3D34A 2B59B 4YDIH 1HHGB 2J88H 1AHWC 2ZOOA 3AUVA 2NX5A 3RYMA 3WUZA 2AXWA 4IJ3C 3PWPB 4WNQA 4S1QH 4X9FA 8FABB 4K71C 1NC2B 1BVLB 4TUUA 4RZCA 1I8UA 3FTYA 2BIHA 4FFTA 5E99L 1Q0EA 3QXUA 5TE7H 3CFDA 5DJDA 5LXVA 1ADQL 3ZDXF 2EACA 1NIDA 2VXQL 4LEOA 3UTXA 4Z76B 5DJCA 1S5HA 3TCXA 2D4FA 1M71A 5ADPH 1FDLH 2X1XR 1C5CH 2YKLH 4HJTA 4MA7L 4S1SL 1VJMA 2ZPKL 2XPZA 3LKOA 2P80A 5F6HJ 5F7WC 4OLXH 1E6OH 3AREB 2P52A 3U4AA 4NO5A 4PYGA 3O8XA 2Y1ZA 1AAJA 1YEFH 3IJSA 5T3ZE 4YSCA 1SXBA 3IPEA 1NPJA 2DD8H 3D4CA 1KFGA 4ZD3L 4NYLA 2WLJA 2BRDA 3QZBA 2BJMH 2WCGA 5IGXL 4FQ2L 3CODA 2R23B 3ORJA 4PJXA 2CO6A 2O5YH 1JD7A 4AITA 1FO0H 2QL1A 3PL6D 1DDTA 3D51A 3UTSB 2V2WB 3CZUB 3H7BB 3Q6GL 4J4PA 4AYFA 4HX1A 3OZ9L 4HS3A 3IDYC 3LV3B 3TO4A 4NRXB 4HHGA 3CVIL 1QI3A 5CLZA 2DV6A 4GRMB 4M03A 4WNSA 3BAYA 1K2DB 3SGDH 2UZYA 3MUY1 3BP6A 2B1HH 4GAAA 4HWBL 1R6VA 2JXMB 2FSEB 1MRFL 2OMYA 1AXSB 1S78C 4KNTA 4PMFA 3OB0K 5D1QC 5BS0A 1G9NL 5K39B 5E8NA 4PJ7A 1HNFA 4HPYH 2XACC 1J5OH 1SDDB 1HDMB 1PNDA 2J3SA 1E5ZA 1MCOH 2FVNA 2VDMB 2WLHA 4HXBH 1EH9A 2YOCA 2WYZA 4AJWA 2AJZA 4KXAA 4BZ1L 1MAKA 3TPUA 1BG1A 1X5HA 1CT8A 3W39B 1K9TA 4A2MA 4Z7NB 5IVZA 4JFFB 1JFHA 3GBML 5DMKA 4QRPE 4HAFA 4ICWA 1AE6L 4Y5VC 5EIQA 2DLFL 5FO9A 2DWSA 3JQOB 5KVDE 4PJFE 3HVNA 2EE2A 1RURL 1XIWA 3EH5B 3LEXA 2BW5A 3EYUH 1ZHLB 4MCZB 3QEUB 2VNCA 4Y2NA 4QRQA 2XN9E 4GSRA 2IBBA 3T09A 4UTBA 3CHQA 4TVPH 1UXSA 4F27A 3HARA 1KLUA 3WS3A 5IHHA 3DRQA 3U4EA 4A37A 1UYWL 4HXAL 1JZGA 2N7SA 3QJHB 3BVTA 4XTRD 1NIAA 2X4OA 1LQBC 4MRCA 2J8UF 5MP6L 1A6AB 2A6IB 2EDNA 4DW2H 5B6XA 4F7EB 3B6SB 3U1QA 2JCCB 4NZTL 4KJWC 1QFUL 5CN1A 1X5AA 2UWEF 4PJ8B 5D93C 5GRJL 2Q8BH 4J23A 1UVQB 3QFJD 5IZ7A 4IHBA 1NIFA 2BXYA 2RAMA 1IJNA 3AGWA 4P2RA 3UZQA 2LTQB 3NN8A 2IWGA 2WP3O 4MQ7A 4BUHA 1K8DB 1HSBB 5GHWH 3ZL2A 4IMLB 2VL4A 3W9EB 5TGBA 2KUTA 3ARZA 1C7TA 4NQEA 3UZVA 5FDWA 1HI6B 3C6EA 4YS4A 5IMLA 2WBJA 3O3BB 4LSVH 5E23A 5B4MD 3IU4H 2XWZA 4GBXD 4AVHA 4HU2A 3A4AA 1NFAA 4NIKB 3AU1A 4UTCA 1MFMA 3BDXA 3OHXC 1KYAA 4NAJA 2BP5M 4XVUD 4LIQH 5E51A 2QKIB 5MEQA 1S4IA 3BN9D 1TVHB 2WMPA 4KO7A 4OD3H 1CF8L 4YFLI 2SEBB 4LRNH 1CR9H 3BZ5A 3EJYC 1L9PA 3R1GL 4YFEA 1ULVA 2PTVA 4N0RA 4ZO9A 3KYOB 1ACZA 1OK8A 2FBJL 4NAQA 1AOHA 4P5MA 2KYIA 2XJKA 5JOPD 4FNQA 1P1ZB 1TLKA 3CG8A 1XF2A 1JG9A 2V9RA 3DVGB 3RWDB 5HJBA 3VXRB 1U36A 4C4UA 1NEPA 1S6NA 4IOFC 2PWGA 5EV7A 3GJEA 1JGUH 2EDKA 1TZOA 4DN3H 4RMBA 2CNZA 1JRHH 4PJEA 3UJIL 5C6TL 1CL7L 4MNQE 4LCUB 1ET7A 2E9WA 3O2VL 3QC5X 4JO2H 4JO4L 5TQ0L 4F2EA 3N44B 3AY4C 1IGCH 1QZ1A 2CKNA 4OD2A 5DO2C 4JW3A 1UZ8A 2BHZA 2GY7B 4HISA 4TULH 2ZKMX 1OCZB 1EHKB 3QEGL 4MXWL 4HG4J 3NIFF 1G43A 5F3BA 4PXFA 3VI4B 4V11A 1U19A 1TTBA 3NABL 5I0WA 2CQVA 3AAZA 2E9IA 4OCLC 5I73B 3BDYH 4KXBA 4Z1PA 2C1OA 3SJVE 2HVJA 3RNKA 4TSCL 2P5WA 3LZLA 3UP6A 1BGXL 4HGWB 4JPKL 1CICD 1FO0A 1WP6A 5C07B 1KTDA 2QVFB 4ZPTB 3R7RA 1JGJA 3VD4A 4HWEL 3ZGIA 1RMFH 3RVVC 3OVUB 1SYVA 3KNBA 4KPHL 3GBEA 5E2UL 4XMTA 3GIVB 5H8DA 1BBJB 3O3EA 4MQSB 5PAZA 1J8KA 4DP2X 1NCWL 3CZGA 5DJ0B 5F7DB 3MTRA 3DMMD 1GPOH 2XWCA 5KVGE 4HIJA 4BV1A 4F24A 4YDKH 5ENWA 2ADYA 2TRHA 5DJ6A 5IHZA 2VMEA 5C09B 1U58A 4HCRL 5ICXA 3MRNB 4OZIE 1A6ZB 4KI5D 4MQTA 3JV6B 4QLRA 5AW9B 3IMBA 3QUZC 5ICZA 4PBDA 3A6BL 3BKJH 1KF9B 4LOFA 3LDBB 4XPTH 3L95A 2ZX8A 4GNKB 3TT3H 4EIZC 1TTCA 2X3BA 1GJUA 5JORB 1QASA 3GXPA 4QXUH 1S8DB 1KFAL 3MLRL 1NKGA 3HNSL 5D7EA 3OZLA 4TM9A 3KPRD 4DIXA 2D03L 4KDTC 4X0NA 3BMWA 2QV2A 3RGVD 2XN0A 3WFEL 3B2PA 3UG5A 5G2NA 4ATTA 2H41A 5IVXE 2O6PA 4TKWA 1SVZA 3VH8B 3RVUC 3PWJB 1UFGA 1A7NL 4Q9BA 5EOCJ 4BJLA 3Q8BA 1OB0A 3DX9A 3PPSA 4LCWD 1FNFA 2A3TA 1FLTX 1N59A 4LP5A 5C0AE 4HCFA 2WVVB 1E9OA 1EXGA 5D9SA 3DVNB 3NSFA 2PW2B 4U1IB 1MFBL 4LLDA 2D0HA 1CFNA 3BP4A 4P4KC 1JDCA 1UJ3C 4LSRL 1Q0YH 4RRPM 3CFUA 5JJEA 2Q5BA 2WXJA 1S7RB 4GG8B 4UV4L 3S35L 1BM1A 5A45A 4WUUE 1RHHB 3V9CA 4DKTA 4IDLA 1WV7T 2AERT 5L4FA 5D7LA 2VR5A 3L45A 3VW7A 4KTDL 2PO6D 2G5UA 1M05A 1YLBB 2NY6C 5AZUA 3FT0A 1P4BL 5CD3A 1GA2A 2FJFA 5ITBH 4OLWH 5EU6D 4LESA 3HVDA 1OTTC 1P5VA 2F0CA 4G9DA 4M5YL 1UM6H 3AU0A 3RLSA 2NX5D 3UPRA 4GMSH 1ZLVK 1SLUA 1X5KA 5ISZE 4MMZC 4X4YA 5IWLC 2YD2A 3UBFA 3KVQA 4ODBD 5D55A 2NLJB 1G7JB 2W65A 4FQJL 4JEGB 3D8MA 4IU3B 4ODSL 1F2XK 5F7NC 1AR1D 1JUFB 2MKWA 4FI7A 4V1DA 2VC2B 3MJ7B 3RVWD 5BZDA 1DBKH 5I66A 3IRPX 1YMMB 1XB8A 2O5ZL 3MA9L 3WO4C 1KXHA 2OSLB 1AZZC 1TMCB 3HFFA 1LK2A 4GOSA 5D5ME 2XYBA 1RUMH 3NZHH 4DZ8A 2WIIA 3UBXB 1N18A 3G9AB 1MCCA 4FN0A 3TJPA 2YDOA 1HWGB 3I2CL 1P8UA 3O8XD 3PHOA 4LB8A 5DU7A 3TC9A 1GZQB 3WNMA 1RHFA 5SWZB 3LEVH 2Q1EA 3A24A 5AAMC 1P84K 4CADA 3V4VB 2IXQB 4PTTA 4FDWA 4JM2F 1AC6A 2F5AL 2K8QA 4GW5B 3C6LB 2P8MA 1XGZA 2IPTH 3PHAA 4YHZL 4TF4A 4CN1A 5EUOF 3CFNA 5C0BE 4LSTL 2VLRB 3HPJA 1TO5A 3QRLA 1JPST 4GI9A 4J4PD 2J12B 3FUMA 5F0LB 2UZIL 5ALBH 3X12B 4IHOB 1U3HD 2F7QA 5AWNH 1INEH 3V0JA 2NYYD 4ANWA 1L5GB 1CTOA 1EVUA 5D2LF 3ZDXE 2YD8A 3QORB 3P1VA 4XGZA 3G08A 5TE4L 2XIDA 4JE4B 2D7NA 2X4UA 1S7WB 3QFGA 1C1EH 2ZXCA 4F9LC 5HVWA 1UCBH 5FYJE 2Z4QA 3ELAT 4I13B 2D7PA 4JJHA 4Y5XA 1GYWA 3MPCA 1FG2A 4OF0A 2X10A 2AABL 1TUPA 3DV4B 4NCDA 4ZFFB 4BSWB 4WI2A 3ZR6A 2OX5A 1Z3RA 2F74B 2P5ED 5DVKA 5E6IB 2JJSC 4QI1A 4UTBL 3E6FA 3E38A 5KVEL 1TJGL 1O75A 1EDQA 3FUFA 4I77L 4BFNA 2YWZA 1U91B 4HQQH 4AGQA 1GZHA 1XIWD 2CO4A 4F9PA 3HI5H 5J6HA 2DZEA 3RX8A 3HI1A 3CZKA 4GH7B 4DKDC 7CGTA 3P3YA 2BVQA 1D5MB 1RIVL 5HHOA 2F61A 5LXGH 1IXFA 2DQUH 4JB9L 2VW4A 5AAWA 2BVUA 5JW4N 3RY6C 3AZUA 3B3IA 2BO0A 1EJ6A 1UXWA 3FFCA 4A66A 4AYFB 3CVHB 4C83A 2YD4A 2CCWA 5G55A 5EF1A 4R84A 1S8JA 1RUAL 2XY2A 2QPEB 1TEGA 5TK4A 1BF2A 4NXKA 3SYPA 2X1PA 2X9WA 3PJSB 5AOIA 4FCAA 4QHNB 1ZLEA 2FWOB 3UL4A 2E86A 3NIGF 4PRBA 1M6UA 5EEVA 1OCOB 4PV8A 4NJAH 3RX7A 4ZMPA 3QEQD 4RESB 1EFXB 5JJNA 1X0K1 4BEYA 4Y2DC 4XXCA 4P2RD 4IK7A 5FUCE 3ARVA 3D3VB 1E2VA 5EPMA 5IV2A 2XA3A 3BGFB 2G3XA 3D25B 3V55A 5CFHA 5J1SC 1NCCL 4JFDA 3KGTA 3T0VA 3P3SA 1I1RA 3MACH 3J2PA 4ERSH 1HN1A 5I16B 1A4BA 5FECA 4B5EA 4GUPA 3DTDA 3LEYL 2WBJD 4H8PA 4RGMB 3EYQC 3C5ZC 4YMPA 5L2JA 1KDIA 1YEJL 1TVDA 1YEHL 4M5TA 4OF3A 1BVNT 3MRLA 5DJYB 5T3XH 3T0EB 2UZPA 3BSGA 5HHPA 1ZGLP 1J9RA 4YDIL 1X0I1 3PPEA 3KW8A 4JREB 2PP8A 2LLLA 2J88L 2YD9A 4PJ5B 2YSSB 4W4OA 1CF1A 4J3OF 3V5HB 4OKDA 4O02H 4DQOH 4S1QL 2MCPH 2VH5H 1J0YA 1ZWIA 5A2CA 5FM5O 3VE0A 3UAJD 1ROCA 2WXRA 3QUXB 2J20A 3VWKC 2J8UE 5TE7L 2VZSA 3D2TA 1AHWA 1F11B 1KPVB 5IFJA 1V7ML 4P05A 4NHCH 2A4CA 1E5UI 5DSCB 1DQQB 5B3NA 2UWEE 4TUOA 5ADPL 1C5CL 4YBLC 1GZPB 1SOXA 1YYCA 2DQJH 2YN5A 4JLRB 4LSDA 3BPNB 4ADJA 5GGRY 4OLXL 3JZYA 1BF8A 2H47C 3RVXD 5D4QA 3GMQB 1KT2B 2A99A 3BVVA 5FA3B 3TWYA 1YEFL 2JJUA 3QDAA 2EUWA 2C3GA 2DD8L 2H2SC 2HH0L 4MNHB 4CDGC 4H1LH 3LMJH 2BJML 1YNLH 5C3TA 4XXDB 4JFXB 5AOMA 2FEEI 3IFNH 1AO7A 5BVPH 3OAUL 1OE1A 3FO2B 3EJJX 1FO0L 1MCPH 3CXHJ 4HPOH 3KBPA 1BAFH 4XAKD 1FZJB 3I75B 3FT9A 3BN3B 4B3EA 3NFPA 2Q7YB 1XF3B 4HHAA 4NNXA 2FRGP 3NEXA 4KOCA 5PCYA 1SBSH 3GUTA 1B0GA 4AC2A 5DUBB 2NNCA 2P5WD 3FW6A 3MV7D 3QUGA 2ZXDA 2G87A 3FS9A 3HAOA 3VDBA 1I1AA 1NIEA 1EO7A 4EZKA 2JIXD 1K5NA 4H1LG 2B1HL 1YYMH 3QQDA 4FL4C 4HKJA 4P04A 3WTSA 1J86A 2XVGA 4RWYH 3BRGC 1NSNH 1NGXB 1GSKA 3TVMD 1OB1B 4YK4C 4QRRD 3T4AB 5GIRA 1IEBB 1G4RA 3MA7A 4K3JH 4RFEA 5CSGA 3E0GA 4CSZA 1J5OL 2YUVA 3DGDA 3QULB 1RUKH 1MCOL 4HXBL 5D1QA 1IAOA 4ZXBB 4DO5A 2WJKA 1ETB1 3BUYA 4JG9A 3CU7A 1X7QA 5AVSB 3BQUB 3RFRA 3BIKB 43C9B 4L2YA 1TO4A 5IB2B 3B2DC 2HG0A 2KHAA 1MCRA 3FH7A 15C8H 3UTZB 4ZMXA 1DLFH 4Y5YC 1YNTF 5TGZA 3PAVA 3UBXA 1J0ZA 1DQJA 2FNBA 2YD0A 3F58L 3QNYB 5DR5H 4ZSOA 5I17B 2BPBA 3V7MA 3O11B 1JWUA 4M9OA 4Y4FC 3NIFE 3WLBA 3H54A 3RVTD 3B7SA 3HE6D 3P2TA 4LCYB 5CJ5A 3NBNA 3V79C 4TVPL 4XCYB 1JZ6A 4I3RH 4PWHA 1YPZB 1WO2A 4W4NA 3DVIA 1QABA 4DOHE 2ERJC 5ERWB 4GRLC 3IJ9A 4PRAB 3AS0A 3BGAA 1QOKA 1I85A 1FFNA 2P1YA 2JI3A 4JQVC 3OKDA 4H26B 1AGCA 5EU7E 5IJVB 3LYRA 4DW2L 3D0LA 4K7PH 2H1XA 1MPAH 2VE6A 2WLKA 3N50A 3M7FB 4NLAA 4PGEA 2Q8BL 1JVOA 3MBXH 1VB9A 3R18A 4JPQA 3VXPA 2EYTB 4TQHA 3D52A 3KXFB 5HDRA 2UXTA 3LH2L 5IF0A 1TNMA 1Z7JA 4PY8J 5GHWL 2AQPA 2MJWA 4TLTA 1G1KA 2UY7B 2XQBH 4K73A 4PJIB 3CVBA 4N8VB 4P0DA 1N6UA 4LSVL 3MRDB 3NGBB 1EANA 1IEAB 1A47A 4KH2A 4L9LA 4OJEH 2NNRA 5ESVB 1DBJH 2ZXBA 3EBAA 5DURD 1QSEB 4MA1B 1TR7A 1GS8A 4A6YH 4OJFH 4FI8A 4E0RA 1RKRA 5D1XC 1W8NA 4N2GA 4LIQL 4UV7H 3ZMRA 3ZZ1A 3QDJB 1EA9C 1UC6A 4OD3L 1ZT1B 4V1DD 1CR9L 4UQCA 1D5XA 1VZGA 3F7PC 5F7LB 1QZNA 4N0YH 4DCQB 3GIZH 1IFGA 3IE9A 2X3CA 5GS0D 4O02A 4NBXB 3FU7A 2CUIA 5B39B 5BUAA 4FQHA 4NKOB 1A4AA 5C0AD 3U7WH 1UZ6F 4EIBA 3FQWA 3AG3B 2VLKB 4NOFA 1DJXA 2NR6D 4UQ2A 2VXSH 3EUDA 3OMNB 1JGUL 4OUUB 4XBPA 3GWJA 4DN3L 2NZ9C 1JRHL 4FQQB 3X1FA 1C5DA 2FWUA 3PP3K 1T2XA 5IQ9A 1FVDA 3H85A 2FUQA 4JO2L 3SO5A 3CX5J 2X28A 4LAJH 4WUUD 5KANG 1IGCL 4ZS6C 1M7IA 1ZVHA 2C9PA 1BZEA 4MMYA 3TBVB 2H3NA 3B43A 3GPEA 5TPWL 1IGTA 1OTSD 1ZT7B 2CNYA 3M46A 4QIRA 2GJ6A 4CDHA 4HWLA 1E9QA 2TRYA 3AY4A 3IFOA 3K91A 3B7TA 4HF5H 1JI1A 2X1OA 4JMNA 1HHIA 4WUKH 4H1LA 2WYIA 2X4NB 3PGDB 4W9KC 1ORSA 5IM7B 4PRIE 3S36H 4RMRA 1W72B 5DJXB 2QR0B 1CLOL 4V2BA 5F9JB 4HV8A 1OV8A 1GU8A 2FWSA 2BOCB 2IOOA 5J06A 3IF1A 3R06A 4Q97A 1RMFL 3C09C 5KYUA 4DJHA 1ED3B 1U0QA 1HESA 3ZKMD 3RTQD 2G9HB 4OCWL 5AKVA 2DJSA 2EEFA 2JKLA 1HEZB 1FL3A 4U6HB 1GPOL 4YDKL 2R2CA 4AG4H 1FFRA 4F7CB 1KIUB 1W2KT 5JXAH 2EE0A 3IS1X 4PRNA 1T1XA 3ERXA 2DKSA 3OWRA 5B1JA 1ETZB 4QRYA 5DRZB 4OT1H 3TLRA 1USZA 1MJJA 3V2AR 4NO3A 2FLRT 3C2AH 1NFDA 5JHDB 5CZKA 3QZWB 2OI9B 1OP5K 5EUOE 5E8PB 4XPTL 2Q76A 1TSHA 4BE6A 1LE5A 3TT3L 5C0CA 4AM0A 2ARJQ 2JQMA 1YUKB 3QUZA 3U0TB 3N2JA 3VDAA 3WEMA 4QXUL 5I5IA 5H2NA 1OM3H 3ESNA 2ZCZA 2W07B 4X5LA 3CCHA 2EO9A 4WWKD 3N5AA 5D2LE 4AZUA 2IV9A 1AZBA 1P4LA 2DQ6A 3ARDC 3D39E 5IW1B 1Z9SA 1MLCB 3PL6B 3CSPA 3GMRB 1FQ9C 4KDTA 5FYJD 4XXWC 3N41F 5GRUH 2JKTM 4GQZA 1QWUA 1WFUA 2GTZA 4LLVA 3U9UB 2HFEB 1IL1B 1NCBH 3I9AA 5AVWB 1BJ1H 3GSXA 3NRPA 1OE2A 5K9KB 2AQTA 4IM8A 4YHYB 1MWOA 1Q0YL 4W9EC 4UQ3A 4ZO7A 4PTUA 1OF2B 1F00I 3GXNA 3V6FB 1YNKL 4NQSA 1T3FB 1FFPA 4JZNB 5EBLB 4M4RB 4HLEA 3AG1B 3ZZQA 1F02I 3HPLA 3RZCC 4U3CA 3UYOD 1UJ3A 2OXGA 2WBWB 5ITBL 4OLWL 3QDMA 4MD1A 1JK9B 3VTTA 3G5YB 1UM6L 4DGIL 2XKSA 3WSQH 4KQ3H 1AMYA 1YA5A 1DFXA 3WEXA 1NAMH 3TTSA 3V4UL 4LDLA 3V9FA 4FA6A 5C0JB 5L4MA 1VFAB 4DERA 2X0VA 2E7CA 2CDGA 5GJSH 1JWSA 1SJEA 2WZ6A 2DEWX 2AV7B 3L3JB 3ZQXA 3OKMB 4MXQD 3II1A 4LLQB 2BSTA 5TH2A 3BFOA 3SKUD 2M1KA 3D85A 4YIQB 1RPKA 3FT2A 1V3JA 5FO8B 1DBKL 4MMZA 3NIGE 2VDRH 3NJXA 5DGRA 5DTFB 3SOTA 3O45B 4N0UE 1EPFA 1R47A 3M1CA 5SX5H 5HBBA 3QHTC 3KGUA 1X5XA 3H1ZA 1KJVB 3GS4A 5G36A 3SE6A 1HH6B 2ZFEA 1RUML 3MRBB 3NZHL 4HS6B 4OF7A 5JA9A 1PW3A 4Q58C 1TQVA 4R97B 1HHKA 3FQ2A 3NEOA 5HGAA 1RPUA 4BH7A 4BVNA 4L9DA 3OMIB 4IEFA 3LEVL 4YXLH 5E08H 2ZONA 3KR3H 3C87A 5DXWA 5FLVA 4JFWA 4MNGA 4WWOA 3I6GB 1U6AH 3SE4C 2Y7NA 2XG5A 2DQIH 2LOEA 2WC7A 4DUVA 5GGRA 4G8GE 1EMTL 5FYLE 4GW1A 2G9KA 2KSYA 2GIYA 5AAMA 5JIQA 5JR1H 3G6JB 4F8NA 5ALBL 1L9OA 4QOKE 3MFGB 2YHGA 5AD0B 1I7ZB 1ZIAA 4G6KH 2QMKA 5AWNL 1CYWA 3BP7A 1INEL 3V6OC 1I1AD 1JZEA 2EC8A 4PLOB 3QAZB 2E46A 3TJEH 4GBXB 2EXWC 3CFBA 3TBTA 3VFTB 5K5YA 1I8AA 4CC1A 4PJDA 1WBYA 1UCBL 3U2IA 2V17H 4KJYA 5FF6A 4OR1A 1INDH 1UJTA 1KJ2H 3H2WA 3HZYB 5AALA 5ES4B 4FXTA 4AMKL 3B2UC 5DC9B 4TVUA 4JG0H 4F9LA 3BVUA 4I18B 4ZX5A 3WDIA 1AC0A 3S88H 3EYVA 1S9VA 4Z3JA 5BQ7A 4YR6B 3EBHA 1CE1H 4AH2B 4ZMAT 3QBKA 1TPXB 4RSYA 3FPYA 4HQQL 4FQLH 4MDRA 1XWVA 2O61B 2D7QA 1CDGA 2JJSA 3PWVA 2E9JA 3L3DB 3VM7A 1JYVA 2Q7NA 3QXDA 4AXWB 5LXGL 2DQUL 4FJ6A 5GS2H 2BFGA 4JFOB 1L9SA 2VL5B 2IDCA 4FP8H 2JCWA 3R4RA 4D0DB 2CLZA 3SDCC 2AI0H 5I76B 3MU3A 4G82A 4YDZA 3RWGB 4N4YB 3MCYA 1O5PA 1MFCL 1ZEAH 1L9HA 4GP8B 4NKMA 5ICYA 4BKLB 1KGXA 1VHPA 1W91A 2WUBH 3QIBD 5A2KH 5MERA 2E56A 4UILH 3L3HA 3RY6A 6PAZA 4TQPA 1FNGA 4PS8A 3UMNA 5ITFA 5JXEC 4MQXC 4NJAL 4CKVX 4M6AA 1PG7X 1DVXA 2DWXA 3ZE2E 4Q89A 6TAAA 2F2HA 2DL9A 4NAMA 4OJAA 5CF3A 1CICB 4KKBC 1YN6B 3S5LG 5K1NA 2V8LA 4QRUB 1EHNA 5K9QI 5EULV 4ERSL 4Y2DA 1MVYA 3HS0B 2O6DA 4IIZA 1JCKA 4U1MB 1I9JH 5EU4A 2AANA 1LEGB 3QWRA 4GMTH 1Z5LB 1ZE3C 2MQ0A 3DMMB 4WJ5A 2ODHA 3VFWA 1A64A 5T3XL 1DTUA 4X5XB 1VZHA 2C8NA 2A73A 3EO1A 3C9LA 4YSTA 2H0FA 1A9VA 5E1AB 3C5ZA 3Q8FA 4O02L 2OP4H 4DVBA 2A7BA 2ATKB 2MCPL 2VH5L 3SDXF 1AGFA 4O2EB 1V7NH 2CRMA 2P8PA 1O9ZA 3HRZC 1DBAH 2IVFC 3O3DB 4YDMA 5K93A 1XGUB 1TTGA 4CUCA 3IMUA 2ZG2A 1AIFA 1SDYA 2DQEH 3N0AA 4R4FH 3PWNA 3J27A 4IIQB 5I1JH 4X6CF 1FJ1A 1NAMA 4NQCA 1RZIB 5I5RA 1X6LA 2K7PA 3VWKA 2DQJL 2IDFA 3WE1A 4L5FH 4AJ0A 2PPEA 3KPRB 4LAQH 8PAZA 3KPMB 1JVLA 5DZNA 4JKWA 3N1QC 1SGKA 3G04B 1IAKB 4AQAA 5BO0D 4Y8DC 1T21B 3RGVB 3O6LH 3CSFA 1MVUB 5CJQH 1WD8A 5CJXC 5C86A 1FVEA 1OSZA 4IOFD 2A38A 4XT1C 1YNLL 3X11B 3S9DB 3POHA 4HD5A 4LCWB 4OLZH 3WKPA 1P7KA 3IFNL 3FO9B 5BVPL 3FN9A 4GAFB 2ZCLH 4FAAB 1MCPL 4HPOL 4WZ9A 1BAFL 4D94A 1R3HA 3KBHE 1QFPA 4BKTC 3B5HA 5IQ7H 3SPGA 2ZCKH 1SBSL 1KJMA 4Z3EA 2QQQA 4HUVA 4XBMA 4QY8B 4XP1H 1SBBA 4BFGA 2IH9A 3QS3A 3LN9A 1JZ5A 2OL3H 2WGXA 3HOGA 4FLSA 2PWEA 2WY3B 1WZMA 2PO6B 2H0PA 4ODUB 4AI7A 1KIRB 1YYML 4WW2F 4UWQB 1NSNL 3NAAH 4PPTA 5EU6B 4Y4HC 5I28A 3MNVA 4UUJB 3RWEA 3PLYA 4K3JL 1CMOA 2NX5B 1UZ6E 1WCQA 4BIKA 4IMKC 3DX8A 2NTWA 4L3FA 4PI2A 1RUKL 4LLUA 1D6EA 2V9UA 4RZCB 2QVTA 3HAPA 4GG6F 2KQMA 1AR1B 2B2XL 3KJ6H 3CFDB 2PUQT 1MRCL 5F97E 4BUQA 2GK0A 4KKAD 3CHRA 4IKKA 3QI9C 2H8PA 1QWNA 3BISA 1DLFL 3GBNH 4HWZB 4QCIA 4K9EC 5DJCB 3SGJA 4XCFH 5J1AA 1M71B 1AJ7H 1KJ2A 3HEIB 3H2PA 5DR5L 3SKOA 5BRZA 4PVLA 3F5WB 1PD6A 3P0GA 2NSXA 4KDWA 2J1ZA 5BV7C 1RFDH 1EDHA 3O8XB 3QUZD 3IJSB 3N43F 4ZUSA 2Y0SA 3X3FH 1JGIA 2Y72A 2IFFH 3MRQA 4I3RL 5DK0B 4ZUWB 3UXFA 2NY0C 4NYLB 4Y4FA 2CXGA 2YBGA 4LGRB 5CLXA 4APXA 3AXLA 4GKZA 3A4EA 3PNRB 2BP8B 5C0FB 4XC3H 3K6SA 1ZVSB 2Z7UA 3P9WB 1LTXA 5I26A 3RWHA 3NPZB 5I1IH 3SQOH 2WXQA 4R96A 2VN4A 4P5RA 4B9IA 4E9LA 5DYSA 5F7BA 5F9WC 3U1PA 3TWCH 1KGYE 2NY3D 3A23A 3EZJB 1LL1A 1MPAL 1R17A 2G2NA 2Z1KA 3QFDA 1DLHB 4GRLA 4HX1B 3ZOAA 2FX9H 3MBXL 3S5LA 1U3HB 3OPZL 1UWFA 5MEPA 3O6KL 1N12A 2XYCA 4B9FA 4ZX6A 3F7LA 2UZYB 1RK7A 1T80A 4L1HA 5FM4A 4L4VA 3CDGA 1WEJH 5I1LB 2OMYB 5JHAA 1WG3A 5T3ZH 2XQBL 4M93C 5EORL 2NXYC 5FGRA 3MCG1 4U05A 4AX3A 4JKMA 4DQAA 3GSNL 5IQLA 4PN6A 2XG4B 2QVKA 4AGMA 1DBJL 2AJZB 1NWPA 4JHUA 5EF0A 1H15A 1CT8B 1QAWA 2P5EB 4OJFL 5IVZB 4KXZH 5DMKB 2YAHA 1LVEA 1EVTC 1FAIL 5GS3A 1F4ZA 4UV7L 2V7HA 4Z6AT 4BXSV 2YA1A 4RIRA 3D85D 1XIWB 4CVXA 3BEWA 4XPGH 2UVEA 4JE0A 5D1XA 1XF5B 1JZJA 3TYFB 5JW3H 1CFMA 4N0YL 1D5BA 3AS2A 1UH4A 3GIZL 3BVNA 3VU1A 2VT4A 3HAQA 4XHJD 1KPRA 1X3DA 2EEBA 4YSDA 4G2AA 4R2GC 1KLUB 3WS3B 3LD8C 3DRQB 1L9MA 3IETA 1BRRA 3EO0A 2VXSL 3D48R 1V3LA 2A6JA 2E27H 2G5BA 4MAZA 4YSAA 2RACA 2L7EA 4MCNA 4W9JC 3U7AA 3VXNA 4QXTB 1SHXA 2EIEA 3NCMA 4QHLB 4NC1C 1A6WL 2FUTA 4NWTH 4X4ZA 4ZFZB 4Z7UA 4JZJB 2J56A 3VUAA 4R7NA 4I3SH 2WLZA 3HJEA 3VJ6A 3QEQB 1PKOA 1E4XI 4XOEA 1X44A 4HBQA 3GSUA 1MXDA 2CLRA 3ILPB 4P2RB 1K4CA 1UXMA 3NN8B 2VJXA 1S7XA 4Y19E 3T4YA 4HF5L 2A74C 5AHYA 2QHRH 2R27A 3NUKA 3TBYB 4WUKL 3UJJH 3ZE0F 3QZPA 4YJZL 3D1MC 5TGBB 4JUTA 4ORZC 1D9KC 5FDWB 3S36L 4KVCH 3GQFA 3S2AA 3ULVL 3RI5K 5F7YC 2RB8A