4FA7B

Structure of recombinant cytochrome ba3 oxidase mutant a204f from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 49
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4fa7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4fa7B02
4CSZA 5BR2A 3GDCA 1XIOA 3ABMB 1ZIAA 4YSOA 4UAHA 3NSFA 2UX7A 1AS7A 1IBZA 5D4IA 1X0I1 2XU9A 4HCIA 1R84A 4ENZA 1GS6X 4M3HA 4YSQA 1KMEA 3NY8A 2AZUA 3QAKA 5IY5B 3UAAA 1FBBA 3WKPA 5G53A 1TN0A 2EIKB 4XTNA 3X1GA 1P8HA 1O0AA 3PWHA 4MD1A 4QI1A 1GU8A 5AX1A 4XTOA 3OD3A 1RZQA 1OE1A 1SF3A 2OJ1A 3H4FA 1IXFA 4PXKA 1BQ5A 4QIDA 1KG8A 1SHXA 1A4CA 3FPYA 4YSSA 5AHZA 5LWEA 3UABA 1XB8A 2PPDA 2BWIA 2X87A 2X88A 4BEZA 4GPOA 1DZ0A 3BVDB 1P8IA 4AKQA 3AYMA 4KO5A 3OE9A 4YVUA 3NP4A 3BQVA 3D4SA 1JVOA 4DP5X 5D4HA 2WO2B 3OMAB 2FT8A 1AP9A 1SDDA 2PPFA 4A2EA 4PAZA 5TK4A 1SHWA 1BEXA 4AMIA 3S8GB 1JVLA 3OMNB 3AZUA 1S8LA 3T45A 4Y9HA 5B6VA 3DDLA 3CDZB 3FU8A 3U25A 1R2NA 2R4RA 3ABKB 2AT9A 3HARA 4WKXA 4KLYA 1RCYA 1S52A 2IH9A 2R4SA 2VW4A 5EHFA 4HCFA 4YSEA 2VM3A 4WTQA 3EH4B 3CVDA 1NIFA 2YARA 3FS9A 1QHJA 2DV6A 2HZHA 1WS7A 2HX8A 2Y1AA 3SN6R 4AX3A 1CC3A 5ETZA 4F2FA 1NIAA 4BK5C 2BP0B 2PCFA 2FQDA 1IBYA 1F56A 5AFAA 2PP9A 1AS8A 1NIBA 3PLYA 1OCRB 2H47C 2ZWNA 4G71B 2JFCA 4A67A 2ZOOA 3QBLA 3HAQA 4GP8B 2X72A 2RACA 3OE6A 5JJJA 3T71A 1GZMA 4NERA 5H2NA 2XVBA 4N8UA 5FC9A 2YXWA 1A4BA 2VM4A 4G7QB 4GBRA 5B2NA 1BXUA 1TKWA 2DYRB 3KJ6A 4BXSV 4CSPA 4RH4A 1W8EA 4EJ4A 3NSYA 5AHYA 2FJSA 4KNFA 1J5CA 2FT6A 1GR7A 5B3SB 1BM1A 1X0SA 1XB6A 3IE9A 4NAJA 2PPAA 3SBQA 4BUOA 4YSUA 3TBCA 4J4QA 3NSDA 1QM8A 5B6ZA 4A4MA 1S54A 1GS7A 4LDOA 4GY4A 3WI9A 5I28A 3UTXA 1NPNA 3QJTB 2J55A 2XLLA 3CVBA 1SNRA 4HHWA 3REYA 3VHZA 4GRVA 1ILSA 1XMEB 3MX0B 2H5UA 2JAGA 1NPJA 2AANA 1AACA 1OE3A 1T5KA 3CDZA 5B6WA 2VT4A 2QT6A 4G70B 1JZHA 1HZXA 3NYKA 3QBIA 4XTLA 1AG6A 6PAZA 2WJLA 2ZFEA 4XXJA 1AZBA 2PLTA 3X1FA 3PBLA 5G2DA 4GYBA 2NTUA 1NDTA 2H3XC 3T6WA 1PNDA 1AZNA 1SFDA 1BYPA 4E9SA 3PAZA 4HCGA 3QQXA 1E67A 2HRHA 1JXDA 2Q5BA 1J9SA 3EF4A 4A2FA 1KBVA 3QDCA 3ZDWA 1L9HA 1AIZA 2Y02A 2FQGA 3JTBA 1ZDSA 1J9TA 4Q8BA 2BP0A 2YDVA 1GYCA 2JKWA 2OV0A 1L9SA 2BZ7A 2UXVA 4P5RA 1WA1X 3WIAA 4DP9X 2BHFA 1OCZB 1JGJA 3RZEA 3WQJA 3X1EA 1RKRA 3PQRA 1V54B 2B08A 3FSAA 5ITEA 2CUAA 1WS8A 1AZRA 3DKHA 3ZPRA 3FYIB 3GXUB 1ET7A 2KSAA 3H4HA 5LDUA 4GYCA 4HWLA 4GXFA 3EH3B 3FQ2A 1JV7A 2J4YA 2N0MA 5B1BB 2EINB 3ASOB 2CALA 1C8SA 4WW3A 4YSTA 1RZPA 2YDOA 2KSBA 5I6NA 2CBPA 4XT3A 2I20A 4KO6A 5DYSA 3V2WA 5G2CA 3NJLA 5H2MA 1UCQA 2I7SA 5A8EA 2IDUA 3TASA 4A66A 2J5WA 2YCXA 3FSWA 1CUOA 8PAZA 2BO0A 4PXFA 4DP2X 1JERA 3FQYA 1OOWA 1JOIA 1TU2A 1X9UA 3NJMA 2QPDB 1L9OA 5DHGA 2CJ3A 3SQRA 4AKPA 1TN5A 2FT7A 4NC3A 1PZAA 2WO3B 3AG2B 3ABWA 2TSAA 4ZK8A 1QLEB 1PXSA 5I26A 2PCYA 3OAXA 2HRGA 4A68A 3X2QB 4MFHA 1MG2C 1WA0X 3S3DB 3HAOA 1E5ZA 3P0GA 2IWEA 1PAZA 2Q9OA 2HXAA 2IAAC 2Y04A 4L6RA 4K9JA 2YAOA 4KNTA 5EN0A 5E9NA 1PY0A 5G36A 1CYWA 4E9VA 1PZCA 2A3TA 2ZIYA 1YLBB 4DJHA 2XV0A 1NIEA 2TSBA 4KNUA 1KBWA 5B1KA 3ASNB 1AT9A 2DWTA 3MBWB 5A45A 1JXGA 1GUEA 4L35A 5B35A 1JFPA 4MD2A 1J9QA 3OE8A 1A65A 3UAEA 1JZJA 3AM6A 1SF5A 4E9TA 1HAUA 5FJGA 1VGOA 1OV8A 1PY6A 5AZDA 1BRXA 4LDEA 2FNWA 5H2HA 1VLXA 3HEIB 1KCBA 5B7EA 2WSDA 3EHBB 4BWBA 2FTAA 2G87A 4AZUA 4DP0X 1M57B 3FU9A 2LLNA 2CAKA 1HAWA 3VVKA 2WJKA 1GS8A 4XT1A 4BWWA 1UAZA 2KS9A 3HASA 3X3BA 1FFTB 3AG1B 5B7FA 5B34A 3T6XA 4A2GA 1IKOP 3H56A 3NJIA 2BW4A 3QAPA 2Y69B 1M0LA 4K5YA 3FYEB 4G7SB 4Q89A 3IN0A 3UG9A 2Y03A 1M9WA 4DKLA 2BP8B 2UX6A 3QJSB 2IWKA 2VN3A 2PEDA 2XWZA 4HAKA 1PNCA 4QKTA 5ANHA 5PCYA 1L9PA 1VJMA 3OE0A 4YSCA 5G28A 3QBGA 4X31A 5H2PA 1AANA 4NB7A 3L45A 2IDSA 5AKRA 1H2SA 4KNSA 1E0PA 5I5MA 2YCYA 1OF0A 2XXFA 3RYMA 4PCYA 1ASOA 3EMLA 3TBBA 4EIYA 3QPKA 1A3ZA 1PLAA 5I5IA 4YSDA 1OE2A 5J7AA 9PCYA 5AWZA 4BWUA 4BXVA 1BAWA 4MQSA 3TU6A 1AZCA 4N4YB 1LN6A 2ZZLA 2R7EA 2PP8A 1X9RA 1E5YA 2XV3A 3UADA 1L0MA 5BR5A 3PCYA 5G54A 2PPCA 4IAQA 2DWSA 1KGBA 2XUWA 2P80A 3C9MA 4YVNA 1BRDA 3NY9A 3QJQB 4BV0A 2I7OA 4DP6X 3ABGA 2QDVA 2IH8A 3ODUA 4BDVA 2BW5A 1KDJA 4OV0A 3S3CB 3X1NA 4KO9A 4KOCA 4YL4A 2F95A 2IDQA 3PXOA 4DP4X 1ADWA 3RFMA 4HZ1A 4FA7B 3NYAA 3QJVB 1F88A 1I53A 1TEGA 4W9ZA 1L9TA 1IC0A 1XB3A 4FAAB 1MG3C 4FPDA 2AFNA 2W88A 1PLBA 3DQBA 4X32A 1MDAA 3FT0A 4HIPA 2Z55A 1M0KA 2AVFA 2J57A 1Q5IA 4DP7X 1EHKB 1JZEA 2XX0A 1JZFA 5JJNA 3OMIB 3NJFA 4M4RB 4X1HA 3WNJA 5I6OA 4E9RA 1R1CA 1SJMA 3ZBMA 1M56B 1NTDA 1QHQA 3NP3A 1EZLA 2HX9A 5B6XA 2XYBA 4AKOA 5I6LA 4KOBA 1E30A 5G2AA 2OCCB 2BP8A 3UACA 2QPEB 1QKPA 2B3IA 1ASQA 1ZPUA 3PXLA 1ETJA 5I6MA 1FWXA 2FWLB 1U19A 1BQKA 3AW5A 3AG4B 5H2KA 2M3GA 1AS6A 5ITCA 1J9RA 1NINA 1IW9A 3NJKA 4BWTA 7PCYA 4F2EA 3CG8A 3IN2A 4YSRA 1NZRA 5H2IA 1CYXA 1L9RA 3FQ1A 3CODA 2DY2A 1AOZA 3ABLB 1A4AA 2FQEA 3GYRA 1CURA 1PXRA 4G72B 3VGAA 4QRYA 1ILUA 3FPXA 3WKQA 3HANA 1F50A 2I21A 3PDSA 1E12A 3NS0A 1NIDA 2I1XA 1JXFA 3QJRB 2UXGA 3NSBA 2GHZA 4JHUA 2MTAA 2YAEA 1BYOA 3ZEVA 2W8CA 2EI4A 2VSMB 2YCWA 4BEYA 3A7KA 2PP7A 3FSZA 1A8ZA 1ET5A 1S8JA 7PAZA 1NWOA 3OM3B 1J5DA 1MZYA 3X3CA 2DYSB 4X4KA 2R7EB 2YAFA 3FSVA 1C8RA 1S51A 2BRDA 5B1JA 4GP4B 1P8UA 1AZUA 2KSYA 2XX1A 3ZIYA 3FU7B 1ET8A 1V10A 3UTWA 4HHGA 1AR1B 4YSPA 3UTVA 3AY2A 2JXMA 2GIMA 1KDIA 4BDVB 3C9LA 4HYJA 2NRDA 5B1JC 2E86A 5C1MA 4UG2A 3IBOA 4N6HA 4DPBX 2VMJA 1ASPA 4IARA 4JR8A 1BQRA 2GSMB 2HLEB 2XXGA 3T6ZA 1KCWA 2YQBA 3NJJA 3KW8A 2XV2A 2UXFA 3OQRA 3ZX1A 2EIJB 5I6KA 1UATA 4UANA 4GP5B 1IW6A 2PPEA 2YAQA 4P5SA 3T6VA 5D4JA 3V9CA 1KV7A 3S8FB 5H2JA 1E65A 3G5WA 5B7MA 1NICA 4F7KA 2YXVA 1N70A 2HX7A 4DP1X 3PAVA 1H68A 1AG0A 1OCCB 1Q5JA 2EILB 4G7RB 6PCYA 3QBKA 3T9WA 2VSKB 1GY2A 5TK2A 3UZCA 1IUZA 2BZCA 1KYAA 1FBKA 1SFHA 1NWPA 4AMJA 1X0K1 2IWFA 2QDWA 3DIVA 5AX0A 3N55A 3PAUA 4EF3A 3MBVA 1WAEA 2YAHA 4FBZA 3N2JA 1OCOB 4JKNA 3X1BA 3TA4D 3CAPA 2GB2A 1GY1A 3PPSA 4QLWA 1ID2A 5H2LA 4MQTA 5DHHA 1WA2X 1AAJA 4A2HA 1MZZA 2FQFA 3IEAA 4MBSA 1W6WA 2Z73A 5I5JA 5I6PA 4E9XA 3NSCA 1CWQA 3VI0A 1GSKA 2P80D 2YAPA 4HYXA 1KGYE 3ERXA 1JZGA 1PZBA 3CVCA 3VW7A 1N68A 4HALA 3WG7B 3FU7A 5A44A 3SBPA 3QJUB 4DPCX 5H2OA 2CCWA 2EIMB 4TXVB 5B1AB 1PLCA 2UXTA 3SBRA 5F7AA 2J56A 3UONA 4WAVA 1F4ZA 1URIA 2JAFA 3DTUB 1V55B 2ZXWB 2Y01A 4DP8X 2VW6A 4UHRA 3NJGA 5PAZA 4E9QA 1DYZA 1BXVA 1HFUA 3V9EA 2NTWA 4LDLA 1DZEA 4E9WA 2GBAA 5F8UA 1AQ8A 1ZDQA 4L0PB 1FA4A 2YCZA 2BWDA 4IB4A 2GI0A 3VG9A 3UZAA 1PCSA 2RH1A 4JHVA 4JKVA 4KO7A 4YSAA 1ZIBA 1BXAA 5JJEA 2I85A 3WNIA 4E9YA 1QKOA 2HPYA 1W6LA 1BRRA 5AZUA 3AYNA 3EH5B 1JV6A 1MGYA 3COCA 1XJIA 1S53A 1JZIA 2MRYA 1QNIA 2YAMA 3C75A 2L6XA 1KG9A 1SDDB 1L9QA 1TEFA 4TL3A 4EA3A 5F7BA 4AI7A 3HAPA 4N4WA 2IDFA 3UTYA 2LNLA 3UGEA 2I35A 4DPAX 3S3BB 1GW0A 4BVNA 3AG3B 5KKHA 1PMYA 5TGZA 3HB3B 3JT2A 2AZAA 5A7EA 1ZV2A 4UF7C 1B3IA 2GC4C 3D12B 2Y00A 2F93A 4DAJA 3NJHA 1M0MA 3V2YA 4W1TA 2GC7C 3CZUB 3KW7A 4JQ6A 1C3WA 3NT0A 1PF3A 2IDTA 4A2DA 3ZPQA 2VW7A 5B6YA 3NJNA 5B0WA 2ZONA
chains in the Genus database with same CATH superfamily
4RWYH 5HDWA 5TF1L 3ARGB 3GDCA 4G9FA 5CO1A 2D7OA 2Z91A 4HLJA 2RAMA 2OR7A 5C0EA 5EBGA 1CZ8H 1MAKA 4GW5A 1X0I1 3VXMD 1PZ3A 5C0IB 5ACLA 4HK0B 3FCGA 4L3EB 4IGBB 1G84A 4N90E 4UQDA 3BN3B 1JRHH 1RUML 3FU5A 3O2DL 4IIZA 5DO2D 1BWWA 4XTOA 1F4WH 2BVOA 1MJUH 2D8KA 5EZIH 3U4BL 5I2IB 3Q5YA 4OD3H 1OGTA 4GIAA 4OJFL 3EKCA 5EMYA 3UABA 3I6KB 5CZVH 3M86A 2FBJL 3BLBA 3RAJL 1J1PH 2VDNL 3AYMA 2BPBA 3MJ8B 1MDTA 1SJHA 4Z76A 5MEPA 3S88H 2HVKB 4X2UA 5IVXA 1JVOA 3OKDA 4E36A 2ITDA 5CN3A 3T2OA 3QJFA 1L9NA 1KCRH 4P3WA 4PJDA 2K70A 5BRZE 4PJHB 3WJMA 2BCKA 4NRYA 2R4SA 1T3FB 2Y7OA 4F91B 3BZEA 2NY2C 3BAKA 3EJZD 2VM3A 1F6FB 3VAEA 3CVDA 1S7VB 4KVNL 3CBRA 3ZTDC 2D7QA 3TIEB 5CEXB 5J6GA 4K7FA 4MA7L 1WFJA 1WS7A 4LCYA 3SSGA 4IRSB 2B20A 1MIMH 2ZZUT 4CMHB 3VYPA 2B3RA 2QPSA 1YNKL 4BQ9A 1OP9A 5CINH 1F56A 1AQDA 5DJZA 2OL3L 4BZYA 5LWYL 1AS8A 4JO1L 1K5NB 4A67A 5IQ7L 2H6PB 2NTSP 3TIDA 1FNSL 4K3DL 5GQBA 1PYWB 2IV8A 1IC4H 2XVBA 1GMIA 3CCHA 2YXWA 3VFTB 1TFHA 3GMQA 3AWFA 1VGEH 5JQHC 1I3RA 1UZGA 2FJSA 1BVLA 2WUBH 3EYSH 1AMXA 4TMPA 1IC1A 1K6QH 3SJVA 4X4ZA 3EOBA 1BBDL 4JFDD 4GEJA 1ORQA 1J1OL 4U1JB 2MPAH 5B6ZA 2XN2A 3MREB 5J57B 2ADYA 2HFEB 3EG9B 4DGIL 3MGTB 3LIZH 1QNZL 1XMEB 1JUFB 1YN6A 2ADGB 2JAGA 4P9ML 2R29A 3UPRB 1BZ8A 1ETZA 3SYOA 3DJRA 1QFPA 1TOXA 4IJTA 1L6XA 2YD2A 4EUPH 3DIDA 1L7TL 5H94B 2ITFA 1AG6A 1YQVH 1GOHA 2APSA 2Y2YA 4ZMOA 2F7PA 2XXCB 3A6CL 2D4DA 1Q94B 1LO0H 3S37X 1FVEA 1HIML 2J6EH 2Q3AA 4DAGH 3QQXA 3PWPA 1V05A 3QYMA 2CK0H 3N43F 4U1HB 3QEHA 4TNFA 4OV6F 4MCYB 1ZT1A 1X6NA 4GUOA 3R19A 2YDVA 5D72L 1L9SA 4GLRH 5C0DA 1WRFA 3QQDA 3RZEA 2VLJE 5GGQH 1BP3B 3IXAA 3ZPRA 2DB8A 4FFTA 1PG7H 3KXFB 4JG0H 2OSLA 2X4NA 3LH2L 1MCHA 1X5HA 4EBQL 3EFDH 1J5HA 3ILPA 3MUZ1 5AAMA 5LJYH 1Q4NX 4YHIA 2F54D 4A7GF 4KO6A 3G5YB 2R4SL 3DDGA 4H88L 4YFEA 4LHJB 1AZVA 1E8XA 3RUGB 1UCQA 1R75A 2OZNA 2G3NA 4Z7UB 2OK0H 4Z0XB 3V4VH 3L9EA 1SMAA 2DDQL 3OB0H 3L3DB 1RSYA 3B43A 1CUOA 4QR7A 2PO6B 2EACA 3CVHA 3CDYA 5ITBH 3N06B 1FBIL 1THAA 3JSSA 3NAAL 4Z77B 3HFML 3FCSB 3FRPB 2YPLB 2C5DC 1JNJA 4JG1H 1KXTA 3HE6B 2NY2D 2XZCL 3MRHA 3ZE2B 2X70A 4N68A 3D05A 3OSVA 3PFQA 4PGBA 3UDWC 3ZTNH 3KWXA 4AEIH 5L6YH 2GQHA 5ISZD 2Q6WA 1M7DA 1PLGH 3Q5TA 1CFNA 1H6FA 2A6IB 1FC2D 2QVMA 5I1GL 2Z92B 1IE5A 5GS1A 1KBWA 1WP6A 3EH1A 3DYOA 3FAWA 3HN5A 3R7RA 3L1OH 4LOFA 4YE4L 4R26L 4KI5E 1B0RB 1ZE3H 4PJIF 1RHHA 4D0BB 3Q05A 2VIRB 1M7IA 4ODTL 1CXFA 2XIBA 1NSNL 4Y1TA 1IJ9A 1CDGA 5F88B 1I1YA 2Z93B 3MOAL 3NIFB 4F7EB 1KT2B 1O9WA 3VXSE 2LLNA 2F8VA 2WQUA 4NRZB 1GS8A 3BI9X 4HBCH 2EAEA 1W91A 4Z9KB 1KV3A 5J3HD 2XG4A 3SGEI 3TCLA 2LFEA 1NFAA 1Q0YH 4N2FA 5GJTL 3T0EA 4XP4H 5ID0B 1T89A 2XIDA 1M9WA 1DQVA 5F3HB 3PF2A 4NNYA 4QKTA 2F58L 2NSMA 2R4RH 3MRCA 3UZQA 5SWSA 2F61A 4G6JL 3VQLA 4MMXA 4FA8A 3OG4B 4D94A 3LRLA 3IJSA 4NQED 3WEBA 1KXHA 2I32A 3UTSD 1E0PA 4LKCB 2VXSL 4EI5B 2XXFA 4JCWA 4RGOH 1TPXC 4WGVB 1P6WA 4XP1H 1YUHB 1EAOA 4J3WA 4JO5A 5GRZA 1LMKA 5EORL 1PLAA 1OE2A 4BXVA 1TJXA 4YGVB 3FUEA 2QR0A 4ELME 5FO8B 4L8SB 1HEHC 2ZPKH 1D9KD 5F1OB 2WINB 2PF6A 1A22B 1SGKA 4U05A 4GSUA 1OP4A 5ESAB 1FUNA 1U91A 5CLYA 4U1MA 3LZFH 4KKNA 4M7ZB 5EO9A 3K8LA 1EXHA 4H7VA 2IH8A 1KEGL 2ED8A 3AXLA 5FYLH 1HI6A 2C4FU 1MJJA 2VLKA 2WW8A 4S0TD 3OKNB 1BZDA 5MEND 5FKPA 3RZCA 2IDQA 4EN3C 3K1KC 4WNQB 3RFMA 2D9CA 4NJAL 3RVWC 3ELAT 3JBG7 4H13C 2W88A 2AFNA 5JW3L 2B9BA 1K8DA 5L4FA 4CW1B 5FLVA 1M0KA 4KXBA 2XPZA 4AIOA 1Q5IA 1SN0A 3QO1A 1NKOA 3TS8A 2DQJH 3LEXB 4GG6F 1MELA 3INUH 2KLSA 5C08D 5EEWA 2FEJA 2HX9A 5K33A 1NCWH 2X4OB 2XYBA 5KSVB 3CSYA 5F7MC 4O02A 4PLKC 3KPRE 5DSCB 1F00I 3HKZA 1CT8B 3HE7A 4XP9H 1IC7L 1KTJA 2C7UA 3T3PE 3PJLA 1U19A 1H15A 1SMOA 3GM8A 4LSQL 3T0VA 3LPFA 4OLWL 3U9UB 3F7KA 5ITCA 4H0LC 4W9CC 5EBMA 5C07B 3SDAA 1WZLA 1M1XB 3B7YA 1K8IB 2ED9A 3QSKB 2YPKB 2E7LC 4EVNB 3WSQL 1L9RA 3SPHA 2H0FA 5CWSB 1MRDL 4OAWA 1KLGB 1T66D 1T0MB 3CZNA 5IMOA 3QRFM 2CMRL 5B39B 3OX8A 1YPZB 2CDGB 5SX4H 1A1OA 2WP3O 3SOTA 4NKMA 2HFGL 3BN9D 1WAAF 4Q58C 1J0YA 1L9MA 2IANE 1Z2KA 2JKJA 2W8CA 2ZOKA 5SX5K 5K59E 1L6PA 5DHYA 3T4YA 1S8JA 4HKJB 4R6UA 4R5TA 3FQTB 2AAVA 4Y4FC 1PD0A 5I6XC 2VR7A 5A2IH 2WBKA 3II2A 2KSYA 4JN1L 1A6VH 1C5CL 1V10A 2NMSA 3P1VA 1T21A 3ARDA 2QKIC 3EJRA 4TNEA 1Z9MA 1FIEA 3DRQA 1PZDA 3K46A 4NZRH 4Z7VF 1CTMA 4FKHA 4LNVA 1JZ8A 1NC2D 5GRYA 1QACA 1JD7A 2E86A 5C1MA 2ICEB 4JPIB 3PHQB 4M6MH 3PPEA 4HJUA 4NC1C 3V9FA 2ARWA 4B7IA 5C6PB 4MDJA 1S46A 2UWEB 1XL4A 1U92A 1DVQA 4WJ5A 5E2VL 3FB5A 2GSMB 3GSOA 3KGSA 4WKZB 5KBNC 4OBSA 3OAUL 1JPSL 3EFFA 4PG9A 1D5RA 4WUKL 2JIXB 2ZT9C 5BS0D 2IADA 4FNRA 1IW6A 3FAXA 4ZMPA 2FJGB 1FH5L 5H2JA 3BP4A 3X11B 3HHRB 3B2VH 2BOBB 1ZTXH 2OMUB 1WZ1H 3T1FB 1K4CB 4MJIA 5CUSL 3ILQC 1Q5JA 4KAQH 1AJ7L 1NDGB 3MLRH 3MRDB 5HYJD 4K23L 4FQ2L 2J8UE 4ZO6A 5ABDE 1E42A 5JPNA 1N5YL 1X0K1 3PAUA 3QUZC 3B4NA 2GCYB 3IWUA 5BCAA 1I8MA 5EOQL 1ZANH 5H2LA 5F96H 1DHKA 2ENSA 2ESVB 3IEAA 4UQCA 4LVNB 4D7BA 4EN3D 5KANI 4O02L 3RVWD 4L3EE 4AG4L 1T4KB 4A6YH 4W9LC 3MA9L 3H42L 5JXAH 3MLVH 4H8WC 1N68A 2B1HL 1OSEA 5E1IA 2Y7MA 3US9A 1KTLA 4KK5C 1IAOA 5DJCB 3BLPX 4JQIH 5IBLD 4TULH 3O8XC 2CBQA 3U9PH 5IOPB 3PL6C 4LLUA 3MCG1 3NJGA 3OHXA 3K4ZA 1JNLL 3QWQB 4R90H 2NTWA 5EF0A 4E5XB 4PLKD 2ZXCA 3V0IA 4FMKA 1BLNA 5LXGH 4NUPA 1DBBL 1QRNA 1CTNA 4QHUA 1FA4A 4UINH 3D08A 1CF8L 3RFZA 1CE6B 2Y23A 4U33A 1MVUA 4N9GB 4JKVA 4MNHA 4CN4A 2XXMB 4EIBA 5DUPL 1R3IL 2OFQA 3HI5L 3O6LL 1UZ8B 1JV6A 2D3VA 3OLGA 4Y2DC 3RWEA 5KSBF 1SQMA 1KENH 5LN4A 5D7LD 1YNLH 3Q2LA 4DGVL 5D1XA 3UYRH 3RLSA 3KPOB 2XN9E 1KJ2A 5DVPA 4LFHD 1MCEA 2J8OA 1TJHL 2YD6A 4JFPB 3BAWA 5HYIA 3H7BA 4ZBJA 5I24A 4OD2A 2DL9A 1UB5A 2HVBA 3GXTA 1CIUA 1FZOA 2V5YA 4Y4FD 4F8OA 2GC7C 5H35B 2PYEB 5E5MB 4HEPA 4QRRD 4OJAA 3HC0B 1J7VR 3NCJL 4GT0A 3NIGE 4PS7A 4NEHB 5TE6L 1ACYH 2W5PA 5EN2B 3BAEL 1YMMB 3DOHA 1FAIH 1PTZA 1YUKB 3EJYC 4KBPA 1HH9B 1IBZA 1QVOB 3D6GA 4APQB 4F20A 3DX8A 4ZTOH 3QZPA 2N7SA 3T65A 4ZTPH 3QZWB 3NY8A 3QAKA 4FQHB 4Z8FH 2EH8L 3UAAA 5MEQA 2GTWB 3U4EB 5LGYA 2CHNA 3PWHA 2X4QA 4XMLH 1KJVB 2VDLB 1I7UB 2RIKA 2WLLA 3DV4B 3FMGH 3MUY1 4G8GB 4AMXA 1UQSA 5ESVA 2JV6A 3F62A 4JN2A 3V4PA 1NGQH 5HY9B 2X87A 4RNRB 5L88H 1YCSA 2OMXA 2C1PA 1GSMA 2XA3A 3ZDYF 3RWHA 4LOUC 3HMWH 2WXGA 5KYXB 2BFVL 1P1VA 4KKPA 4F7MB 2XBTA 3O6FC 3NP4A 3QDMD 1ZCRA 5T8IA 3KPPA 4AOFA 3RGVA 3TP4A 4AYMC 1K4DA 1AXSB 4WWNA 5ITFA 2P24A 1O6VA 1OAJA 1UB6B 2W07A 3LEYL 2SEBA 4Y1AE 5E5LA 5EA0L 5GHWH 3L5HA 2AI0L 3CHXA 4Z18A 5IMMA 4PBWD 4K3HA 4HIIA 5EHFA 2AAAA 5I0DA 2P5WA 3TO4C 1TTBA 4NAMA 3U79A 5LDSA 1YN7A 5T1LB 2MHAB 3B9DA 1HINL 3MOBL 1JN6B 4AMWA 3VM5A 1XF3A 2IJ0C 3BRGC 1KLFB 1QHJA 2HX8A 4NQVB 2RBLA 2A4EA 1JTPA 5DMKB 3L08A 4CVWA 3O8XD 1EAJA 4EKXA 4FNLL 2ZOUA 3E8UL 5J12B 5EBLB 4PJ7F 3HOGA 1JV5B 2HG5B 4BUQA 4GXUM 1FLTX 1KJ2L 4Z7UE 1SRDA 4LL9A 3VTTA 1YEDB 4Y5XA 5EC2B 1S9XB 1FCGA 3QCTL 4GBRA 3P9LA 4X42A 1DCLA 3M17A 4HXBL 5D96C 1PJWA 4UZGA 3IDXH 1QKZH 2NW2B 4UUJB 3JWNE 1YEKL 4Y2DD 4G1EA 1M1SA 3UZVB 3MLXH 4NQXB 2YPLE 5D1QB 3IWVA 2X2UA 1KIRB 3HPLA 4A4MA 4JGJA 3HS0A 3QI9C 3ZE2E 5CEZL 3DO7B 3RWJB 2XLLA 4GQ9H 2AJVH 2B77A 5DRZA 4PVNA 4P59L 4EMZA 3BKCH 4K8RH 2GTZB 4OM1H 4GXVL 3LRMA 4P99A 4WAFA 5L7XL 2HLAA 1NLDL 1ZS2A 2XI9A 1PVHA 3IPFA 3MAWA 3NPZB 4A2MA 4AQ1A 4WHTA 5IQNA 6PAZA 2X1WL 3S96B 5AW4B 3OB0K 1HHJA 3T5WA 4GUQA 3VGBA 3MV8B 4OLVL 3B5GA 2K6ZA 3NIFE 4R0LC 3V4PL 4X9HA 4YHNB 1L7IL 4ODSH 2YN3A 4N0YH 3ZDWA 3RHWF 5E2WL 5KSAC 4GSDL 3HZ3A 4AQOA 3DVNA 1J9CT 3KS0J 2R23B 3N41B 5EU7E 3BGFB 5B1CA 1JTTA 4L1LA 3M1CA 2R56L 1LWRA 1IGML 1RKRA 3EO9L 1H3PH 3RIAF 3CPLA 1WTGT 1ET7A 3VI3B 4KUCF 3NACH 5D6DC 5EH1A 1MFCL 1LE5A 1U8IB 4OIIH 4WW2A 4HVBA 1DUYA 3MRGB 5ANMB 3UYOD 4D3CL 4PRIB 1PFOA 3OKOA 4KHXL 4TQIA 5DQDL 3QXTA 3L3JB 5C2UB 3CU1A 5KYYB 1I3GL 3QULB 4HEMA 4FFYA 3O6FD 3ZQWA 2IDUA 4IDJH 3GMNA 3ZE1F 4KQ4H 4RRPA 4L3AA 1BJMA 1DQQB 2YCXA 3BLKA 3FSWA 5D7JA 1U2HA 1DBMH 4M5TA 1ZGLB 4ODXA 3ZE0B 3LKOB 3KJ4B 4S1SH 3O3BB 1RURL 1Y7VA 2ZKYA 3ULUE 3C6LC 1I8KA 1EHAA 4WSJA 3MRMB 3AT8A 1QLEB 2K4AA 3C6EA 3MYJA 1T0OA 4TSBL 4Y4KB 3IRCA 1C9SA 3HAOA 4YIQB 1VZHA 2X4PA 5F89B 4AT6B 4P4KC 4D0CA 1M6OA 1PZCA 2HLFC 4YHZH 3GZQA 2NY1C 1SEBA 4KNUA 4LQ1A 5B1KA 1JWSA 4JRYA 4KKCC 1F3DH 2ZXEB 5GPRA 4PJDF 1HAUA 3IDUA 2OYPA 1ND0A 1Y0LB 3MU3A 4LDEA 1HOEA 1U33A 5FO2A 1NBVL 1MFDH 5DZJA 3V8OA 5F7DB 4FQQB 3SPVB 4NDMA 4LP8A 4XBMA 1QABA 4E0RA 3QRGL 1ECZA 3FU9A 4JANB 1ZY9A 1AGCB 1DJHA 2WQAA 4H8HA 5FUOL 1Q8MA 2KERA 1P4LA 2DL2A 3VU1A 3AG1B 2YXFA 4NUGL 4UNUA 4MCZA 5DA4A 2BW4A 2NXZD 3I6LD 1AXIB 1E5AA 4XPBL 5F9JA 5C07E 1BCIA 3V55A 2CO2A 1PNCA 2H26B 2YN5A 2OM5A 4Y2OB 1VJMA 1VPOL 2BCMA 1E8YA 5AKRA 2UY7A 3VDAA 3ARZA 3NFSL 3MI6A 1YPZE 2NNCA 2DQIL 2R83A 5E2TH 4KDTA 1KB3A 4PI2A 1URLA 3ISWA 3LD8B 1DDHA 4HMEA 2FO8A 4HS6B 5CKGA 5B21A 5BO1H 4KHTL 5J7AA 2KH2B 1E7VA 4QF1A 3NDYE 1I8LC 1QHPA 4FNUA 1R24B 4ONGL 4NSKA 4I2XA 1Q72H 1BJ8A 4A2GA 5KSAD 1U3NA 4K4KA 2PPCA 3AB0B 1AO7B 3RWGB 5DD1L 2XUWA 3J27A 3ENEA 1RIVH 1WO2A 4QRSB 2Y0SA 2OXHB 3EJQA 4DP6X 1IGJB 3IJEA 5F71A 4DN4L 1IIIA 3RJQB 2BIQA 1JDCA 3BKML 2ZCLL 5FYKE 4M03A 4ABQA 2C3GA 4UTCA 2R2EA 4MSWA 1UVQB 3WDHA 4FQCH 3OC5A 1F1GA 5DWUH 4X32A 3N44B 2Y24A 4DFHA 2ICWJ 3DI3B 1RUKL 1S6NA 1TZ8A 2GY7B 3NPSC 1E8WA 3ZU8A 1Q9KB 3IFLH 4FNPA 2WUCL 5F1IA 2KI6A 3NJFA 3QIBB 4H40A 1N6QH 4JKPH 4X50A 4XNUH 4FJ6A 1IQWL 2DBLL 4UV4L 3QDGA 3X3FL 3EGXB 3L4VA 4JFVA 5B6XA 5CLZA 4XWGH 1V27A 4C56D 2BP8A 3BH9A 3A0OA 5D7KD 2E4FA 3VJ6A 3C6LD 4RBPH 4J2XA 4RGNE 1A7PH 3NMEA 4P2QD 1J9RA 1PX3A 3EGDA 4PUBH 3MZGB 4F2EA 4MB4A 4WTXA 3FQ1A 2ZNWA 3L3KA 1IAIL 4HJTA 4P4KD 4RX4D 3TLRA 2FQEA 2HLFD 5DZLA 2NY1D 2H0PA 4MD0A 3AQYA 3O4OB 1P9MC 5G4MA 4GAYB 3BQUB 4KKCD 4XNXL 3GQFA 1G7JA 1UT1A 3BVXA 1FIGH 3KYNB 2OP4L 1SHSA 4HETA 4QRPB 4B9YA 4M1DL 5BJTA 2Z0UA 3GIVA 2IO5A 4X4KA 3UXFA 1HE7A 1X5YA 2EADA 3QUXA 4GAAA 1C8RA 2BRDA 3FO0H 3D9AH 3MLTB 4A38A 1YDPB 4AIEA 3KJ6L 3V5DB 2LT9A 4KKZA 1UXSA 1IBDA 2K0RA 1HSAA 2I07A 4JDZA 2KUTA 2V3DA 3ECBA 3K8MA 4N8PA 4PWGA 3AY2A 1UOKA 5LQBL 5GRWA 5C0CD 1F6AB 4K7PH 4P5TA 5DI8A 3TCXA 2LOEA 1VA9A 2NRDA 4XNBA 5I66A 2CZNA 1QFUH 3QIUC 5TDOB 4XPTL 3S97C 4WTZG 1T5WB 3HJEA 5DD3L 5F3FA 3CX5J 3BFQG 4G43A 2TAAA 1NAKH 3CFQA 3V0WL 4ATWA 2ADIA 4JY4A 4MB1A 1U8JB 4DHLA 2DWEA 3HMXL 3PGDB 5J6SA 5BW7C 4UANA 1O75A 4UOW1 3ZQ9A 1WBXA 2YAQA 3TURA 1MJ8H 5D4JA 3MUUA 5EOTB 4FP8L 1IQDA 4AMKL 3OXRA 1OCCB 1FNHA 2EEFA 2PR9A 2P5EB 2VABB 4HWBH 1N0XH 4HG4J 3SCMB 3UC0H 5AOKA 2PYEE 4YDJA 5L8JB 1MKFA 4NO2A 4KXDA 2QDWA 1L4IA 2PABA 5FYJL 4HH9B 1NANI 4C4BA 5A3IC 5AAWA 1A7QL 2K45A 3C2AL 4RWYL 2VE6A 3I9IA 1JWMA 5A2FA 5JHLA 4I1RA 5DHHA 4Q97A 1CZ8L 1IE4A 2FQFA 4MBSA 3DMMA 4H5SA 1XF2A 4PRHD 2A1WH 1CLYH 3N85H 1WEJH 2NUPA 1SBSH 3ULVH 4LSTH 1JRHL 4PJCA 5AG8A 3GXIA 3LN5A 5HPMA 3GXPA 1M2VA 1F4WL 4JM2D 4E41A 5D2LF 4LL1A 4NQSB 3LKQA 1MJUL 4G8GE 5EZIL 5FWQA 5B8CC 3VDBA 1SEQH 2J6EA 2MOGA 3P30H 3QUYA 1PAMA 3R0NA 4OD3L 3FTGA 4U6XB 4FZEH 1GGTA 4JREB 4DP8X 2Y01A 5KS9B 2VISB 4GEIA 5FA3A 3KYOA 3UJTH 1J1PL 3DSFH 3JWNH 1UACL 5KJ7E 1XGUA 1ONQA 1QOKA 1BM3H 5ALCH 4GW1B 5AW3B 3S88L 3NA4A 1R3JA 1PW3A 1CMOA 3VB9A 1FL6B 5F97E 3PIQA 1U8LA 1KCRL 5T1MA 1QKOA 4L18A 1FL5B 2Y6SD 4CKVX 4LLDA 1RXLA 5IJKA 3VXPA 5A16A 5DJYB 1UM6H 3EDFA 3MFFB 1M05A 4QHMA 4N4WA 3VD5A 3QWNA 3UGEA 4BSVB 1NAMA 3V4VA 1MHCB 2VQ4A 1PMYA 3F58H 3AMKA 3TA3B 3JT2A 3VWKB 1ZXKA 3FQRA 5BOPA 2X6BA 3L4ZA 1MRFH 2JCCB 5G55A 1DJIA 4WI5A 1MIML 3SGDI 4DAJA 4A2LA 2VB5A 4UCFA 4GUCA 5CINL 3REWA 2VJ8A 4TUJB 3BT2L 4A2DA 3QORC 5IT2L 4GUPB 1CICB 3MROA 3ZRSA 2C3HA 5B0WA 4H26B 2CE6A 4U6VH 3KWWA 3ATBA 3MACH 3H7LA 4PY8I 1IC4L 3HVDA 5K9KB 3WUZA 4XCYA 4WFFD 3QIUD 2XWRA 2JI2A 1VFMA 2WUBL 2PXYD 1WC7A 3EYSL 3ZKXB 4JZJB 3MSPA 4UT6H 2EIZA 4XPGH 3MR9B 2MPAL 3ARWA 4MA3B 5D1QE 5I74C 5HYSB 3TBVB 2V4LA 3CLFH 5FUCE 3WELA 2WHVA 4GI8A 3WXWH 4LF3B 2GAZA 3U0TB 2E27H 3VX0A 1XB8A 4UQ3B 4TNWK 3LIZL 1ROWA 3KYAA 3NSXA 2Q3XA 2VXVL 3N9GH 5AEAA 2VZ1A 3V6ZA 4F1SA 3BFWA 3IDGB 4AYFA 3I75B 2CIKA 1N8ZB 1RZIA 3FRPG 2K6WA 4P46B 3WN6A 3GHPA 5CGMA 1UH4A 3D2UD 1BD2E 3FONB 1YQVL 1SDDA 2P52A 2WXRA 1EEYB 1N7ML 3S48A 2QZ5A 3NVQA 3K0WA 1ZLWK 5B6VA 1LO0L 4I5BA 4R7NA 2J6EL 3FO2A 3MV8E 1OD9A 2R4RA 1AGBB 4JJ5A 5D4QA 3S36X 2CK0L 4J3UA 1CG9A 5KUMA 3BPLC 1KCUH 2BNRB 5I18H 1LP9B 2CO7A 4H25B 4NUJA 5DVOA 1YNTA 5IWLC 5KBPA 2LU4A 4LSSL 2HJKA 1KJ3H 2YARA 1UJ3C 3NABH 4PTTA 4Y19D 2WXQA 1PG7L 1U8KB 4JG0L 4BIKA 2CNZA 2N7AA 2QTVA 4ORZC 3EFDL 3BRFA 1NIBA 1Z9NA 5ANME 4PRIE 3SY0B 4G71B 1DJXA 2ZOOA 2GEQA 4CADB 3PUCA 3D25A 3GLZA 3IAPA 5EU3A 1B6DA 1LILA 5AW9B 3DECA 3SQBA 2CJTA 2OK0L 4PB0L 4ZMYA 2KPWA 1R3LB 1EANA 2AABH 1T6BX 1E27B 4X6DB 3ZE0E 4U2YA 5ITBL 2QVIA 1AHMA 4MMZC 4XOBA 5HHOA 2EEBA 1X44A 3UPCA 3BD5A 4JG1L 4LLMA 2H6UA 2J6WA 3M7FB 5HDLA 4AEIL 3ZTNL 1OGAA 3RDTC 5L6YL 5IV2B 3KPSD 2DQUH 4GRVA 3MX0B 4LMQI 2YD4A 3OR6A 1FO0L 2ZXQA 4FXLA 4XOEA 5CFAA 5J1AA 3WJLA 2RB8A 2W60B 1AXTH 1T5KA 3C9NB 3L5WB 5B6WA 4WV1C 3Q6GH 4FXKC 3L1OL 5JOPE 5E0FA 1A25A 3QORD 4X6EB 4PD4K 4F15C 5LBVA 1P1ZA 2BIHA 3FT2A 3LQZA 1UFGA 4NJ9H 2GJ6D 1KIPA 4HLZG 3TBSA 3ZRFC 1BBJA 4RDQG 2HRHA 1DQMH 4Y16A 4BE6A 3HPJB 2ADFH 4M8QA 3QDCA 1IM9D 4FHBD 4TF4A 3STBA 4HZLA 4KJPD 1VACB 3ES6A 1GGUA 4OUOA 4HBCL 2IAMD 2O61B 1QLRA 2D3NA 2DQ6A 1Q0YL 1U8OB 2F19H 3FUNA 2AV7B 4XP4L 1ACZA 2BVPA 4U6YB 2A77L 4GXFA 4L5FH 4NN5B 1YJDH 1XGRB 4PV8B 2AQ1A 2WB7A 4BH7A 1HHHB 1A6TA 2NT1A 3NIDB 5KVEE 4PJ8B 4O9HH 3O3UN 3SE8H 3QXWA 2VLRD 2GSIA 5JW4N 1REIA 3RWCB 3P4NB 4PBXA 4RGOL 4XP1L 3KGUA 2CUMA 4NQCD 3WHE0 4KMLB 1YMHB 3D18A 3RWIB 3WTTA 3O4LB 5GSVA 5AAPA 2E74C 4IHOB 2ZPKL 5IB5A 3V0JA 3AG2B 5TDNB 4J3OH 3VI4E 3S34H 5B39G 3L4CA 2DZEA 4QYOB 3LZFL 1P5VA 3SYPA 3MPCA 3EJSA 3SGKA 2NQ3A 1SHMA 4L6RA 5IEKB 3LOWA 3CDGB 4G6FB 5EN0A 3GXDA 2X3AA 5DHEA 3W57A 5FYLL 3ULSB 3P4MB 4AYGA 2JQZA 4JGMA 2IOIA 1OD7A 1JG9A 2BSEA 2EP6A 3PDOB 5A45A 5CBEB 1A65A 1DJWA 3NCWA 4MTMA 4XOAA 5C6WH 1EFXD 3V6FA 1BRXA 1DQTA 3M07A 5T3ZD 4NWTH 2KKQA 5IW3A 1XIWC 1VSCA 1CE1L 2DQJL 5EBWA 4AQ8C 2NZIA 2ZICA 3CFIC 1JHTB 4O2EA 2K4WA 1NGZA 3EO0A 1NCWL 5IQ9B 3U6XA 2MEJB 3GS7A 2LLGA 3GFUA 2KS9A 4B9GA 1DO5A 5F9OH 4YXKL 2CGRH 4A6YA 4Y1SA 2WXMA 2AEOA 4UQAA 5KEZA 2YEZB 1AP2B 4FQXC 1T1WB 4JQIA 4KWUA 4PW9A 4DKLA 2G0LA 4K94H 4MAUH 4U31A 4ZS6D 4OUUB 3F85A 5G28A 1TZIA 3TJHC 2ZUVA 3N50A 5DRNB 1A3LL 4AXWA 1PZ5A 3QNZB 4WFED 2E5EA 4B95C 1NFKA 4WWID 4LPYA 3Q8BA 4HUXB 3VVVA 4NO0D 4MAYB 4QRPE 5AWZA 1XH3A 1YEJH 2YD3A 2OQJB 2Q7NA 2B4CH 4J3OG 4R7DA 1OT2A 1QPPA 4UBDC 1BSIA 4Z0BL 4G6KH 1L3WA 3QCVH 2OPCA 4RBPK 1A6VL 1IJNA 1D5BB 2ZKHH 3SE4C 4BA8A 4BV0A 1AD0B 2I7OA 5LGKA 4Q2ZA 4OLXH 3ML8A 1TVDA 4X98B 1KDJA 1FFNB 3S3CB 4NZRL 4ZQKA 2EYRA 4KOCA 2VDLH 2OMVA 2WQ8A 4WI6A 3Q5OA 4DP4X 5EC1B 5ID1B 1QWUA 1TEGA 3MV7B 3V0FA 1AR1C 7TAAA 4AM0Q 2ATKA 2DEYX 5AUMA 4YHLH 3DQBA 1R5VA 2V6HA 1GW6A 1PPIA 1D5ZB 4ZPVB 3WL9B 1KGUA 1F86A 3Q01A 1OIOA 3MFGB 1J8HB 2DYPA 1W0VA 3CK0H 3BZDA 1T22B 4F7CB 2FX8L 3VQ1C 3C5ZB 1OP3K 3WNJA 5I6OA 3K5SA 4B60A 3P3SA 4JO3L 3B2VL 2YBRB 1FG9C 2PCXA 1WZ1L 1NCNA 1T83C 4CSTA 1I82A 4J3XA 1UEMA 3F84A 4KH2A 3S3SA 4KAQL 3UBHA 3MLRL 3DHUA 2DJSA 1IM3B 2FWLB 3ATDA 4G7VH 5B3JE 4C54A 2BSTB 1OWRM 4JQVA 2AJZB 1VGKB 3B9AA 4UZUA 3S0PA 3ZMNA 2OR9L 1JZ4A 1VZIA 3GMPA 4QDGA 1G7HA 1OPGL 2V7HB 4MDIB 4PRNB 1ZANL 4V2BA 4DTGH 4YMPA 1PXRA 1B4TA 1A6ZB 5C09A 5MI0B 3UPAA 3I6GA 2ZYSA 4PRDB 4TL4A 2I21A 4ZMTA 4BFEA 3PDSA 3QIWC 1MHPH 4NBZB 4PBVC 4XP5L 1AIFB 4A6YL 1CXLA 5JXAL 1R3HB 3MLVL 1JGLL 1U4FA 2Q2EB 2UV3A 4XX1G 4YX2H 1OAXH 5FPIA 4ES9A 5I1JH 5EG6C 3F7YA 4JQIL 3UMTA 1XIWD 5EIIB 1T0PB 3TESA 4IBVA 4PWEA 3U9PL 2X4SA 4ELDA 4Q14A 3VFGH 3ARBD 3MGOB 5AYQA 3ZHLA 5IROD 3JVGA 3GRGA 3PWLB 3VWJA 5KS9E 4R90L 2GSGA 1WH0A 1MI5D 2G60H 2Y07L 4K15A 3QDJD 3UTVA 4KRPC 5FFOA 5C71A 5LXGL 2GY5A 3VXRD 3C9LA 4UINL 2B59A 5C2BH 3HHSB 4FQXD 4AQAA 1IMHC 5AOMA 4WGKA 2VR6A 4QWWC 4PVMA 3SYQA 5KJRH 4UG2A 3AQDA 1YC8A 3IBOA 2P43B 3QG6B 1UM4H 3VXSA 1OAZH 1MNUH 1YY8B 4JFHD 1KENL 3FQ4A 1LK2A 3RVXD 3TJHD 1YNLL 3KW8A 4KPHH 3S37H 1WCBB 1B4JL 2R15A 2EIJB 3C08H 3UYRL 3NQKA 5IVZA 4LSUH 4M5ZL 5IJBC 5EWIH 2F0CA 2IGFH 4ZUVB 2LGNA 4XP6H 3DI2B 4XBEH 3IXTB 5JLZA 5K9JH 4G7RB 4QRQA 4GPVA 2BVTA 3VRJA 5IJVB 1E9OB 4JFTA 3FFCE 1I8UA 3B9KA 1FBKA 4UBDD 2OTUA 2XSKA 4AMJA 1P53A 4RA0C 3VB8A 3KEHA 5AX0A 1PZUB 3UZEA 3PWUA 2DOCA 3I6SA 4GBXB 4YS4A 1ACYL 3PPSA 2V37A 4MQTA 1NM4A 2NW3B 1FAIL 2DM4A 3GEFA 4V1DE 3ZKSD 5I5JA 4U1GC 4W81A 4ZTOL 3EJUA 1NQBA 2PW2A 4ZTPL 2P80D 4K5LA 5ILTL 1AR1D 2AHIA 2DTMH 3T0XA 3MV01 3QA3B 1CLOH 3V0VA 3WAKA 4JQXA 4XMLL 3RL2B 4FLSA 1EFQA 1HC1A 1U58A 5D1ZA 5DC4B 3FMGL 1CVRA 5HTSA 2UZXA 2ZUQB 4HWEH 1TYEB 1NGQL 2AJYH 3VXMB 4P2OA 3VXUA 4LSVH 2HTLC 3ZTJG 3HMWL 4X5LA 1XF5A 4XWOD 1LO5A 3BJ91 1ZV9A 3E3QE 3HG1D 4FL4B 4JKMA 3CUPB 1TSRA 3BCFA 4KRMB 1QLEH 4U6HA 5A6MA 4HKBA 4ZAKD 4A7UA 4YN3A 5JJEA 3E6HA 5ECJE 3WEXB 3A47A 1LLAA 1VDGA 5GHWL 3WNNA 2GUOB 3TJEH 2XN1A 3KPRA 3UJIH 4QCIA 2X05A 3QIWD 2WN2A 1MQKL 3KAAA 4RSYA 1LP9E 3THMH 3ZK0A 3PNWB 2AC0A 2V3FA 3BRDA 1LEGA 4EOWH 4KFZC 4CBZA 3KW7A 4JQ6A 2H1XA 1RU9H 2I26N 4OI8A 4G42A 3GB7B 3MRJA 4P3DA 5E8OA 3LPPA 5E2UL 5BR2A 4KRPD 1A7OL 1SJEA 2EKSA 5DK2A 5GZNA 2IANA 2AV1B 2VXTH 1EA9C 1RZ7H 2ZP0T 4NCC1 5D4IA 3QPXH 4HSQA 1NA8A 2NY3D 2A73A 4QWWD 1JNHA 3ARED 2ZUTA 5KYWB 3MCLH 1KG0A 1QKZL 3BC9A 3IDXL 2YA0A 2EIKB 4XTNA 1WFNA 3OKEB 1ZLEA 3IJYA 3MLXL 3NZ8A 3EAKA 4E42B 1DQJA 1WFIA 3K72A 3B7SA 5E00A 3QQ9D 3AITA 2XJKA 4GQ9L 2AJVL 3KMDA 4XPFH 4WU5A 1BFVH 1LO4H 2HKAA 1D6EA 3V0DA 5ACZB 4OZIE 5IUSA 1G7PA 3ZLQC 2MQ3A 3NJXA 4JFDB 2J20A 4X99A 5JORA 4MJ4A 4AW4A 4HUUA 5JIDA 3HB3D 1QMUA 4B9IA 3IU3A 1KF9B 5DLML 3P54A 2XKSA 3T04D 3V6BR 1W2KT 4NPYA 3G6JA 4N6RA 1R2NA 2AT9A 3B7TA 1KCVH 3JV5A 5AQ0A 1AHWB 4HCFA 4J4PA 4N0YL 4BH8A 5CF3A 1WD9A 2Q7YA 4Y5VB 4B0MB 5E6SB 1MCQA 2VC2B 4LIQH 4PRAA 2J8UA 3KPNB 3L7EA 2W59A 4ZUUA 3DWTA 3VNZA 4KKLC 2KQMA 1GZHA 3SN6R 1HEZA 3ARGA 3NACL 3HNVH 4NLHA 1Q1PA 5JW4Q 4NFCA 4OIIL 2J12B 5JPMC 3KLQA 5EOCJ 2C9QA 2X6VA 5C0IA 1X3DA 2HTLD 3NIDE 4HK0A 1CXKA 4DERA 4IGBA 5JJJA 4HOWA 2O6FA 4JKKA 4IDJL 5FC9A 1QEWB 4FLQA 3NQIA 2E9BA 4XBGB 2AS5M 4WU7B 3V2AR 1YYCA 1DBML 5JOEA 1XGQB 2F5BH 4PJCF 6TAAA 3AS3A 1DJGA 2X7LB 1QQDB 5KVGE 1J5CA 2E7HA 4WTZA 4L4TE 1UOLA 2K6YA 3I6KA 4S1SL 2CLRB 2F54B 4NAJA 3SBQA 1Y1UA 3U7WH 2BVQB 5T5NG 1T04B 4ANWA 1JGUH 5DZPA 2MQGA 4LDOA 5I28A 1QWHA 5KW9L 3UTXA 3BWZA 1KEMH 3MJ8A 4PS4H 5LVEA 5ICUA 1INQB 2HVKA 4BINA 5I0VA 1QUNB 1A7BA 2JQAA 2M83A 4ZO8A 1CGUA 4ABWA 3PQYA 4ZFGH 4YHZL 3L4UA 3OAYH 3A23A 2VT4A 1CVSC 3P0GB 4PJHA 3TNNB 4QHNB 1A9BA 1AC0A 2Z8WC 3V5HB 3P69A 2DH3A 4XXJA 1T3FA 2NY2B 2OJZL 3IFPA 4DK6A 4L0YA 3NN8B 4ONFH 3FCTB 5ISZB 5GS0L 1IU1A 2WBJD 3O41B 4W9EC 1S7VA 5TH2B 5CLWA 5E7FA 4YHKH 5E8PA 3TIEA 5CEXA 1B0IA 3LQAH 1IGTB 1KBVA 4ONOA 3NBNA 2VLJD 4IRSA 4KUCD 5AL0A 1L6ZA 2K78A 2QL1A 3EOAB 3WIAA 5IMKB 4I3RL 3U6RB 2BHFA 1VB9A 2NX5A 1OSZB 3ZGHA 2DQEL 3FFDB 1EO5A 3PQRA 1QBLL 2JELL 3HUJF 4PJEB 2CUAA 3DKHA 1PKQB 5TDPB 2A9BA 2EO9A 2HT2C 1PYWA 4KXAA 1C8SA 3VFTA 5HJ3B 2RFXB 5EIVA 4C58B 3H2QA 2CBPA 5LG1A 4GMTH 1X4YA 2DI9A 3FT4A 1TQCB 1H6TA 4J27A 4PY7A 4U1JA 2A99A 4R8WH 4NI6A 5BO1L 5AAMC 5IFAL 3W0WA 2Z8RA 1JERA 1UXWA 2HFEA 3EG9A 3QNFA 2EDYA 3MGTA 2B5IB 1JUFA 1PQZB 1LEIB 1F4HA 5SWQB 2PETA 1CFTB 3HJ0A 4NQEB 2HRGA 3GK8H 3FN9A 3UTSB 1WA0X 4DKDC 4FYTA 2XA8H 2IWEA 4N2NA 2VDNB 1LNUB 1PAZA 1RIVL 4NI3A 3TO2B 4GSRA 3HCVB 5DRWB 3UG4A 4OZ4B 1PY0A 5G36A 3LS5H 3P73B 4KKLD 2ZIYA 1C12B 1D9KB 2MCPH 4OLYH 4PRPE 4ZO9A 1NDMB 1AGDA 2PTTB 3AU0A 3WGUB 2F8XC 1J9QA 4FQCL 4HWBA 4HS8L 4U1HA 5DWUL 3SYCA 4HUWB 1BVKB 5AZDA 2Z1PA 5IIEB 4MCYA 2MKWA 4CMMB 1TETH 1J8HE 3IFLL 4AGLA 4Q0XL 3ARYA 1P4UA 1N6QL 4JKPL 4XNUL 5MENB 1E9PB 2CAKA 4TM9A 4UM8B 2CCVA 1YNTF 3KXFA 4LCWD 4N1CA 4XWGL 3NCXA 3X3BA 3E0GA 4W4OA 4XVJH 1RIUH 2NY4C 1GOGA 1RAMA 2WNXA 3G5YA 4J7RA 3TZVB 3ZDZF 3RPBA 5F7UA 3VNYA 1I1CA 3WTUA 3RUGA 4PUBL 4X4ME 4Z0XA 1E6OL 5C08B 2JB6A 1S7RA 2WLYA 3SJVD 4YSCA 2PO6A 1AANA 5JHDD 3RB5A 2UUDH 1PS3A 1TJMA 3T0EC 2BERA 4Z77A 5HYQA 4F27A 1T89C 2YJLA 5I1CH 5FM5O 3FCSA 1FGNH 3FRPA 4AGNA 2YPLA 3PWJA 3B56A 1G1OA 2R27A 1P69B 1FIGL 3C8DA 3HE6A 3QXVA 3U7YH 9PCYA 1HEJC 4MMXC 4QXGH 4FG6C 4H2CA 2R7EA 3PABB 4XHJC 2PP8A 2A6IA 3H0TB 1CU4H 2Z92A 4D9RD 2Y7NA 4YLCA 3D9AL 4PYHA 2QEJA 3KVPA 2OAAA 2AXHA 1XXDC 1BRDA 4LBEA 1B0RA 2DMCA 4D0BA 3APFA 2VIRA 1NBCA 1XMWA 3PWPD 4WEBH 4K7PL 4BDVA 3EHBD 3COOA 4O2CB 1M71B 4FQJH 4OU3A 4YL4A 3BXNB 1QFUL 3QFDA 1DSYA 2Z93A 5DJAB 1X5XA 1BMWA 2ZWYA 4F7EA 1KT2A 3TPUB 2ITEA 1NAKL 4IKJA 4OF5A 4MLSA 4P2RD 4GT7A 1X7TA 1WZMA 4ZZFA 4PJAE 1UM5H 2XX0A 1R47A 3RZCC 3UERA 3KLAB 5JJNA 4N0FB 4RFEB 4X1HA 1JHLH 1KXQE 1MJ8L 1NC2B 1M56B 3NP3A 1HL8A 4H4NA 4ZFOB 5BOJA 4BFIB 2FR4B 2XVGA 5GGTH 3GMLB 2D7NA 5E4EC 4HWBL 4AVJA 4UOZA 1N0XL 3UC0L 1B6UA 4AE1A 4GQPH 5HGBB 1TR7A 2NPLX 1MUJB 3NGBB 4OGAD 5BS0B 4D9QE 4LKCA 2AEWA 1TPXB 3IN2A 2DJ4A 3CODA 4P57B 5BZWB 4R4BB 1T1XB 3HE7C 3LY6A 3QXAB 1DCEA 1HHIB 5CR1A 1MPAH 3KVDD 1E9QB 4XMWA 1XQ4A 2BIMA 2H32A 3F6LA 4FD0A 4L8SA 1NIDA 2I1XA 4A55A 3SDAC 5DZOA 1SPDA 1CLYL 4FYSA 1WEJL 3ZEVA 1SBSL 5ESAA 4LSTL 4UT9A 4ANUA 4DEWA 5KAQF 3FQXA 1A47A 2G3XA 3D4ZA 2TRYA 4OLZH 1MWOA 1SEQL 3P30L 2YAFA 1DQLH 5GS0D 5I1IH 4FZEL 2PWFA 5IW6A 3VXME 2K9FB 3OKNA 1PG7W 4CVXB 3LHPH 3WMPA 4EN3B 5AB9A 5C8JA 5KYUB 4JK0D 4WNQA 1XGZA 3L9BA 2J5LC 3DSFL 4YSPA 5E9DE 3LNDA 5EIQA 2EVFA 5HVGB 5CJXA 5HP5A 1BM3L 3GLEA 5ALCL 3QAZC 4HYJA 4CW1A 2QGDA 2D03H 1MCJA 1NGWB 3CX2A 3VXNA 2FH8A 4DPBX 1D6VH 4L37B 1G7QB 1OAYH 5C3TA 1HWHB 2HLEB 5E99L 3ZTEA 5AVUB 3WEOA 2EKJA 4FADA 4UQ2A 3VRIB 3OQRA 3QUMB 3O3AB 4EAEA 2FYVA 5E8DH 1UM6L 5DSCA 4GXUN 1CT8A 3JZYA 4TVPH 5F72S 1HSBB 3D4CA 3BX7C 4FXGC 3BJLA 5LB1A 2KPNA 4FX5A 3F58L 3U9UA 3GMRA 4RMQA 3TN0D 1P84J 1SY6A 2X0UA 1OHQA 1M1XA 4WWPA 1K8IA 2ROYA 3C8KB 2YPKA 1MRFL 4MZ3A 4BEIA 4EVNA 12E8H 5CWSA 4XHJD 3I50H 1FF5A 3G6DL 5D7LB 3IDMA 4E2OA 2BHZA 1T0MA 1J0JA 4M61B 4LSDA 5B39A 1YPZA 4POZD 4L05A 4LVOB 4U6VL 1HESA 3GSRA 2EVGA 3MACL 1EX0A 4A2HA 1I1RA 4OT1H 1C8PA 1T0NA 2Z73A 1TTFA 3MNVA 5DJ0B 3CFMA 1J8RA 2EIBA 2H41A 4Y4FB 4HKJA 5T3XH 3FQTA 5JPNC 5LCVH 5I6XB 4ZXBC 3UGUA 4HYXA 5I1KL 4HISA 3B83A 4QRRB 4Z3TA 5LNEA 1HDMB 1CL7H 1BIHA 4UT6L 3FXIC 3TH2T 5AWNL 3CLFL 3HC2A 1LO3H 4BZ1L 4NP4H 4AL8H 3WXWL 1TJIH 2E27L 5F7AA 2J56A 1URIA 1ZT7B 1C8QA 2JAFA 1Y6KR 2XQYK 4GO8A 4ECNA 1TQVA 2JJTC 2ICEA 4JPIA 5EZJB 5KVGH 1CBVH 3N9GL 3W2DH 2UWEA 4XAWH 2BSRB 2YXMA 3ULUL 4JFDE 1D5IH 4JFQB 1NEZB 2CH8A 2B15A 3UZAA 2CO6B 4M1CD 1PCSA 4UNVA 3SIKA 3OHXC 3VO0A 4P9HC 5BZZA 5SWZA 3B6SB 2FJGA 3R8QA 4N0CC 3X11A 4Z7NF 2BOBA 5A6IA 1DSWA 2OMUA 2L6XA 3RKDD 3E80A 3RFZC 1KPUA 1DBKH 4LPTA 4AV4A 1PD6A 1NDGA 3QDMB 4U7KA 1KCUL 4RCAA 4WHYG 3SDAD 4DIXA 1TXKA 3UCRA 3K1DA 5C86A 2AQ3A 5KKHA 1Z9SB 1KJ3L 4F8PA 1B3IA 3OKKB 1M9SA 3DX6B 2EDHA 2ZUWA 5D1XC 3DJSA 4U1KB 1NPUA 5I17B 4B9KC 2ESVA 2IDTA 2WYIA 1KFGA 5F1NA 4IU3B 2ZONA 1MFEH 1UUNA 1T4KA 1TMQA 1QSEE 4PGDB 1MFMA 3A67H 1MHEA 2UX7A 3NEOA 4JGUA 5DJCA 2AABL 3LKRA 3O8XB 2D0GA 4M3HA 3HFFA 3F7QA 3WO4C 2IFGA 4I1PA 2F54E 4L0ZA 1RPQA 3BPOC 4XNZC 3N42F 3IDIB 4NZUH 2DLGA 3RY6A 4DUVA 1KG8A 4YSSA 2GG1A 1TQBB 1FQ9C 4PH8A 4UU9B 4Y7MA 5DJDB 4KI5F 4UMSA 3WENA 4BEZA 2ARJQ 2EZ0D 4N9GA 4KMQA 1CD1B 3QR0A 5IUCA 1AXTL 4XXWA 4I0PD 9CGTA 4Y2DB 2DKSA 3O3EB 4XMPH 3FO1B 3Q6GL 2K1MA 3BQVA 1QZNA 4Y1AD 2WD0A 2CRMA 2OLDA 1BLIA 1DBAH 5DMGC 4OIBA 5TK4A 4L8CA 4JVWA 2BMKB 1ED3B 2B16A 2YK1H 4LQFH 5ISZE 4MJID 4N24A 3U1QA 4JFPA 1DQML 3K6OA 4KLYA 1S5IH 2ENJA 3H3PH 2ADFL 3RGVC 2B2XL 5IZ7A 1D7CA 4WTQA 4ZXBD 2LAGB 4DQAA 5H35A 1QYGH 3BEWB 3QK0A 2QQLL 5E5MA 1EBPA 3REVB 4PLJC 3HC0A 4PJEE 1PKQE 2F19L 4W6YB 3MXVH 4BV1A 5I73C 3F6IA 1S5HA 4IK6A 1YMMA 1WITA 4G1MB 1U8HB 3P2DA 1QVOA 4APQA 1YJDL 3PLYA 4DKFH 2GEEA 3HRZA 2EEDA 4P2YA 3QZWA 3SDYL 4O9HL 1DUZB 1GJWA 4FQHA 3SE8L 2GTWA 1HCZA 3U4EA 4ELMF 4OJCA 4TPRL 4GKLA 1BFOB 2F6AA 1GOFA 1Q9LB 3I9GH 3WV0A 1KJVA 1I7UA 3DV4A 3Q1SH 4G8GA 1OAKH 1NL0L 4ZJ9A 1SM3H 1GR7A 1BM1A 2YGVA 1MY7A 3LKNA 4FEIA 3IE9A 4N0CD 4RNRA 5EPMB 5G5DA 3K2KA 3TONA 2J1ZA 4Y5XC 2EC9T 3NSDA 4XVUC 4NQEE 5GGSA 3S34L 5KYXA 3UTSE 1JGEB 1ZVYA 1AYRA 3O6FB 4YR6B 1SVBA 4F7MA 2J55A 3CVBA 5C0BE 1SNRA 1KCLA 4WI2A 4NUMA 4W70A 1VKXB 1IEBB 3G7TA 4OFVA 4PJ6A 3DK0A 2YIHA 1AXSA 3QYCA 4LKXA 2Y06H 5ENWA 2EUXA 2QT6A 1ODUA 5D1XD 1UB6A 1F2XK 2JB5L 3HS0C 1F58L 2VSDA 5CZXC 5CCHE 3ZYZA 4PGEA 1B9KA 4LP4A 2CHDA 1HS6A 1KIUB 3T6WA 1PNDA 3K6FA 1AZNA 4NWTL 4NAQA 2BSSB 5T1LA 2MHAA 3CNKA 4Y8DC 1JN6A 4HSCX 4CSSA 1K2DB 1KLFA 5MENE 1L9HA 2X53A 1AIZA 3K6IA 4NQVA 4AQ1C 3PY9A 3AUVA 1AOHA 5DMKA 2CG9X 3MGAA 1GYCA 4ADIA 5AD0B 1A1MA 3VFSA 3P3RA 5C70A 5F9OL 4JZNB 3DGDA 2VXQH 3PDDA 5EBLA 3QFJE 3N0AA 5CJQH 4DGUA 1WAPA 4HYTB 3WTWA 3H4HA 2HG5A 1WWBX 4U49A 4YFDB 5JW5B 4AC4A 4YEFA 1FL3B 3Q2NA 4K94L 1YEDA 1SDYA 1TVBB 1UT9A 1A2YB 1S9XA 4MAUL 4ZX5A 3KYMA 2ZUSA 2YDOA 3L6FB 3MO1B 4QKXB 4LPCA 3K71B 5K59F 3GBEA 4UUJA 3QR2A 2ZG3A 3ESVF 3STLB 2EE0A 3L9RA 4HIEB 2NXZB 4RFNC 3UZVA 4JFFE 1A4JA 2WKOA 4FQ1H 4NQXA 4WW2C 5D1QA 2XKNA 5FW8A 1JD9A 4G5ZH 4DP2X 1YEGH 4XC1H 4PJFE 3RWJA 1HCVA 4YDLB 1YEJL 3MJ9A 3B37A 2B4CL 1CWVA 3DRTA 3VG0H 4FNTA 1HILB 3X17A 5C7XL 1WZKA 2Q1EA 3FUMA 1JYVA 5D7JC 3RGVD 4G6KL 2ZSVB 3QCVL 4TN9A 2ZKHL 4KVCH 1NBZA 1HQ4B 2EDJA 1T6VN 1Z7JA 4Y0GA 3UIYA 4J2QA 1JI1A 3SDDC 1SLWA 3S96A 3LZQA 4E9VA 4OLXL 1BV8A 3MUGB 4A63A 2I5YH 5EIIG 2VXUH 2VDLL 2YRLA 4QD2E 4AY0A 5JXEC 4DVRH 1JXGA 2HJLA 5GS3A 1Z9LA 2K3HA 5F0PB 5J11C 5KSAB 1SF5A 2L3BA 3V4UH 4YHLL 3G6JF 5JHAA 2EE9A 2R23A 3L8QA 5DD0L 4JKLA 3DGCR 4YZFF 4G6MH 4G8EB 5DGRA 1G1KA 4DP0X 4PJ9D 4AM0B 3O2VH 3RKPA 3VI3A 1J5OH 1R0AH 1EXUB 1HAWA 4Q7DA 1KMGA 2J8UF 3AFLA 1Y1DA 2FD6H 4JHZA 4BQBA 1U8IA 4Z7OE 3T6XA 2J7LA 3MRGA 2O5ZH 4JVPA 2VDOB 3QAPA 4PRIA 3J8F7 4G7SB 4G7VL 4B9FA 3UG9A 4WI0B 5EEZA 4ZMLA 5BS0E 3QULA 5KYYA 1LEKB 5D55A 1PG7X 2ZX8A 3QVAA 4JO2H 4N2DA 4TQHA 4YGAB 5PCYA 1DQQA 2K3TA 3QHFH 1CTOA 3CFCH 5ABZA 2XCMC 4GRWH 1ZGLA 1E0OB 4C56B 3LKOA 3QH3B 2MKLC 2NDFA 2Z8VC 3C6LB 3O3BA 5L0QC 4ETQB 1MHPL 4P2QB 5CZXD 5AKVA 3TBBA 1EJFA 2YGNA 1IKFH 3QPKA 2E9WA 4QYAA 4MA8H 4Y4KA 1SOQA 4YX2L 4FLRA 3QWRA 1OAXL 4YIQA 4A39A 5I1JL 4LXFA 4P4KB 5F89A 4AT6A 4OCYH 4F9PA 3L7FB 5DC2A 1JK9B 3ALPA 2NY1B 2X89D 4KDTC 1F4YH 3FN0H 3VFGL 4U3HA 3APDA 5FYKD 4AUUA 4BUHA 3OC8A 4YAQB 3P2TA 2G60L 5M94B 2DQDH 3BSZH 4PJHF 1Y0LA 4MKMA 5C2BL 3X12B 2RHEA 3U48A 5BXFB 1QZ1A 3PXOA 1MJ7H 4NS0A 2XQYA 5KJRL 4FQQA 3SPVA 2BWQA 4EZJA 1PEWA 3I2CH 4HX1B 4FAAB 1JRHI 2FAUA 1UM4L 1MDAA 5D70H 1ES0B 4JANA 1OAZL 2Y1ZA 1AGCA 1MNUL 5TPWH 3RGBA 4B96A 2JK5B 1FSKC 4KPHL 1QI3A 2MOQA 3S37L 5IG7B 4C4KT 4DP7X 5C0CB 5IMLB 3C08L 4N8VB 4LSUL 2V5RA 3S36H 5EWIL 4N0RA 1I7ZA 2IGFL 3WKNA 4E9RA 3G5ZB 4RGND 1EZLA 4TQPA 3ALWA 3ZN6A 4KOBA 4XP6L 5G2AA 2Q20A 3BGMB 1DQDH 3JUYA 3FQUB 1P4IH 2H26A 5K9JL 2AK1H 3PJSB 3E8VA 4PV1C 4XE5B 5D7LE 4I1NB 4OV5A 3WFCH 2E56A 4Y9CA 5JMRA 5IESH 3EBAA 3V7MA 2VC2H 1QLFA 3ATAA 4OZFH 1HJCA 3SDDD 1FG2B 4HS6A 4OCWL 1A6UH 4BGLA 3FB8B 3GBNH 1CURA 3QBTB 1RUQH 4XH2B 5JXED 1U93B 3W5MA 1JXFA 1R24A 4JHUA 4BCYA 4XCCH 3HR6A 1AQKH 2DTML 4QRRE 1CLOL 1HXMA 4KTEH 1AO7A 2BOCB 4WWKD 2P26A 4BEYA 1EDQA 4HKXA 4PY8J 1O5DT 4QRSA 1VADB 2OMYB 5J56B 2PN5A 1IGJA 2EQDA 2AXGB 1FGVH 4HWEL 5B1JA 4F92B 5DMIH 2Z7YA 2Y25A 3KLSA 2AJYL 4NC1E 4PRHB 4LSVL 4QGTA 1Y18B 4HHGA 5TE4H 1UVQA 3CX5K 5CILH 4ISVB 4TLTA 3GSNB 5HGAB 2BXYA 2VRQA 2XWTB 3JTTA 1QLEL 3NPSB 4JM2B 3QUXC 3W9EB 4JDEB 1V3KA 1FZJB 4CC4A 4H8QA 3QIBA 4HV8A 5KOVC 3OG6B 2X40A 2AJUH 2ID5A 3T4AB 2FX7L 1F11A 4P5TC 3WFBH 1GJUA 3TJEL 2JKNA 1J8KA 3CFNA 3KPMA 3UJIL 3AT9A 3QDME 2R0LH 4HG4K 3V9CA 5BUAA 1U3HA 5CD5D 4U1LB 5DMYA 3GC3A 4F7KA 2FK9A 3ULVF 2VZOA 2EXWC 3LN9A 4P23A 1T5XB 3G08B 4EOWL 2LTQB 4GKZA 4ZFZA 3RUGF 4Z7UF 3VE0A 3UAJA 5B38G 5E8NB 1RU9L 5IEHB 4GNKB 4M3KB 4LLVB 2OMTB 3EZJB 3VD4A 3MBVA 4JKNA 1ZVHA 4OZFG 3BQUA 3HIZA 1GY1A 3GXMA 4O51B 3KYNA 3BE1H 5DFWH 4QRPA 3V8CA 2VXTL 1RZ7L 1NUGA 3QPXL 4LAQH 2LE9A 1ZSDA 3HZVB 5TFSL 3ESUF 2YFNA 5IKCB 3UP6A 1KC5L 5HVFB 1GSKA 3MCLL 4GLRI 5AAWC 3KLDA 4FKKA 1YDPA 3CN2A 1NMBH 3BD3A 3HN8A 1H3XA 3A6OA 3SDXB 1O0VA 4DPCX 1NFDB 4F57H 3DMMC 5B1AB 4MD5B 1F6AA 1MH5A 2AGJH 4DK3A 4XPFL 3TWYA 2UZPA 5D7IA 2XPGA 3QIUB 5CCGE 1LO4L 1HFUA 3BZFB 4NQDA 2PXYB 5TDOA 4GI6A 4E9WA 4OJFH 4M9PA 1AQ8A 3QUYC 1U8JA 3NIFF 4JHVA 3I9AA 3RAJH 2VDNH 3PGDA 3S5LB 3P3TA 1N64H 5KN5B 3EH5B 3GTNA 5EOTA 3DOIA 1I8AA 1S53A 1RLBA 3GIZH 2AXFA 2CDFB 1KCVL 3ZGIA 3CFJB 4PJGB 3J07A 4Y7OC 2IPKA 4EA3A 3MRIB 3HAPA 5DQ9A 3BZ5A 2P5EA 2VABA 2DLEA 3AXHA 1W80A 3D2UB 4BVNA 4LIQL 5FO7B 2E76C 2ZJSH 4DZBA 5I76B 3WY4A 5I8CB 3JWOL 3GMOB 4HH9A 5IJKC 4W93A 4GFTB 2UZIH 3HNVL 1H5BB 5I82A 4K7PY 2B39A 1Q9WB 2H3NB 1P5UA 3CZFB 1AYOA 4X5WB 1QG3A 3M7OA 5CP3A 2WVUA 3NCFB 3ABMB 3DYPA 2MNWA 2OL3H 4UDUB 3QUXD 3ULUF 3PRZA 4Y19B 5B8CB 5AW5B 4NQSA 3D69A 2F5BL 2GJRA 4UYQA 3G04B 4U6XA 5G53A 3WKPA 4NQUA 4ATTA 4NO5A 3UTTE 1JGUL 4JUSA 4RDQF 1WFTA 1BQ5A 3HBPA 1DQIA 1KEML 4PS4L 2JVUA 3TT3H 1FL6A 5IVOA 4TLKA 4IOIB 2I60H 1ZE3C 5HDRA 3DBSA 1BD2D 1DE4B 3WFDH 4BFNA 1P8IA 1YYMH 4Z6AT 4ZFGL 4G83A 2ZYIA 4NENA 4LCCA 4DS7E 2GBTA 2DWDA 4GRLB 3KD4A 3D48R 5HDQH 4BUGA 5C9JB 1V5JA 1NGPH 1BA9A 1NCOA 4FXTA 3GWJA 4F3FB 4IKLA 3WFHB 2X2JA 2ATPB 2IPTH 3B3BA 4ONFL 3ZPDA 4Y9HA 4BSVA 3KPSB 4XMTA 1MHCA 3SO3B 1L7TH 3W9DB 4WKXA 4YHKL 1RCYA 3LDBC 2CLVB 3LQAL 3VYOA 2V17L 2JCCA 4OF3A 3EYQD 4F5CA 2DAVA 2WIIB 3POHA 1ZLSH 3QORB 4TUJA 3GPEA 8FABA 2DV6A 4JY6B 2GJ6B 1CICA 3DLQR 1CC3A 4GAFB 2D7TH 2V7NB 4H26A 3QS2A 4F2FA 5D72H 3DMMD 2FQDA 4KY2A 2A9NL 2OTWA 4HGWA 1IM9B 1JPST 2YD0A 5K9KA 1YPZF 2PR4H 3G5XB 1UEYA 1OXYA 4HJIA 2G4EA 4BFKA 1E3FA 2HWZH 2XICA 2IAMB 1BW8A 3BZ4A 4OZHB 2WM0A 4EBQH 3T8XB 4N8UA 4KGLA 4ZYKB 4K5PA 2VM4A 1VFUA 1PY4A 4X8CA 4R8WL 4H88H 1YHPA 4KKRA 3TBVA 1BZEA 2IQAB 4IBLT 3U0TA 5I19H 2HFFA 4X0KB 2DDQH 3KBPA 1KB9J 3QEGH 3TBCA 4FC3E 5EOCH 3JT0A 3Q43A 2VLRB 3GK8L 4N28A 1DLFH 3I75A 1N8ZA 4LVEA 3NAAH 1WGOA 1JBJA 4P46A 4XCFH 2WY3B 3P40A 4PJBB 2UWEF 4RMTA 2DQMA 1B88A 2IDCA 3LS5L 4NQCB 1EEYA 2XZCH 3EFOA 1J0HA 1KTDB 1O7SA 4FHKA 4OLYL 1ZK9A 1WVZA 5GGTA 5SX4I 2FWOB 4ZPTA 2WB1A 1AGBA 3FUKA 2JQMA 2DLIA 3H8NA 1UZ6F 4FEMA 5I1GH 1DZBA 1NOLA 2YQGA 3KPQA 4XODA 1TCMA 3BPLB 3GSVB 4M93C 5FF6B 2BNRA 3WJLC 1TETL 2R9HD 4YE4H 4H25A 3Q6FB 1BM7A 2MQCA 3KHOA 1UJ3B 4MNGB 2BIOA 3I3DA 1ZVSB 1FFOB 5K1VA 3CHPA 3ZHDA 4HIQA 1J9TA 2IPUK 4KZCA 3L17A 3MOAH 1YG9A 1CGXA 1LWJA 3U0PB 1SBBA 1RIHH 3PJNA 1WIOA 1EFXB 1NCUA 3PGCB 1BQSA 4XVJL 5IF0B 1RIUL 3QWOB 4Y16C 4NHCH 1F0LA 5LDUA 4J3OF 2A9MH 2CUIA 4K0OA 2PCFB 4U1SB 2EINB 4ZSOB 1A9VA 2JJSA 1R3LA 1WWWX 2A0LC 3FL7A 2JMRA 4RISH 1XCQB 4X6DA 1E27A 4HOXA 5D7KE 1B0WA 1X5MA 2W65B 5A8EA 4DEUA 2F58H 3C09B 3S6CA 2ZWZA 3FOLB 4P2QE 4WIQA 5I1CL 1FGNL 3HAEB 1RZ8B 3U7YL 3P0YL 2WNKA 5CSZB 4QXGL 4AKPA 3MX0A 4MX7B 1BREA 2W60A 3C9NA 3L5WA 4FXKB 5KVFE 1RHFA 3Q2CA 1I3UA 2VKXA 4NO0B 1UA7A 1SQ2N 3GINA 5DJ2A 4F15B 4X6EA 4M9OA 2ZG1A 4DJHA 4NO3B 3SE6A 4V11A 1DBJH 5CIPB 4FQJL 4X5RA 1N0LA 2MSPA 2JWYA 4BSJA 3MBWB 4AQEB 3VFUB 5A2BA 2NT0A 3HPJA 3SGKC 5KUKA 2XRAL 2J71A 5FJGA 5ELIA 4F8QA 1IO4C 4HH8A 4OF0A 1VACA 4HJSA 1I1AD 5C0CE 2O61A 2X6CA 3EYOB 4UAOC 5AOLA 5JW3H 1JHLL 1ZLVH 1U8OA 2Y7QA 4YBQC 3NEXA 4O00A 2Z9TA 1CD0A 2YD7A 4IW4C 1EHLH 5ESQB 4H0IA 5FK9B 5LCVA 2QSCH 4IBTA 3BAYA 1XGRA 4OZGB 3QRBA 4WGWB 2Y69B 2GKIA 1HHHA 4Q89A 4PJ8A 4L4VE 2XZZA 4Z95L 3CVIH 1FAKT 2Y03A 4R84A 1CO1A 1BJ1J 1H3UA 3RWCA 1JCKA 1WJ3A 5DEFB 3AAZB 3G9AB 3VD1A 4MCMA 4X31A 5CM1A 2PWGA 1MPAL 3L45A 3RWIA 1H2SA 4Q6IB 3O4LA 3WSQH 3NOIA 1OF0A 3B9VA 5HBBA 4N2GA 1ULVA 5E1QA 1JJUA 4JFWA 3BWUF 1JWUB 4BA0A 2ZCHH 2P8MB 5IEKA 2BIPA 3CDGA 4OLZL 4PWIA 5FA4B 1DQLL 3ULSA 4QTFA 3P4MA 5BR5A 1FO0B 4AIZB 3LHPL 4PRHE 2WKLA 1A9EA 1QFWH 5CBEA 3FULA 2D4FA 4EI0A 4W9JC 4JRXE 2E0PA 3W39B 3ABGA 2OS7A 1NJ9B 5BUPA 5AOZA 3GZOA 4Y16D 2E46A 4JN1H 1C5CH 2W80C 1CDYA 3I3EA 4ICXA 4BRJA 2O6EA 1XIWB 4OKVA 3AS1A 3ZTCC 3H9YA 4W9ZA 3GUFA 5KBDA 4PGJA 1JHTA 1D6VL 3ARBB 3FT0A 1CR9H 1RK1B 2OMZB 2Z64C 3BAIA 4K73A 3SBWA 1MI5B 5IQ9A 3TV8A 3GXNA 1A4KB 4Y2LA 5E8DL 4L1SA 3VXRB 4M4RB 1OSPH 1HKLH 1RZJH 4TVPL 2FO4A 3BMVA 1GIGL 4W9DC 4FQXB 1AP2A 2C9UA 1JPSH 4OJYA 4MXVE 3CN1A 1XCWA 4MJ5A 2OCCB 3LYRA 12E8L 2NY6C 3DROA 4ANVA 1XH1A 4OUUA 4RAUA 1P7KB 2CCLA 5F9DC 2X4TB 5H2KA 3L3IB 4NN7C 5DRNA 5E2JA 5JO5B 7PCYA 1MHHB 4DO6A 4MMYB 4MYPA 1IAKB 1CYXA 4HUXA 4AQZA 1UKQA 2J72A 4UB0H 3ABLB 1HE8A 4XB8A 3ULAB 3RVUD 2YC1B 1N5YH 2X3CA 4OT1L 3HANA 5T3XL 1N18A 2WYTA 5ICXA 4JQVC 5LCVL 3SD2A 2QQKH 5EOQH 3P11H 1A64A 1KIQA 2VZTA 5HHXH 1HOCB 1GKOA 4XVOA 3A7KA 1CL7L 1D5BA 3T2NH 1I1FB 1A8ZA 1BF8A 1SYVB 1QI5A 4LZKA 1NWOA 7PAZA 1NFDE 1AD0A 2B7DT 3X3CA 2LU5A 1LO3L 3C8HA 3KDMB 2BSED 4NP4L 3FCBA 4AL8L 1TJIL 2EH7H 4X98A 2Z7UA 2Y1VA 5DHVH 4GG8A 1UADC 1P8UA 5T5FA 2W38A 2EC8A 1YC7A 1ET8A 4R96B 5ID1A 4ZUSB 3MV7A 5I8OH 5KVGL 3D34A 1AR1B 1CBVL 4DETA 2FWUA 4GS7C 4XAWL 5DRXB 5I30L 5GRVL 4EDXB 1D5IL 3GLDA 1JNLH 1D5ZA 4RETB 3W82A 1XO8A 4WO4D 4F7CA 3JVGC 3C5ZA 1DBBH 1Z3RA 4NBXB 3BUYB 3X3GL 1CF8H 3FJTA 2YBRA 3ESNA 4QJ4B 1DBKL 3HG1B 3VI3F 4ZUTB 3BIBX 1UD5A 4ZAKB 4Z78A 1E65A 5B7MA 4U0RC 2BSTA 1QSZA 3FFCD 2IBBA 4R7XA 2AJZA 1VGKA 4X0NA 3LPWA 5BVPH 1E28B 1XR9B 2C4XA 2V7HA 3OXSB 3P2BA 2K8QA 4MDIA 4PRNA 5JQ6H 5CNHA 2BZCA 4ESKA 5E08L 3HZMB 1EIBA 4PRDA 1NWPA 3QIWB 4FS0A 3N55A 3TYGL 3VGDA 4V1DD 4G6AD 5D1ZI 4MXQC 1G0DA 3WMSA 5KBKA 3ZE0F 3TC9A 1MFAH 2P3YA 3A67L 3ETBF 5EUKB 1AGEB 4L1DA 5AG9A 1JGVH 1YEIH 4Y19E 5TE6H 4AGOA 5EIIA 3CFEA 1KYOJ 4DEPC 1OWWA 3UZEC 3UTZA 2JLLA 3WLBB 2HYMA 4UQBA 3VW7A 3ARFB 2H9GB 3MGOA 3IKKA 1DL7H 3PWLA 4KRPB 2KZ1B 4K8RC 3LB6C 2WLNA 4NZUL 2EH8H 4JE4B 4FN0A 2J44A 4AJWA 3ARUA 3HHSA 1I85A 3OAZH 2NY3B 4UHRA 3BIKB 3FW6A 3ZOAA 3W3BA 3P4OB 1DYZA 3AREB 2IBGA 3WIFB 2A6DB 4Q9RL 1CN4A 4JQXC 2WZAA 3AT0A 1VCBC 1VFAB 3QG6A 3L3OB 4XMPL 1ZDQA 5D1ZC 4GKOA 3WNPA 1YY8A 2VXQA 3TH4T 4K7PX 4RIRB 4X5XB 3HG4A 2RH1A 1WCBA 1HHGB 2ARJB 4P2OC 1A14H 3D09A 3O3DB 1KXQA 4M7KL 2YK1L 4LQFL 3KPSE 5CZKA 4ZUVA 3AROA 1EUTA 1GCFA 1S5IL