4FA7B

Structure of recombinant cytochrome ba3 oxidase mutant a204f from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 49
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4fa7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4fa7B02
3S3DB 1JOIA 2HX9A 2Z55A 3PXOA 2XVBA 3EMLA 1TU2A 2FJSA 2PPDA 3NS0A 4N4WA 2FTAA 4HHGA 3HAQA 1OE3A 1TEGA 3SBQA 4LDOA 1R2NA 2XV3A 3UACA 1DYZA 2QPEB 1GZMA 3NY9A 4X32A 2BW5A 3FSVA 2FQEA 2GBAA 4JKVA 2YCYA 3QAPA 2P80D 2HX7A 3QJVB 2XV2A 2ZXWB 4JHUA 5A44A 4P5SA 1RKRA 3RZEA 2AZUA 1AZNA 2AANA 2YAQA 2J57A 1KCWA 2IDFA 4X1HA 4M3HA 5EN0A 4DP5X 1JXDA 2I21A 4E9VA 2EILB 1R1CA 1X0K1 4KO6A 1J9SA 2IDSA 4DP6X 1PLCA 2PP8A 1NDTA 1AAJA 4AKPA 4DPBX 3ABGA 3WKPA 2YARA 1OCZB 4DPCX 4N6HA 4YSSA 1AZRA 3UZCA 2R7EB 2UX6A 4BV0A 5H2JA 4MBSA 1X0I1 1BQ5A 1U19A 1P8HA 3SN6R 5AX1A 3PAVA 1V54B 2IAAC 1XB8A 4AMJA 5E9NA 1M56B 1OOWA 4HWLA 4HYJA 5I6KA 3REYA 2XUWA 4YSUA 4AMIA 4XTLA 5F8UA 3QJSB 5PCYA 3WKQA 2XXGA 1J5DA 1AOZA 3ZPQA 1QM8A 2YAFA 3ZX1A 1SF5A 1OCCB 3CAPA 2W8CA 5LDUA 5IY5B 5AHYA 1ET7A 3TBCA 3FT0A 3EH3B 2E86A 2GC7C 1AR1B 4Q89A 4QLWA 4YSTA 3EHBB 4HCIA 3RYMA 3QJUB 2Y69B 2FT8A 1E67A 2VW7A 3ZDWA 1A65A 2NRDA 3KJ6A 1AQ8A 1T5KA 2BRDA 1AS7A 4BDVA 2VT4A 4BXSV 3AYNA 1AZUA 1XB6A 2FWLB 2FQGA 3PCYA 4E9SA 1J9QA 5I5JA 4UHRA 1SJMA 4PAZA 3ABMB 4LDLA 2WJKA 3CZUB 1PZCA 3FSAA 3KW8A 4UF7C 1BXAA 3NJNA 1WAEA 7PAZA 3OD3A 5A7EA 2R4SA 3VVKA 4MD1A 1OE1A 3AZUA 3CDZA 5AHZA 1J9RA 3AM6A 1ZV2A 2ZONA 2H5UA 1DZEA 3X3BA 2YAEA 2CUAA 4Q8BA 3NYAA 4HAKA 1KG9A 4DP0X 2EIKB 3UGEA 4PCYA 4YSEA 4YSAA 1IW6A 2PCFA 1JZEA 2HXAA 3FQYA 3DIVA 5B6VA 5AZDA 1QHJA 4L35A 5A8EA 4WAVA 5JJNA 3NSFA 2PP7A 3BVDB 1SFHA 2XX0A 3FS9A 3X1BA 4KNTA 5H2PA 1PMYA 4J4QA 4DJHA 3UG9A 2FT6A 2MRYA 3SQRA 4F2EA 1WS8A 5C1MA 3UTXA 4BEZA 4DP1X 1L9SA 5FJGA 1FBBA 4AI7A 4AZUA 3AG2B 3T6VA 1FA4A 3FPYA 4DKLA 3OMAB 1JZFA 2Y1AA 2QPDB 3ABLB 5J7AA 4YL4A 4YVNA 1GS6X 1KYAA 1SDDA 4F2FA 3PQRA 1ET8A 2OV0A 5DHGA 1PXRA 1M0MA 2UXGA 5B7EA 2QT6A 1ZPUA 1URIA 1BQKA 1ILSA 1NICA 2YAHA 3PWHA 2YAPA 1CURA 3ZPRA 3SBRA 4X4KA 1VGOA 2IWEA 2YDOA 4BVNA 4A68A 1KMEA 2HPYA 3MBVA 1SNRA 2NTWA 2GIMA 3NJFA 1GU8A 1L9PA 4P5RA 2ZOOA 2DY2A 3V9CA 1AZBA 4KOBA 2KSBA 1BXUA 3VI0A 2YCZA 4FPDA 4KOCA 4E9YA 1ET5A 3IE9A 4UAHA 1TKWA 2BWDA 4ENZA 1BAWA 2F95A 1OF0A 2B3IA 1XJIA 1F4ZA 3DQBA 1ADWA 1V10A 2AFNA 3AY2A 3PAUA 4HCGA 4JKNA 4N4YB 3QAKA 3NY8A 2VW6A 3OAXA 2J55A 4YSDA 2Y03A 3TU6A 2BP8A 1GSKA 4BK5C 5JJJA 4YSQA 2PEDA 3NJIA 5I26A 4BWWA 3JT2A 1E65A 1AACA 2VSKB 3FU9A 3OMNB 3HANA 1RZPA 1E5ZA 3UABA 3X2QB 1NWOA 4G7QB 4K9JA 1A4AA 1WS7A 1JZIA 1A3ZA 2AVFA 1FFTB 2I7SA 1HZXA 4A4MA 5BR2A 1B3IA 3NT0A 1KGBA 2CJ3A 1IUZA 1GY1A 3DDLA 2PPCA 1JFPA 3QJQB 5A45A 3QBGA 1X9UA 5B1JA 4BWBA 1PCSA 5H2MA 1BRDA 5EHFA 1JV7A 1VJMA 4QKTA 1NWPA 4A2FA 5PAZA 1OE2A 4M4RB 2IH9A 2DV6A 1OV8A 4QRYA 4NAJA 1ASPA 5B34A 1AG0A 1VLXA 4PXFA 1BYOA 2VW4A 2X88A 1JVLA 1GW0A 3RFMA 1M0LA 2UXTA 2EI4A 5H2HA 2XWZA 4HCFA 3ZBMA 1BYPA 1HAWA 3ABWA 5ITCA 2IWKA 2DYRB 4NC3A 2ZIYA 1NZRA 2Z73A 3OE0A 5F7AA 2GC4C 2JFCA 1L9TA 1L9RA 4TXVB 5I6LA 1MDAA 1ZIAA 4DAJA 4FA7B 1P8UA 1ASQA 5H2LA 5G2AA 3C75A 3NSDA 5AZUA 1IBYA 5AX0A 1SHWA 3N55A 4DP8X 1KCBA 4BWUA 3GDCA 2R7EA 4E9RA 1H68A 1IBZA 1TN0A 1NIAA 2TSBA 1MG3C 2I35A 2UXVA 3FSZA 2YAOA 4GBRA 3PLYA 3HAOA 2OJ1A 3TASA 2RH1A 3CVCA 1S51A 2JAFA 5B6ZA 3UZAA 3V2WA 3PXLA 4GY4A 3UAAA 3NJJA 3GXUB 1BEXA 3NSBA 4GP5B 2NTUA 1NPNA 1QKOA 1L9HA 1PLAA 2FT7A 4LDEA 1MG2C 3D12B 3EF4A 1KGYE 2VSMB 1S8JA 3S3BB 1NPJA 4HHWA 5I5MA 3H4FA 3FSWA 3L45A 2J56A 1JGJA 2PPFA 3AG1B 4PXKA 3T45A 3FQ1A 3FU7B 3T6WA 2CALA 4E9XA 3IN2A 3OM3B 1PY6A 4MQSA 2WSDA 1QNIA 4K5YA 2XX1A 4QI1A 3T6ZA 4W9ZA 5H2OA 3ABKB 1KG8A 2KSAA 3MX0B 4HIPA 7PCYA 1R84A 1LN6A 3C9MA 5B1AB 4E9TA 3WQJA 2KS9A 5D4HA 1BM1A 3TA4D 4AKQA 4G7RB 3DTUB 4GP8B 3ZEVA 3UAEA 2Q9OA 3DKHA 1XIOA 1X0SA 3UONA 1NIDA 1PF3A 3AG4B 1E5YA 4KO9A 4XT1A 1GS8A 1FBKA 1ID2A 4HYXA 4A67A 3HARA 2HLEB 4IAQA 1J9TA 4L6RA 3WNJA 2IDUA 3NJLA 3FQ2A 5I6PA 1AZCA 1KBVA 2VM4A 3U25A 1XB3A 1UAZA 3QBIA 3PPSA 2AZAA 1H2SA 3CVDA 4GPOA 4FBZA 1HFUA 3IN0A 3X1GA 2N0MA 5I6MA 1GYCA 1NIBA 4YSOA 1Q5JA 3PAZA 3TBBA 5D4JA 5ITEA 4AX3A 4BEYA 3X1NA 5G53A 3EH4B 4A66A 2UX7A 1NTDA 1BXVA 4DP4X 3HEIB 3T71A 3VG9A 1E0PA 1CUOA 1CWQA 4Y9HA 5H2KA 5LWEA 3CG8A 3WIAA 2J5WA 1E12A 1FWXA 4TL3A 1AS6A 1KDJA 3NJMA 3OE9A 2I20A 2XYBA 5F7BA 4G72B 2YXVA 2G87A 1PNDA 2GSMB 2F93A 4GRVA 4OV0A 1S52A 1M9WA 2BP0B 1JZJA 3FYEB 1IXFA 4GP4B 4WW3A 2CAKA 3OMIB 4ZK8A 1GUEA 2W88A 1KDIA 2YXWA 3QBKA 2UXFA 3AG3B 1IC0A 1DZ0A 5I6OA 1PZAA 5JJEA 4NERA 2YDVA 3HAPA 1C8RA 1MZYA 1PY0A 1WA2X 2CBPA 2TSAA 2YQBA 3ASOB 1YLBB 3T9WA 1CC3A 3QJRB 1S53A 1UCQA 1IKOP 2QDVA 4NB7A 3VHZA 2X87A 2GB2A 3V9EA 5B2NA 4DPAX 1EHKB 3A7KA 2LNLA 2ZFEA 4XTOA 4A2EA 1JZGA 3QQXA 4F7KA 2Q5BA 3CVBA 1UATA 4W1TA 1GS7A 4MD2A 3WG7B 4KNSA 2PLTA 3QBLA 3H56A 5TK2A 3IBOA 2HRGA 4EIYA 2HZHA 2BP0A 4X31A 1W6WA 3GYRA 2FQDA 2PPAA 1L0MA 2VM3A 1OCRB 2BHFA 4KO7A 3H4HA 3CODA 6PCYA 2L6XA 1TN5A 3AYMA 3NJGA 1JXGA 1TEFA 4WKXA 4JQ6A 1PAZA 2R4RA 5BR5A 1CYXA 1QKPA 4EF3A 5ANHA 4YSRA 3UTWA 3FPXA 3NSYA 3QDCA 3AW5A 4KNUA 1AG6A 1ZDSA 1M0KA 5I28A 3X1EA 1JERA 4CSPA 3P0GA 1BRRA 3VW7A 2BW4A 5I5IA 2GHZA 2A3TA 4AKOA 4UANA 1NINA 2AT9A 1E30A 5D4IA 3IEAA 4HALA 2JXMA 1AANA 5AFAA 2EINB 2IDQA 1WA1X 2IWFA 5B1BB 3D4SA 2QDWA 5FC9A 3OQRA 1HAUA 4KLYA 2BZ7A 2XV0A 4WTQA 1A4CA 1GY2A 4BDVB 3QJTB 1QHQA 4GYBA 5AKRA 1ASOA 1ZDQA 2ZWNA 3WI9A 5B7FA 5B0WA 5G2CA 1SFDA 4JR8A 4FAAB 5DYSA 5B1KA 4G70B 3MBWB 3N2JA 2YCXA 4QIDA 4G71B 2FQFA 3C9LA 2EIMB 1AT9A 1J5CA 2Y02A 2JAGA 2LLNA 4BXVA 1F50A 2WO2B 4E9WA 2X72A 1O0AA 4KNFA 1WA0X 5B1JC 2Y01A 4A2HA 3X1FA 2I1XA 1QLEB 2VMJA 4G7SB 1F56A 2BWIA 3CDZB 3HB3B 2DYSB 1S54A 3JTBA 1M57B 2CCWA 5G54A 5I6NA 1JVOA 5G36A 5ETZA 3NP3A 3ZIYA 5B7MA 2H3XC 5TK4A 2M3GA 2YAMA 4DP9X 2VN3A 3G5WA 1JXFA 3ODUA 1N68A 2GI0A 5B6YA 1SF3A 3V2YA 3NSCA 9PCYA 6PAZA 1NIFA 2J4YA 4BUOA 3KW7A 3X3CA 1GR7A 3BQVA 3UADA 4L0PB 5B3SB 4EA3A 1KBWA 4IARA 1C3WA 1MZZA 1Q5IA 4MFHA 2EIJB 2IDTA 1L9QA 3VGAA 4YVUA 2I85A 2H47C 1EZLA 5H2IA 3OE8A 1ZIBA 4A2DA 4EJ4A 3UTVA 2DWTA 4MQTA 5DHHA 1ILUA 2B08A 1JV6A 2P80A 2RACA 3NJHA 1SDDB 2PCYA 2XXFA 4BWTA 1I53A 1PLBA 2MTAA 3QPKA 4GXFA 2FNWA 3OE6A 5TGZA 1F88A 1CYWA 1KV7A 1V55B 3FU7A 1RCYA 3S8GB 5G28A 2Y04A 4JHVA 1OCOB 3S8FB 1BRXA 4GYCA 2XU9A 3ASNB 4HZ1A 1JZHA 1PNCA 4N8UA 3FYIB 4XXJA 4A2GA 1BQRA 1RZQA 2HRHA 4DP2X 2I7OA 1A8ZA 2JKWA 8PAZA 2YCWA 4XT3A 3EH5B 1AP9A 4E9QA 3UTYA 3COCA 5G2DA 4CSZA 2XLLA 2Y00A 1S8LA 4IB4A 5B6WA 1C8SA 4UG2A 1N70A 2KSYA 4KO5A 3WNIA 3HASA 3SBPA 5B35A 2DWSA 2HX8A 2BZCA 5AWZA 3FU8A 2BO0A 2OCCB 4XTNA 1PZBA 5B6XA 2PPEA 2BP8B 3NP4A 4RH4A 2WJLA 4DP7X 3PDSA 1X9RA 3NJKA 1MGYA 5KKHA 1IW9A 3PBLA 1W6LA 1NIEA 1XMEB 2WO3B 3ERXA 3T6XA 1P8IA 1ETJA 2IH8A 1PXSA 1AS8A 5H2NA 4YSCA 1W8EA 1A4BA 1AIZA 2ZZLA 3NYKA 4YSPA 3S3CB 1L9OA 2PP9A 1SHXA
chains in the Genus database with same CATH superfamily
4JG1H 4LPWA 3F83A 5C9JA 1YDPA 1TVBA 1PD6A 3QEQD 3IDMA 4KROC 3WE6A 1CE1L 4XCYA 1MCIA 1WTLA 4C47A 4EJ1C 4X99A 2P46B 4NUGL 5SV3A 3ZTNH 3GSUB 1GZMA 3GMOA 1E4KA 3DIFB 4LRIC 1FL3B 1DFXA 1G94A 3DGCR 4JKVA 5BS0B 4HFWB 4CADA 5IWLA 5KAQF 3MVSA 3RZEA 3RDJA 4NQED 1TQBB 1QLEL 4Z76A 2CU9A 1M1XB 3QZNA 4U1NA 4IS6B 2PWEA 5EOCH 3IB4A 3HS0B 3MXWH 3KDMB 1X0K1 3UTQB 3GS7A 3SYPA 1I85A 5SX4H 4K71C 4RMRA 1ZE3C 4ZD3L 1E6OH 3CBKB 2XBTA 5D7SH 3UZCA 4PCTA 5I74C 5F6HI 3QUXC 2HTKC 5DUJA 4AMJA 1WT5A 3NN8A 5L2JA 2H1LM 4R2GC 4ABWA 4OCLC 3UG5A 3MA7A 2DM3A 3HPLA 4FKKA 1MAML 4CNIA 3MBXL 3FT4A 2BIIA 4G5AA 1KTLA 5GGRB 3G5XB 4ZTOL 3FL7A 5FUOL 4YQXL 3TV3H 1NBQA 4PJHF 4LDEB 2V2TB 1ZEAL 2AERT 2C7UB 5C0EB 1KCRH 4LLQB 4XWGH 5IY5B 4Y19A 3KM1A 5DQDH 5KVDE 2PCPA 2VXVH 1MREH 3EHBB 2Q0ZX 1RERA 1T4WA 1A5FL 5C07B 1VZHA 3W57A 4ZOCA 4RX4D 2FT8A 4F91B 1CLVA 3N44B 4LE8A 3NCJH 1AQ8A 2ZJSL 4LASH 1SVBA 4ZFGL 3GC3A 3DVNA 2J43A 1S9XA 5F8QC 2WTRB 4ANXA 2XBDA 1D5IL 4PG9B 1IC4L 3GKWL 2WJKA 1W0WB 3GUFA 1AXSA 4HD5A 4G42A 3V6FB 4PJ8C 4U1LB 1F3RB 1O7DE 1Z6JT 5BUPA 4KROB 1MFVA 1EVTC 1UWGH 3EO1B 4FMFA 3QGVA 4LCWD 3SOTA 4EUPB 4PSPA 4Y9EA 1E6JL 1KZQA 4MYWB 2R69A 4RNRA 1KJMA 4QRRE 3N6YA 1HOEA 4FEIA 5EA0L 2W9DH 4X5WB 3OL2A 1ZK5A 5AZDA 4G1MA 3GRGA 1FGNL 3QYNA 5A8EA 4MA3B 3V4UL 4FFTA 2QPSA 3NSFA 2PP7A 2BVQA 3FUJA 2Y06L 2XX0A 3O3EB 4OY9A 1UADC 5FYLE 5HY9A 3GUTA 2K4AA 3GMPB 2CIIA 3PREA 3QJFA 5LAXA 1U8HA 3UO1H 1EJFA 4HS6B 4K71B 3ZUNC 2VR5A 1LTXA 4AZUA 4G6MH 1Z3GH 3I74A 5DD1H 3T6VA 5F7UA 3FTGB 4PV9A 4YL4A 5TF0A 5I74B 3ARBC 1EJOH 1I9RH 3HUJE 1J0YA 3QUXB 4BSWB 4GG6A 3BEVA 3LN4A 1ESOA 5IESH 2OCFD 4R2GB 3U7AA 4IBUA 1JWUB 3RWCB 2CH8A 4GW5A 1UB5A 2OL3A 3SBRA 3MHZA 4PJXB 2AGJL 1VGOA 3UAJC 3MGTB 2ICWJ 3CK0L 3QARA 1TQVA 2XOTA 5DMGD 2DQIL 5KANG 5IROA 3MBVA 3WFEL 1UD8A 4KMQA 3FFCE 3S96B 2HRLA 5IB3A 4AEIL 4RA0C 4XVJL 4UAHA 3VFTA 3M8OH 1DE4B 4RAVA 2F95A 2YKLH 5AZ2H 5BZDB 4WIQA 5LXGL 1CBVH 4TSAL 2AJZB 4ODXA 4ZDHB 5J3HC 3OAXA 1YJDC 1KTBA 3BP4B 2Y03A 1RZIA 2BP8A 3NIDB 1ANUA 3KZ8A 2VSKB 5DD3L 3HANA 4PRIA 4I2XB 4JZNA 3D48R 4XVSH 2CKBA 4FZ8H 2ZCKL 4HIIB 1KGBA 4KTEL 5HBBA 2UZYA 4TUUA 4PJ8B 5I2IB 3QJQB 4UT7L 3EDFA 1KN2L 4AVHA 4JFOB 3VFRA 3HRPA 4EN3C 1CZ8L 1DANT 1KNOA 3FO2B 1AD9B 1ZVYA 3TF7C 3I6KA 4YHPA 5D7IE 5B34A 4RRPG 3SIKA 5DK0A 3CMGA 3F2LA 2UXTA 4LCUB 2VLJA 2WXLA 3CFDB 3ZBMA 3VFSA 3A23A 3OLDA 2IWKA 3FUDA 4U1JB 4GAGL 2FSEA 3OAZH 5IOPA 1A25A 3B3IA 3HKZA 1ZA6B 2PXYD 1NFIA 1BZ7A 3B2DC 2Z92A 4KAQH 1KB5B 3BXNB 4F7CB 4DAJA 4WWKA 1B9KA 5JHAA 3APMA 5DMKB 5SWQB 1A3LL 3MR9A 4WJ5B 2A9AA 2Z7UA 3BDBA 1I1YA 3OKEA 5IOKA 1HH9B 3ARBB 3PNWA 4TSCH 2TSBA 2X70A 3L4YA 3V9FA 3ZZ1A 2LU7A 2X5PA 3PHOA 3PLYA 5GRYA 4NRZA 3WFDH 5I8EA 1DBAH 2DWYA 4GY4A 4EO5A 3ETBF 2EQDA 4X0NA 1QKOA 1LO0L 1USZA 1XCTB 2NY5C 3Q13A 4NZUH 2B59A 4PGDA 4X6BB 5DR5L 3V5DA 5JNYB 1I3VA 3KYOB 4NQCD 1NGXA 3ZE1E 1XV8A 3DX8B 3N1GC 4PXKA 3L3OA 2CALA 4TNWK 1KGXA 1G9MH 3S5LG 4W9ZA 1BA9A 4TTGA 4MD5B 4ZMOA 1LN6A 4G6KH 1FBIH 5LHDA 2DM2A 4ZAKD 5I1HL 2MIZA 5IM7A 1KCLA 3DTUB 1F4XH 3RFZA 4UIKL 4AQ8A 4G8GE 1AXIB 4XRCA 4N1HB 4OGQC 4WK0B 4X5XA 2M26A 4FFWC 1RQ5A 4ODUB 2Z4QA 3WLBA 3JWNH 3MRGA 2H45A 4MA7L 1FC2D 3EJRA 3WMQA 3O2VL 4FQHB 2BSEA 3T1WA 1EEQA 5KSAA 4AH2B 3JTTA 3QBIA 1LEIB 4FHKA 1QA9B 3GIVA 1WGOA 5C92A 1AKJD 2EE0A 2MHAA 3TN0A 1NIBA 4CW1B 4DEPC 1KFGA 5CJBA 1MCRA 2VQ4A 4BEYA 4PGEB 4S1DD 2X40A 4P3DA 5D7JC 5C0GA 5TQ0L 3F12B 3CPUA 1M05B 3EGXB 4B27A 1NDGA 4NNXA 4JQXA 4F8PA 2J5WA 4G59C 1D6VL 4BK4A 4IDJH 4D0BA 5JXAH 5F7BA 2EEXA 5TE7L 1A4JB 1VEPA 1M7IB 2UYLB 2XWJB 2GTZA 2ZWZA 5EUKA 3RTQC 25C8H 3M88A 5ITBH 1A47A 1CYGA 1NCAL 4GUPB 3ZGHA 2NY1D 1FJ1A 3EDEA 1HQ4B 5ES4B 2JMRA 1UZ6E 5IR1A 1CC3A 1UM6H 4TLSA 3IFLH 2HN7A 3ETTA 4BFFA 3MRNB 3AVEA 1UEMA 2KZ1B 1Z66A 3PFUA 3PIQA 4N9OB 3RWIA 3V10A 1JXJA 1OTTC 2LNLA 1S7QA 2IJ0C 4OBSA 1AY1H 1E3ZA 1UATA 4HWEL 4EVNB 4DQOH 2J4WL 2JJTA 3CDCA 2PLTA 3LHAA 2FJHB 3KR3L 2K4WA 3BAXA 1JPSH 1RUKL 5E2WL 4ETQB 2HG0A 3RLSA 2FQDA 1WWAX 1AFVH 2YGOA 1DQVA 1TR7A 3H4HA 2OSWA 2OR9L 4WUUA 2VRQA 2DQGH 1E4XL 1ZS8A 4MXQD 4NQXA 1Q9OB 2KQMA 3BVNA 1NFKA 1FO0L 2Y36L 4YSRA 3FPXA 5T1KA 3QK0A 3VG0H 3LTVA 3AY4C 2Y1ZA 4OF0A 4O02L 4QRAA 2GHZA 3NESA 3ZL4L 3BGAA 1M7DA 4I0CC 2JXMA 1SYVB 1JG9A 3UZEA 2XHNA 4AENA 2OK0L 2UY6B 2PR4H 5AFAA 5F97E 4XPHL 3LH9A 1NGQH 5EZIL 4JZJA 4XMLL 2XZAL 4CVXA 3QJTB 1LO4L 3U2IA 5D7HA 2WXMA 4FQXD 3NFNB 1Y1DA 3GEFA 4IMLB 4BE6A 4B3EA 5F70A 1CJYA 4B41A 2YRBA 2F9BT 1ZHBA 4JPWH 5EFIA 1F50A 2GTWA 3LAFA 2XKNA 1F8TH 2WQUA 3QO0B 2Y24A 2VMJA 1P84J 3KBPA 4XN9A 4AM0Q 5JYMA 1HNGA 5SWZA 1WP6A 2NZ1A 1WWWX 3OX8A 1SLUA 5SWSA 3ZY7A 1WEJH 2BS8A 5JIHA 5FYKD 1HINL 3JWNE 1SF3A 5EBWB 1H15B 3RTQB 4QRSA 3N91A 4PB0H 4AUYA 4NN7C 3MRQB 2KI6A 5IJCC 1JL8A 2R59A 5KYNA 1G1OA 1T0MB 2P7TB 5LG1A 4RGND 4FEMA 2ADGB 2ATKA 4DN3H 5CU5A 2EYRA 3VRLE 2IAMA 4L2YA 4A2DA 3VGFA 2DWTA 1KIQA 3O4LE 3TH3T 3VFOA 3U0TB 2YQ3A 4BWTA 1J1PL 2Z4TA 4J2QA 1K3IA 4UYPA 4UU9A 5TGZA 4JQVA 2EDYA 4WDIB 3TCTA 4P06A 3INOA 2EO9A 4JHVA 4XVTL 5HI5C 3LMJL 2ZF9A 2GABA 4B7LA 4KKAD 3B9AA 5EU7E 2NR6D 2EYSA 2G0KA 1BYNA 3MRRA 4M5ZH 2MSPA 3LV3B 1MJUH 1MFBH 3BLBA 3HC3L 2FH8A 3ML8A 4K7PH 4NKMB 1RJCA 1RZQA 2GITB 4IOIB 3K7UA 5F7YC 2I7OA 5B3NA 3S88L 1P7KB 4IRZH 1T5XA 1J87A 3QQ4A 3ZDZB 4YGAB 3MJGX 3PWNB 5B6WA 1N70A 3T8MA 1I9EA 3BSHA 3D0LA 4FFYL 2I25N 2BVPB 3IMTA 3V4PL 5AAWA 2J25A 1S9VA 5ADOL 4NI6A 1M4KA 4CC0A 5AWZA 4EUPG 3QG6B 1DJZA 5K1VA 2ALAA 1MRDL 2ZXQA 1QSEB 2IAND 1W6LA 1IW9A 1XGRB 2P43B 3HNTL 5HPOA 5JORB 1PKQE 4WI9A 3SKJH 2PW1B 5AYTA 1DCEA 3WFBL 1HOCB 1W8EA 4LPTA 1FYTA 2J20A 3O2DL 3SDDD 2F1AA 4XC1H 3WCYA 2C3XA 3S3DB 1JOIA 1N64H 4POZC 4ESKA 5FKAA 4P2RE 1KIUA 1AGEB 4G9FD 4PJBE 4HKZA 4IMKC 1I3GL 2V2XB 2VSDA 1JPFA 4E41A 4B9KC 1AO7A 3P9WB 4HHGA 1EGJA 4WNQA 2DKUA 3B37A 1DYZA 1XHHA 2QPEB 3VCLB 4APQA 4Q97A 1RI8A 5I1CH 1IC5L 4NN7B 3T5WA 1WIOA 5BZWA 2QFPA 1KCWA 3EGSA 4D8PA 1FE8L 1QVOA 5DI8B 4S0SD 4U1KB 4ODVL 4A39A 4HWBL 1IMHC 1ZLWK 4WHYG 4DP6X 1S7RA 4ZFOB 5E00B 3B2VL 3ABGA 5AOZA 1ES0A 4UM9A 1F58H 1ETZB 4N6HA 2QSCL 4JFSA 3T0BA 2VAAB 2VO8A 4BINA 1NFDF 3IDNB 5H2JA 1W8NA 1X0I1 1M1SA 5I8KL 3VD9A 3EYQC 1P4LA 1TF4A 3L3GA 2O61A 2OX5B 2J21A 3HMXL 1OANA 2GEQA 1U6AH 1V3MA 3DVFA 2MOVA 3MO1B 3QFJA 3SCMA 3FTUA 4YFLF 2ADIB 3QWNA 4GKOA 3UOAB 4PJAF 4LRNL 4B9PA 2NY2C 1UT2A 1HL9A 4XO5A 1RURH 2P8LA 2OMBA 1X5HA 3H9SA 3HI6L 5KVEL 4Z7UA 2E86A 2VR7A 5CIPA 5JDSB 1ZGLM 5ALBH 4UUJA 3LH8A 5ID0B 4ZYKB 4FF9A 5HHNA 2WNGA 4PJ6A 1J8HB 1XH2A 3F7PC 2VDRB 2XN9A 4PJIE 5E2VH 2NRDA 2APBA 3LRSB 1MEXH 4HUVB 5EO0B 4BDVA 2OR7A 4O58H 3LQZB 1CU4L 2BXYA 1H3TA 4UOZA 4LSUH 2DBLL 3V6ZA 1ADQA 2VKWA 1D2PA 4PJGE 1E2ZA 1NH6A 4TTDC 4OLUL 3VXUE 2R4SA 4PRPE 1I8MA 4FOMA 4DZ8A 3K0YA 1CLCA 1ZT7B 1SJHA 1U8IA 1U33A 3PWPD 5ESVB 3RILA 4EZJA 2JKXA 4H8HA 1MCSA 1J88A 3Q1SH 2FNBA 3FOLB 2DWDB 1MXDA 1RJYB 2F8OA 4J3OC 4P5TD 4OLXH 4RIRB 1WHPA 1OQOA 2WLIA 5I73C 2B7DT 4ZTEA 1MFAH 5CINL 3RWEB 4HEME 3UG9A 3ARFC 5GISH 2WKGA 3KJ6H 5DO2D 5C1MA 2WXOA 1LMKA 1UWFA 3TZVA 2OSXA 2LLGA 2HJLA 3C5JA 3QRBA 4FA6A 3A6CL 5INCB 2QPDB 3EJCA 3FONB 2NX5D 4AGPA 1UUNA 4N90E 1NC2A 3LS5L 4NHUB 5A2LH 3MJ6A 4PJDA 1WK0A 3CSYA 1L0QA 3P73A 3R0NA 4M8QA 4TMPA 4XPAH 5EU6A 2YN3A 4GRWB 3ZDXF 4LNRA 4F9PC 3ULUE 1Z9NA 4HCRA 4YOKA 5IBLD 5LNGA 5CSBA 3GBDA 3NCCB 4GO9A 5GS0C 5DS2A 3KDPB 4BVNA 3REWB 5E9DB 4H44C 4Y1SA 2ICES 2NY2B 3CVHA 2AQ3A 4IBVA 4HA1A 3CFUA 5C6TL 1QSFB 4OD2A 4X98B 1ITCA 5HDBE 1SMOA 1QLFA 4HX1B 2DQUL 3G9AB 1FZOA 4NX0A 4P46B 1EMTH 1ADWA 2AFNA 5FYLD 1Q72L 1KLGA 4JKNA 4B6ZA 1JYWA 2WLLA 3L5WB 3SDXA 4NKDA 1OP3K 5IFHL 5JR1H 1I8KB 4JG9A 5DJZB 3FH8A 2ZSVA 1L0XA 3DJ9A 4PRBB 3WTXA 2YSSB 4LNVA 3M46A 3V5HB 1QABA 4P3CH 1PYWB 4A2FA 1UG9A 1YHPA 4NIKB 1A6AB 4KI5D 4QGTA 1IUZA 1GY1A 2FUTA 2HVBA 3FK3A 4UQ2B 5A45A 1G9EA 3GI8H 1UWEL 3DRTA 3JTSA 3DOIA 1SM3H 3OC5A 5EN2A 2K9FB 4ZPTB 3QFDA 1CCZA 1DBML 1DQQB 1DL7H 1NWPA 3DBSA 1OTSC 3N41B 4JFZH 3TO4A 1FFPB 3BT0A 3FO0H 2FWSA 3PXJA 3LCYA 4KGLA 4KU1A 4ZUUB 4HIHB 4YEFA 5JW3H 3D25A 2YPVH 2Y07L 3E2HC 3FFCD 5HJ3B 1GGUA 4JO8A 4YNYB 3PWUB 5BRQA 5F7AA 3QCVH 5DHYA 1G9NC 3Q8BA 4RMTA 2A9DA 4QXVA 1QWNA 4TXVB 3ARFB 4KBPA 4OZFB 3S36X 3UP1A 1GOHA 3GTNA 4PJ7B 1LE9B 1CI5A 2EUXA 1WCBA 1UD3A 4PG2C 4B9YA 2E7MA 5FO2A 4L18A 3RNQB 3VGEA 5AX0A 1LDSA 4HPHA 4AV0A 2VISA 5K39B 5IW1A 3D09A 1IM3D 4GG8B 4F8NA 1LK2B 4HIXL 4RDQG 1MG3C 1IGIL 4PR5A 5E8OB 3UJTL 4LMQE 2RH1A 5B3JF 3NCBB 2C9RA 5DTFA 2E27L 3MRIB 1T83C 2FWUA 5AVQB 2F8VA 1S5HA 4LLAA 5CKGA 1FIGL 1UM4L 3FTSA 1R0AH 1U8LA 3K4DA 3DHMA 3GT6A 2C4XA 3EF4A 4M43L 1WSST 2V3DA 3B7UX 3N0AA 5I8OH 3NQIA 3EUDA 1KXTA 4HK0A 2AKRA 4PGZA 1CXFA 1TFHA 3CZGA 3OM3B 2WSDA 1QNIA 4A7GF 4IBQA 4AM0A 4M5TA 1NGWA 1EEYA 1FGVL 4Z95H 2KSAA 2YMTA 4IRJD 3WUWB 1CXKA 1J1XH 4HT1L 1F3DJ 3P30H 5SX5K 1KENH 3V6OC 1KWGA 5EWIH 2RCSH 4LEXH 1YSOA 4LFHD 5B8CA 2XZQH 2PR9A 4JKPH 4N0RA 5L7XL 1OCWL 1IAOB 4UNTA 4JQIL 3WDJA 2DI8A 1A7OL 4UMGA 1YVLA 4GI8A 2AQNA 3LS4H 2DEYX 3BMWA 1GAFH 5GZOA 4L4VA 4FNRA 5DMGC 1AR2A 5JOFA 1H2SA 4MZ2A 3TEXA 1NFAA 3H6JA 3DUSB 2YK1H 1GYCA 4YO0B 2JB6B 5LBVA 1JWSB 3TVMC 3E2HB 3WD5H 4NCDA 5G53A 2IPTL 4OGYL 3G6DL 2UX7A 2VXQH 3MJ9A 5D1ZI 1CUOA 1NOLA 2VDPH 2PO6D 3BVUA 3WIHL 3NJMA 4N0YH 1U9KA 4PJHA 4Y4KC 3IGFA 3SYOA 4ODHH 2BP0B 5D2LF 1R24A 1T21B 1OARH 2OMTA 1AZVA 4XO8A 1ZJBA 4KH2A 4OF7A 1ACYH 1Z0MA 3T2NL 2UXFA 3FB8B 4QF1B 2OZNA 4FX5A 3IYLW 1TUPA 4LCWB 1YEKH 5F2FA 4K3DL 4B9FA 2FO4A 2AJUH 2X87A 3UX9B 3GSWB 2BNRE 2F74A 1NMAL 5DCCA 1EHKB 5F9DC 2ZFEA 5AVZB 3MV9D 1S5IH 3RPKA 3HI1A 2APSA 4IOSD 1AQKH 3KPOB 4R7NA 4AV5A 3WG7B 4H7VA 3IDGA 1KPRB 1OGAB 3BDXA 5T1DL 4FQIL 5TH2A 4G43B 5I15L 4F9LC 4WVRA 3RURA 1MCCA 5LBSL 2HRGA 2HZHA 4U6XB 1S8DA 1NM4A 3MUJA 1U4EA 2BHFA 4XCNB 4HUCA 3ATEA 1BFOA 1J18A 2G3NA 1Z9OA 2WB7A 3P3RA 4WFFE 3T65B 3CSPA 3ZHNA 3TEWA 3THMH 1W0YT 1S46A 3QHZL 2VUKA 2A4ZA 5A2CA 1S9WA 2VTFA 1FN4A 4M56A 3IFNL 3V7MA 5DHVA 4IKKA 1RU9L 1M0KA 4FI7A 3FN3A 3MLXL 2RGSA 4MCZA 3GMMB 3PP4L 3MTRA 1R17A 1E4WH 4NT6B 4RLDA 1NLDL 2EINB 2EKJA 4GAYA 5FC9A 1BEYH 3UEQA 2BVYA 1TETH 2XV0A 1QNZH 1G7HA 5IUSA 1ZSDA 3CLEH 3L1GA 5ILTH 2DLFL 4GW1A 1RUPH 4U3XA 1L7IL 4JR8A 1ZHLB 5B1KA 5ICYB 3TVMB 2CO6B 5F1OB 2EZ0C 1AHWA 3IGUA 2FBJH 1F2XK 4OCSH 3ZHFA 5J9PB 2I1XA 1NAMA 1XZ0A 4ZAKC 1S54A 1CWVA 3LEXB 3UG4A 4CN1A 5HI3D 4Y4KB 3LY6A 1NCWH 3VFNA 2GY5A 3VB9A 2M3GA 1HHHB 1S3RA 2YAMA 4PJCF 5IMKA 5CU9A 3FB7B 4XMKL 3S5LA 5KYXB 5GS2H 3RAJH 4GRWF 2QSTA 1W72B 4CDGC 4KKRA 5F44A 3L2NA 2W59A 3GTTA 1FLRL 3AQXA 4AQEA 2V3FA 4M7LT 3ECBB 1TJGH 2P5WA 1BVKB 2MMXA 3TJEH 2CDFB 3ISYA 2OFQA 2D9QB 2NYZA 2APFA 1U3HC 3FN0L 3IS0X 5H2IA 1RVFH 3DTXA 4KHTL 1N59B 1Q8MA 3PY9A 5J1SC 4NQSA 3ZQXA 1A1NB 1XO8A 3ETBJ 2Y0SA 1AGBB 2FNWA 3GB7B 3TCLA 2XA3A 3R19A 2FX7L 1CYWA 1BAGA 3HCVB 4HPOL 4X5PA 1MLBB 3TH4T 4NGHL 1IZJA 3FOMA 1X3DA 4L23A 4ZUWA 5AVXB 3N50A 2Y2TA 4GYCA 5SX4I 4JFDA 2AV1A 4L29B 4LSPH 5DFTA 4HEPG 1DSFH 5DUBB 3NCYP 2OSLB 5JXED 2HRHA 1T3FA 1WC7B 2NY1C 1YPZF 1T2JA 3CX5J 4C56D 3DPBB 4DOHE 2A74A 4W4OC 1U92A 4OCXL 3MRMA 1HCYA 2YQ2A 1OGTA 1N2RB 1MN4A 2C3VA 4OSUH 2QZQA 1NBZA 3NZ8A 4HXAH 4NQCB 4NKOB 5BUGA 2Z7YA 2I69A 4XP1H 4YSCA 2FL5A 3EADA 1NKGA 3FQUB 4F7EA 3FCSB 2YD2A 4MNHA 1EAOA 2R69H 4H25B 1N5YL 4XB7A 3MKKA 2B39A 2DF3A 4Y2OB 3ARED 4ZAKB 4DESA 1YEHH 2DOCA 4ZX4A 1T1YA 3HZVA 4J12A 3AABA 1YN6A 3D0VB 4ZO8A 3SZKC 3HAQA 3SBQA 1Q9KB 1T1ZB 3DURB 4Z78B 2YS4A 3IKCB 1XH3B 1XF2B 1IKFH 1HZHH 4JHUA 3MCLH 4CVZB 4JM2F 4ZUSA 3FQNA 2AK4D 2Z31C 3TFKD 3QO1A 1R3IL 2I21A 1AE6H 4JO1L 4MXVF 2QGDA 2N56A 1AKJB 4YDIH 5GGVH 1BPVA 1U3HB 4J6RL 3VXTB 3B34A 1WBXA 3EZJB 2KS0A 3M1CA 3BEWB 3EJJX 3ZE2F 1IAIM 4JRXA 3RL1B 3OHMB 2X28A 5E95B 3VWKD 2VDOL 1BQ5A 3KPSA 1E0OB 3LQAL 4QAMB 2WGXA 1G1KA 3DIFA 4JPKH 4P2RD 4YWGH 3NFSH 4DHLA 5I6KA 3REYA 1EVUA 1IBHA 3GM0A 3AJ7A 1RLBA 2E7LC 2VAJA 1I8AA 4FXLA 2WZPD 1TZGH 2C3GA 3L5XH 2W8CA 4IS6A 4I4WA 5DUPH 2NY1B 4KMTL 1HSBA 1E27B 3HS0A 5K93A 2YBGA 3FT0A 1SN2A 3EH3B 4HLEA 5IJKA 3B1TA 4RGNC 4QLWA 3Q6FB 4KZEH 3A5VA 3U6XS 3QJUB 2P8MA 5T33L 1OO2A 3FO1B 5KW9L 4PRNA 1HZLA 5IQ7H 3ECWA 4JGJA 2BZDA 3UERA 5FYJH 3WEAA 2VWEE 4J3UA 4AYID 5FEBA 2FQGA 3WE1A 1K6QL 2COVD 2X0WA 1L0PA 5HGAB 1AGDA 1J8SA 5EDSA 1HYSD 4OBRA 4J3OG 1DVXA 3RNKA 5T1LA 4GSRA 2JTDA 3TX4A 2V7HA 1RPQA 4PWEA 2V2TA 5DVLA 1TMCB 3V52H 3H7BB 2NR6C 1PFCA 2CMRL 2K70A 2YIHA 4LLQA 4PS4H 4X6DE 3LN5B 5ETUB 3OKMB 3RQ3A 3AM6A 1P7QA 4OZFG 4EBQL 5I1LB 2BVEA 1WDAA 2CUAA 4MZ3A 2CBQA 3RWJB 1KEMH 3VRIA 2EIKB 4JY4B 3PU7A 4XH2B 2NCEA 3GIZH 4FDWA 1ZTMA 3JUYA 3FQWA 4FULA 3TYGL 4WAVA 3BGFC 4QTIH 1E4HA 2Z31B 4LCYB 1CPUA 3VH8A 3ZKXC 1J5IA 1X5IA 4XX1E 4UNIA 5I30L 3BI9X 3WLWC 4OKVA 3UTXA 3DK0A 4FP8H 3RWGB 1JDAA 1FBBA 3V6FA 4L9LA 2XICA 2ZOLA 3K2MC 2GCYA 5ACZA 1G7QB 2VDQL 3BO8B 5GRJL 4NUGH 2EVHA 4EUPA 2F53D 1GS6X 3K6FA 4EOWL 3V5KA 3D2UD 4H8WC 1OSPH 1URIA 2F5BL 1CDYA 4PJEB 4UTAA 1URLA 4YDMA 5AW4B 3RUGF 3VUAA 1ZVHA 1IAIL 3WGVB 4BZ1H 3WUWG 4PRDB 1IKNC 5KBDA 4DUXA 2MCPL 2N7BA 2V9RA 2XDHA 2Y3NA 3KPNB 5CUSH 3GMPA 5JUEH 1L9PA 2H8PA 5JHDE 4ZD3H 3DO4A 4RGNB 3VI0A 1BX2B 1ET5A 2IOIA 1WD9A 4B9IA 2F15A 1MW0A 3ULVF 1VZGA 1OF0A 2YLHA 4KQ0A 3KCWA 3PAUA 4CU6A 4XGZB 3U79A 4WU7B 4MBOA 3ZQWA 2Q86A 4ZMLA 2GI7A 1Y6MR 2XA8H 4NCC2 3O8XD 3NJIA 4ZTOH 2AJSH 3OB0K 2B4CL 1WFUA 4IRSD 4LCIH 4N2NA 1CFSB 3MGTA 2WKLA 3HHMA 3UC0L 1LD9B 2YKKA 3CHQA 5AW6B 2WXFA 2AXJA 3CN4A 5KVFH 3VXNA 1MCKA 3ENEA 4Z0BL 3V7AG 4IK6A 3EJTA 1Z5LA 1MHEB 4XZ4A 3DOSB 5MENB 3P9LB 2ZJSH 2W81C 3VXQB 4LSTL 3FT2B 1PFOA 3RFMA 4Q6IC 5H2HA 4ZDHA 3BGFB 2X3CA 3BD4A 1XGYH 3BP4A 2VLLA 1KTJA 4PD4J 1HXYB 4TKWA 5F7DA 3GKWH 4NC3A 2DJ4A 2CGYA 4ZO6A 2W65B 5FYJE 3ZKXB 2IANB 3DETD 3N40P 2UZIL 1WFNA 4G5ZL 4C4KO 4HIIA 3EUUA 1P8UA 5H2LA 4PJ8A 5BO1L 1AQHA 1MJJB 3DO7B 1CD1B 1IBYA 2OL3L 4RDBA 1E50A 4JFOA 5M7QA 1NGPL 3UTSE 2YRLA 4R8WL 3VQLA 2Z34A 3SDYL 1T03H 1QTSA 4G9FB 3H7LA 3FO2A 3MV7A 3EJQA 5D5MB 5DEJA 3MNZB 4UT6H 3PF2A 3V4UH 1UXLA 3UO8B 2K0RA 4JCLA 4L8DB 1RMFH 4X0KA 1NL0L 2YUVA 3CFDA 2Y06H 4I18A 1R5IA 1MG2C 3D12B 4UTCA 4BGLA 1QRKA 1KGYE 2AK1L 1D5ZA 3FQRB 1HWGB 5ALCL 4YDKH 1UWXK 2E4FA 3B4NA 3EXLA 4PS8A 2R0WL 2UWEB 1KB5A 3BXNA 2Z1PA 3H3PH 3UTPD 3B9KD 3T6WA 1XAUA 2EDEA 3X13A 4QJ4B 4GEIA 3U7YH 4MNGB 4FS0A 5DO2C 2NTFA 2EC9U 3T6ZA 1H3GA 4HIPA 3K8MA 2CKBL 2J8UB 1UOKA 5AL8A 1F41A 3WY2A 1KIPB 4LESA 4BZYA 1H8SA 4D94A 5IHHA 4M8RA 2AGJH 2ZUYA 1KTCA 1ZKAA 4FG2A 5EU5A 3QEHB 2XPGA 4Z7VF 3MAWA 2ZXAA 1O7DC 3KPQB 4OJDH 5LG6A 1T80A 1XCTA 1HCVA 2B1OA 4WFED 3D39A 4NQVB 1JN6A 2DLGA 2QQQA 2YOAA 2QVIA 5DJYA 3DX8A 5J6HB 5DSCB 5LXGH 3OLGA 4XZUA 1MSPA 3MCYA 2H0JA 2DKSA 2P42B 7FABL 1G84A 1NFDA 1P4IL 2AJYL 3D9AH 1DVQA 5ERWA 1BWMA 2WXRA 2YJLA 3D87B 4Q6IB 1GPOH 5MEQB 3EH4B 3A4AA 1M2VA 1BJ8A 5CLXA 3HEIB 2XQBL 3P2TA 4Z0XA 4KTEH 3PHAA 2Y7OA 2I20A 4HUNB 4H1LH 4K5NA 2YXVA 4MA8L 1KN2H 4OV0A 3HZMB 4FTDA 4JJHA 3O81A 3TIEB 2H0EA 4KI5C 2GJZA 1X5AA 4M5YL 4XN5A 4X6CE 4EN3A 2YDVA 1C8RA 1LEIA 1QA9A 3OGOE 3WJLA 4OF5A 3VTAA 5D8JH 5G5DB 4GO8A 3CSFA 2X9YA 3QUMH 3VXRE 1UCBL 4X5RA 3MUY1 4JDTH 3STLA 3QQXA 3F12A 3CVBA 3I75A 4NO2A 2F18A 1G6VK 2ISDA 1N0XH 3QHTC 4P5TB 4PLKD 5HP5A 4K3EH 1JGVL 2W07B 5C3IA 2UV3A 4APXB 5ID1B 4B9ZA 2X4PB 4WI3A 4HQQL 4PBDA 3GXDA 5MHSD 1A4JA 2AXGA 1M7IA 5AW5B 1F4AA 3OJVC 2XWJA 3P4MB 3SDCC 1JTOA 4HS8L 1OAQL 3RWFB 3TONA 1FNAA 3ALWA 1T5WB 2XNAA 1CYXA 2NZ9D 4XPBH 2QL1A 1HQ4A 5LBGA 4QXGL 3E7JA 3UTWA 3MRJB 1JS4A 1S7WB 3GXFA 2YRPA 3KM2A 4PGBA 4Q4EA 2ZKHL 2QR0B 4YE4H 1BRRA 3GJFB 3K4ZA 3BWZA 2EDDA 5I5IA 3LXCA 2Q76B 3B83A 4Z6AT 4P59H 1MFCH 4URKA 2HJFB 1VA9A 1AANA 1Y6NR 1KY6A 3HG1D 1CD9B 2FJHA 2C9AA 4HK3J 5CZXC 2PUQT 1CFTB 4WUUE 3WS3B 4QRRB 4OZIE 2ZWNA 5MERA 4WTZA 3OLEA 3BWSA 5AB9A 1D7FA 1P84K 1AT9A 1Q9OA 2QELA 3KLDA 4U3SB 3RPIA 4ALAH 4JGUA 5HGHB 1O0AA 3FFOA 3WSQH 1ODUA 3HLKA 4U6TA 4AQOA 1Y0LA 1FNEA 4P2OC 5E1QA 2YZ8A 3L9RB 4WFFD 2YEQA 4W4NA 3ZIYA 2EDJA 4MA7H 5A1AA 2O93L 1SYVA 4ZXBD 1FFRA 2A9NL 3HUJB 3PWLB 4TNGA 2VLME 4WSJA 2X1XR 1KTRL 1GCYA 4TQIA 2QQKL 4BUOA 5C86A 1FRGL 4IMLA 2CUHA 4EA3A 4I3SL 5JOPE 1C5BL 3KYAA 4OCWH 3HKFA 1H9DA 2L8AA 3BZ4B 4M6NH 4NPJA 5D7JA 4UCFA 3HAEA 5SWSE 3MV11 5IVZB 5GS1C 3FFCB 2D73A 5L2KD 1R19A 3KPMB 5TDNB 1TLKA 2MPVA 1FVCB 5I1EL 1ZTXL 2WANA 4AL8L 5IFAL 1CVRA 4OGXH 2GAZB 1MJ8L 1RCYA 3SDCB 3IDIB 1RHFA 2OMNA 3L1OL 2Y04A 4RZCA 5GIRB 2VLRA 3HFML 4L4JA 1OSYA 4M6AA 1N10A 3CFBA 3ULAB 5I9QC 5I1DA 4PWFA 5KSUA 3RB5A 3ZQ9A 5ESAB 5A6MA 1ZLEA 3KCPB 1IM3B 1DVFD 1KGJA 2JKLA 4FJZA 2AI0H 4OAWB 5E6IC 2YD3A 2NUPB 1AP9A 1KEGL 3ZYIA 1MHCB 5FO9A 2FZ3B 2PABA 2J4WH 4CSTA 4CSZA 5HYSA 1HHKB 3IJHB 3KR3H 3ZT5A 4J5VA 4UZSA 2XZZA 3CLWA 2X4OA 1QEWB 1MQ8A 3NZHH 3QIUD 1WHOA 1E8WA 2DWSA 2HX8A 3U0TA 4C59B 2BO0A 4QAWA 1D7DA 3IETA 5F7LB 4A55A 3U6RB 3NEOA 1X9RA 4ZFFB 2IGFL 5DS8B 4X83A 3M7FB 2LU3A 4NZTH 3ZT6A 1NGYA 4F7MB 5DHXB 5IMMB 3BSZH 3K6DA 3D0AA 1SHXA 4TQHA 1Z9PA 4O02H 2GITA 3MMEB 1TJHL 4KKZA 2MQGA 1I3RB 4P2OB 3NS0A 1J0IA 1TTAA 3HZYB 3OKDA 4GINA 1ID5I 3TLRA 2DJUA 3PWNA 3NMEA 1L9NA 4X7SH 3G6JF 4OFYA 1RULH 2ADJB 2WIIB 5EZIH 2CHZA 4HP5A 4XMLH 4N6QA 1OF2B 5T5FH 3QAPA 2OKMA 4LLVB 4JB9L 5A44A 3UIYA 2QZ5A 2AZUA 2X4SB 1QSEA 1FYTE 4A7GA 1XGRA 4LXFA 2AXFB 3S7GA 1LILA 1JXDA 1YQ2A 1S7UA 4E41E 8FABA 4LMQI 2D7NA 3B6SA 1DZBA 3V4VA 3L5HA 4JY6B 1KPVB 3MGOB 3ZE1B 1AGEA 4XP9H 5GS1B 3BGMA 5MEOA 5DT1H 4FL4C 4RFOH 4Z23A 1LEGB 2J8UF 2WUCL 3VCLA 3QNXB 1OOWA 5HI3C 1TG8A 3QPQD 4OIIL 3EFOA 3M7OA 5I9QB 3C08L 3MCKB 4DK3A 1GKEA 4G8GB 3ZPQA 2C9QA 1CLZH 5DI8A 4MVBD 2VYRE 3KLQA 4U1KA 3K81A 3BZ5A 2PYFA 3CFQA 4XNZC 4Y16A 3ZTJH 5DWPA 4EQ2A 5E00A 2W91A 4AVJA 3OR6B 2XI9A 1J1PH 3MV9B 3KXFA 2PCFB 4V1DE 2KPNA 4L1SA 3MYZA 5BQ7B 3R1GL 4L8BB 5DQJB 2OW6A 3HTLX 5D2LA 5HGDA 4XVTH 3QFJE 5IV2A 3AM8C 2OX5A 4E9SA 5CM1A 1SJMA 3WJMA 3MODH 1EUUA 1QUNB 4Z7UE 4OZHE 2D0HA 1MWAA 2BY3A 2HLAB 1FO0B 4U7MA 5FA3A 1BD2E 1S7SB 3VVKA 1OE1A 3HBZA 4I5BB 3WKML 2W94A 5ICUA 3MJ8B 5JXEC 5HHVL 1TJMA 1IGYA 2Z93A 4F80A 4G7YL 1JP5A 1FH5L 5EC1B 5HDOA 4ANKA 3T2LA 1KJ2A 4XNDA 2HXAA 2X12A 3DIVA 5B6VA 2I5YL 2GT9B 4OFDA 5DJXB 3NAAL 3GXTA 1XIWA 4OM0L 1SFHA 2EH8L 1AQDB 4YIQB 1IL1A 3GPSA 2BCKA 3WXVL 4G6JL 1VKXB 5BPPA 2W0FB 1N8OE 1I3GH 2CR3A 3NH7L 4YBHA 3U7WL 3WMSA 5BVPL 3CFCL 4DKLA 4NNYB 4ZS7L 5J4MA 2V8MA 1FL5B 4FL4B 3D3VA 3MRCB 2QJDA 1G7MB 1SJVA 2K8MA 4Y19D 1KYAA 3H6AA 3AREC 3CVIH 3U1PA 4HGMA 2HT3D 4LP8A 1CGSH 1IC5H 5FK9B 3FOLA 5DURD 3DX7B 5EU7C 4AIZB 5I24A 2ZXDA 4UV7H 3IGAB 2XIBA 3GSRB 1FE8H 4DAGL 3BKJH 4A68A 3ARQA 3HJ0A 2FX9L 3E6FB 2GIMA 1DLHA 3RWEA 3TFKC 5IVXE 1X5MA 3NJFA 1V3JA 4XNZB 3VXPA 5JZ7D 3LHPL 1F2QA 1AZBA 4IKIA 2QSCH 4JFVA 1O0VA 3IDUA 3WFHB 5FOJA 1XJIA 1F4ZA 1J10A 1PEWA 1PQZB 1RK0A 2EIZB 1SXNA 3NY8A 1ADQL 4XBMA 2C7FA 3GBMH 4NHUA 4PJCA 4F24A 4X4YB 2R4SL 3BE1L 1E9PB 4X8XA 3UTOA 3A4EA 3KVPA 5DHEA 3POHA 5IT2L 4JL1A 1JGUL 1WZAA 4UNUA 2ERJC 2G9HB 1CG9B 4XNQA 3WY3A 2AVFA 1SN5A 43CAB 4Z7WE 4KRPC 4LRNH 5EDXA 4ZQKA 2I9TB 5KVEH 3IMRA 2YZ1A 1HEZB 4N3TA 2NY3D 3C2AH 4ONGH 1COBA 4X98A 1NCDL 3DDGA 2XJLA 4ICXA 4MJIA 2IBGA 1P5VB 3JQOB 4AJ0A 3P0VL 4C56B 2DV6A 3QQ3B 5DRWA 3KYKL 4RQQB 4UDUB 3L5WA 3BFOA 4BFBD 4KK6D 2TRYA 2CBOA 1I8KA 5ITCA 2ZIYA 2DBLH 2HFGH 3EOAA 1L9TA 5TGBA 2HYMA 1W80A 2RHEA 5LGHL 1A6AA 2JH2A 4JRFA 5DFAA 3WMPA 1F3DH 3HVNA 3QDMA 1RUQL 1WFIA 1SJEA 3MOAH 4ACPA 5L88H 1HYSC 5G2AA 4P2YA 3PFQA 4HSCX 1YPZA 4HCRL 4DK6A 1SHWA 5IROD 3L6FB 4ZO7A 4HIEA 4MLSA 4EQ3A 5KWYC 1UACL 5BJTB 3AREB 5EO1B 1DQQA 1UCTA 3QBTB 2FHFA 3CVHL 1U42A 1FFPA 2IQAB 3OXRB 3VA2C 4JPIA 4JY5L 1YYLL 4GP5B 2NTUA 3PABB 3WIFA 4YNYA 2X4RB 4XODA 4B53A 3SE9H 1KUMA 2AK4B 4HHWA 5F9AC 4CJ0A 2WVVA 3BKYH 3TT1L 4DO5A 5CBEB 3ARFA 2PPFA 2XY1A 4PRID 3EOTL 4PS3A 5AW7B 1S7TB 3U46A 3A6CH 4N9GB 2L0DA 4ZZKA 5D7IF 3ROOB 4EZKA 3CFMA 2PTTA 5BCAA 4OM1L 1PLGH 5C97A 5I19L 2W1NA 2LU5A 4I48A 5FYJU 3F7VB 5D4HA 1PKQB 5DK2A 4MJ6A 4G7RB 2A6IA 2O4EA 2P5EE 2DTML 4CC1A 4F9PA 4XHJD 2ERJB 2W5PA 5BV7C 1OAXL 4JM2A 4Z7NB 5F88B 4N2GA 4P2RB 4PJBB 4KRPB 2V37A 2VLJD 4HLJA 2AQ2A 3O41A 4Z3EA 2HLEB 4ZSOE 2EE9A 5C6TH 1RPKA 1J05B 4RAHA 1A0QL 3WNJA 2Q2EB 2I9LA 4OD1H 4N2LA 4WSKA 1UAZA 4A6YL 4DCQB 3PPSA 4QHLB 3PP3H 3O0RL 2WYTA 4FBZA 4UINH 5FV1L 4WWKD 1N0LB 4YSOA 3ZT7A 2N3JA 1K2DB 3AC0A 2ITDB 1E9QB 3X14A 1U3ZA 1P53A 2R1YA 2ZKWA 3FQ4A 4PUBH 4TQEH 1ZLWH 2QHRL 2ZOTA 3T8XB 1IQDB 5D7EA 4PSRA 3ZE1F 3MLPA 1OZUA 3KL0A 3WAJA 1BVLB 1VPOL 2CK0L 2ILLA 2DLHA 1QBLL 4L4VE 3JV4A 2GSMB 1TLMA 3CMOL 3ZSTA 1PBYA 2GHWB 3FJTA 2X3AA 3RVUD 5IEKA 4NKIL 1NJ9B 32C2B 1S9YB 2VJ8A 4IRSC 4FQLL 2YXWA 3N1FC 4HBQA 1MCFA 2CLZB 4NERA 4FXGC 2YQBA 4MMXC 3T0AA 2X6VA 3ULUC 5GGRY 1FG9C 2CR6A 2JELL 3P3YA 1A6UL 2Y07H 4P5KA 4YO0A 4B50A 3P0GB 4BQ8A 1U41A 4AJWA 3L54A 3QNZB 4ONHA 4K8RL 3K72A 4PJHE 2QADD 4KJPD 1GCFA 1BM3L 5IKCA 3BZFB 1ZXKA 3L4ZA 1SEBB 3VGDA 2VZOA 3FU0A 3KPLA 2BP0A 4PJIB 1LO5A 3DETC 3UFIA 4XE5B 3MLWH 1WIUA 5C0IA 1ECZA 4JZOB 4QF1A 4D7BA 2BSED 4EKJA 5KSAD 4QRPA 3CCHA 4CAGA 4DUVA 1RZGB 4ATWA 1N18A 5FX3A 2DWEB 3D2UB 5DJ0B 1FIGH 4A38A 5BV7B 5I1GL 4MZRA 1E43A 1T83A 1UM4H 3GEWB 4PJGB 5F72S 4UQEA 5GSRB 1NINA 5EZOL 1EAPB 3MYJB 1RAMA 4HALA 3LKQA 3KPOA 5AKVA 4C55A 5DZNA 2VITB 3CZFB 1PDKB 4OH2A 2IDQA 1OGAA 5TQ2H 1OM3L 3JWDL 3SBWC 3V0IA 4G1EB 5DVKA 3US0A 3MJ9L 1DUYB 1QHQA 1UZ6F 4RGOL 4X7TB 5ELIA 2JF1A 3QWOB 5G2CA 1XBDA 1P4BH 2NNRA 4G8IA 4LFHG 3RVWD 2W9EH 3B9KC 4B9CA 3H0TA 4N2CA 1XL6A 1Z9LA 1H6UA 3S35X 3V6OA 3WNPA 1JCKA 1T0NB 3A67L 1VFMA 5L7XH 4S2SA 3SE8H 1QZNA 5F6IC 3RUGA 3VFPA 3DV4B 2CZNA 3B8YA 4ODSH 2R4RH 5FCSH 3DJSA 4WTXA 1QR1B 3VDBA 4O2CB 2K78A 1KYDA 4GKNA 4IRSB 5CSGA 5TF1L 2QPUA 3HBPA 1NANH 4YLBA 2BX5A 4FXGB 5DDHB 4JE0A 5ACLA 4MMXB 1O6SB 2VLKA 1VFUA 3C5XA 3RPBA 2DQHL 5GGQL 1N9PA 4OGYH 5ICYA 2WV3A 3G6DH 5EG6C 1UXSA 2CO6A 3TVMA 2Y9RT 3I02B 1GMEA 4WUUD 2XWBB 4XWOD 4YVUA 5A2KH 3L13A 3VYPA 3UDWC 3R06B 1B0GB 4FGMA 3Q3GB 3ZE0E 5J9PA 2HKHH 5AD0A 4MWFA 4OU3A 5HDBB 4FC3E 3NJHA 5T1KD 4HW6A 4GUCA 1FSKC 5MEPB 1LQSR 4BH8B 5ICZB 1ZANL 4Y4KA 4NWTL 5LCVA 1OP3H 3M6DA 1L4IA 4L8CA 3TT3H 5KYXA 4K7FB 1CT8B 2IOMA 3QULA 3U1SH 3IPEA 1XF5B 2AHIA 1BRXA 1XH1A 2P5WE 1KY7A 2G60L 5IVOA 5DEGA 3HMWL 2FHBA 3RIFF 1E3XA 1EHAA 5E1IA 3MNWA 1G7JB 3MPCA 3OZ9L 2D8KA 4H26A 2IH3A 1SOQA 3RBGA 1PJ9A 3CJJA 4H2AA 4TSBL 2VLMD 2A73B 1KYUA 1F3JA 1XEUA 2OQJB 4LDOB 1NEZB 5CJQH 4HBCL 5BMFH 5I15H 4KO5A 3WNIA 2WLNA 5JOPD 1HJBC 2ITFA 4YEEA 5DA0B 4JMXA 1J8KA 2BZCA 2Q7YA 4NFDA 4PIRF 1Z9SB 5SWZD 4PLKC 4XO9A 1H3UA 3HHSB 3VX1A 3LEYL 2OBGA 3HCVA 1NAML 4DP7X 1J5HA 1CXHA 5KKHA 3T6XA 5SWSD 3N9GH 3B9KB 4HIJB 1NBYB 4R9HA 4L29A 3VRLF 4LPXA 3EJPA 5GGSB 1RU9H 5BW7C 1THAA 2HX9A 4M1CC 2OSLA 2ZX8A 4N2AA 3MLXH 3RY6C 1WC7A 3PXOA 4I88A 1I31A 2FJSA 5F6IB 1CBJA 4FI6A 3FHEA 4WENB 3WJJC 4PWIA 1E3FA 1RZJH 3UTZB 1UYWL 3NSJA 2BW5A 2IAMD 2XFGB 2F08A 1ULVA 2YCYA 5E0FA 3ZDYF 1I75A 2DLFH 3LZFH 1TCMA 2K6WA 2VE6B 3PUUA 4HK3N 4OLYL 4P5SA 1AZNA 1L7IH 5CWSA 3IT8D 2VRKA 3RB7A 2BLFA 4KK5D 2IXQB 1JHLH 2WQSA 4QRTA 5L9DL 4MJHA 3L8QA 5CSZB 2EILB 2W60A 2ICWI 2VT0A 2WB1A 4K5MA 4R6UA 4RZKA 3GSOB 1PLCA 4HJJL 4H25A 4KFZC 4L8SA 1AAJA 4M00A 4MCYB 1Z3RA 1R5VA 1IZKA 4ZMWA 3ZK0A 1KBPA 4BUHA 2JI1A 2LQRA 3Q9QA 3CIQA 5DS1A 3U4BL 4Z7VA 5BOPA 1FSKB 1NAKL 2C3HA 2UX6A 4KKLD 4PREA 4BKLB 4MBSA 4YZFF 1P8HA 3QC5X 5DVPA 2IO5A 4UT9H 3CZKA 1Q9KA 2R1WB 2B9AA 2CHXA 1RSFA 1IRAY 1F00I 1M56B 1XT5A 2GTQA 4C4BA 5SX5H 4ISVB 4F33A 3QUKA 3KLAB 5E99L 4YSUA 1MH5A 4GSXA 3E6HA 2GKIA 3CU1A 2XQ0A 4ZXBC 3IFOB 5D1XD 1F11A 5EF2A 3O2WH 2MOQA 3EO9H 5KUMA 5KVGE 1CK0L 2YAFA 3KS0J 4JREC 5E5MB 5A3ID 4QY8B 5AZEL 3L4CA 4QRUA 3EFFA 2DN7A 3FN0H 4JRXE 4OQTA 4H0GA 3MFFA 5JIPA 2NQ3A 5C08A 3VM7A 3AQYA 1U3HA 4YJZL 3OKLA 1T04A 4MQSB 4YSTA 1FYTD 1UT1A 4YHLL 4TNFA 1E67A 2XV6B 4L05A 3U9UB 2FX7H 5F1IA 4E41D 5I76A 4HPOH 5LUMA 3JWOC 4WKZB 5ANME 3BESR 1BZ9B 4KNQA 1AO7D 3BCDA 4JFYB 4NGHH 5C7XH 4YUEH 1UUSA 4ABQA 5H4ZA 5EBLA 1HKFA 2X89A 4FQ1H 4DGWC 1JIBA 4CMMA 2F54E 2VQ1A 4APQD 4PAZA 1V3LA 2KYIA 1AGCB 2MPAH 1C16A 2JQZA 2X2HA 3Q01A 4LL4A 2D3LA 5T8IA 1QSZA 1L0YA 1LDPL 4H5SA 4JJOA 1PG7X 3LNHA 2B20A 3Q2VA 2J2ZA 5GHWL 5IHLB 4R4BB 2XQYG 4U0QB 1DVFC 4OCXH 3BVWA 1A6TB 1MCPL 2ZOKB 4LEBA 4A63A 4HULB 1GC1C 2C1PB 2R23B 4R97B 1C5CL 4ZFQA 4YSAA 3FO1A 4UM9D 1YY9D 3UYPB 4Y5YA 5CEZH 1KFAL 1ONQB 3HG1B 3BAKA 3GXPA 4PVNA 3ZKND 3CE1A 5D96C 2BNRB 4QHNB 1UH3A 5SV4A 3TBYA 4MNQE 5HGAA 4ODTL 1YEEL 3X3GH 1PMYA 2FT6A 4DJHA 1KELL 4D3CH 1YECL 4Y4HA 1N5YH 4D0DA 2BINA 4U1MA 4KKBD 4D9LH 3QFJD 3SCMD 4UZUA 3H7BA 4Z77B 4X8JB 3FPYA 4Z18A 1YNLL 1W0VA 4H8QA 1T2QH 3H9SD 5C0AA 2WSPA 1E9OA 1LMIA 2DQCH 3GHBL 1M0MA 3A6OA 3CN2A 3FN9A 3RWJA 3VJ6B 1EJ6A 3QR0A 4N5UA 1ILSA 3SGKC 2APVA 1Q1JH 4E68A 1EDQA 2XN9D 4ZXBB 4PJGF 5GPRA 1UXMA 2Z31A 2UVFA 3WXWL 2WLMA 3KD4A 3ROLA 4JREB 4XPGL 3J7HA 3IDXL 1HQRB 4KJYB 2CGZA 1VEMA 3W9DA 3F6IA 3CH8A 4PYGA 3KYMB 5FM8A 4KOCA 3U82B 2BSBA 3BLPX 4L3AA 4BFJA 3S48A 2N1TE 1VHPA 3V6BR 2X41A 2PN5A 3VFMB 3WNLA 4GLRH 1IGTB 3INUL 3V0VA 3LQAC 3SY6A 5D9SA 1WITA 2QSVA 5I26A 4Q14A 1H3PH 5K9KA 1WS7A 2E7LA 4PRDA 3QPQC 1EEZA 2FATL 5D55A 5LXVA 2NMSA 4HPYH 4Z7OE 1JPTL 1S2EA 3DYOA 1PCSA 4LDCA 1OWRM 1DVFB 4MVBC 1FAIL 1FF5A 3NIFB 4ZRGA 1CD0A 2X3BA 5PAZA 4XCFL 3TZVD 3K1DA 4NAJA 3F6LA 2QGCA 2BVOB 2ZWLT 1RIUH 5LNDA 2NNAA 4NHCL 5T3XL 2YBRB 3IBEA 5T3ZH 5D96B 1NC2D 1EIBA 2Z73A 3B2UD 5CLTA 2GC4C 2JFCA 2LE9A 5DD0H 3HLAA 3KEDA 5TE6L 5EU6D 2B5IC 5LDSA 4XAWL 1P5UA 5GJTH 2CMRH 3KPPB 4E5XB 3CXDH 1FIEA 2VDPB 2I07B 4TVUA 4AEFA 2D0GA 4R96B 2HVKB 5IWLC 1ACZA 3O6KL 4DGYH 2UXVA 5IEHA 3A47A 1YNTF 4TUOB 2XZCH 2YAOA 1OAYL 3DOSA 5MENA 3DSFL 3RGVA 3T0DA 5H35B 4NN6C 3RGBA 4QHMB 2HFFA 5IW6B 5CEZE 3D1MC 3TESA 4XBGB 1S8JA 4QHUB 2FJUB 4DOHB 5I5MA 4X4XA 2YSTA 1RHHB 5LGYA 3IJSA 1WWCA 1H0DB 4HF5L 1XR8B 3HS8A 3KNBA 1D7BA 4LOUD 4NI3A 4YFDB 4OUUA 3U83A 3NZUA 1CD1A 5IJBC 1PJWA 4FG0A 4EOWH 1KJVB 2YD1A 5DRXB 3SN6N 4YXHL 4NZRL 4FFZH 3T2QA 2VWEC 4ONFL 2WKOF 3G6JA 4AKQA 4FMKA 1NBVL 1K8IB 4GP8B 3ZEVA 3QRLA 3TO4D 2Z6FA 4OD3L 5IB5B 2HT3C 3BP5B 1KSRA 4LSRL 3LIZA 4GI9A 4OV5B 4FADA 2VL4A 2BOCB 3QEGH 5IBUB 3VX0A 1ZV9A 2NSQA 1SGKA 3IE4A 4N86A 4Y1AA 4W70A 1XB3A 3FUIA 4N2KA 1IB5A 3PAZA 3F7YB 4DO6A 2H32A 2J8UA 3WDIA 3FFDB 4O5LL 4FABL 5L6YH 1YDPB 3C60A 2IQ9L 4L1HA 1NCJA 1EFXB 2N7AA 3WE6B 4A7SA 3VFVA 4XCYB 2B4CH 3DX0A 3D39E 3IJ9A 4R4FL 4X99B 4B9JA 1Y07A 2B5IB 5C8JA 4JKWA 1IBFA 4R83A 4XOEA 3KPQA 4GRVA 1BFTA 1S52A 3GMOB 4YHOL 2IPUG 1CB4A 1CFMA 4M7JL 4NQVA 4FNSA 3HBGA 1KDIA 1RSYA 5AOJA 4Z0BH 4CADB 3U2JA 1U2HA 4M7LL 2HLFD 3P2BA 4Z76B 4ES9A 2VQTA 4U1NB 5IJDC 2R8SH 1MNUH 4JHWL 3NUKA 1OPOA 4LP4A 4BA0A 3EYSH 2UZPA 4LSTH 1YEIL 1UCQA 2QDVA 4HC1H 5D1ZA 4ZFZB 4PN6A 4NN6B 5B2NA 1KB5L 2DQJH 4ZOBA 1G87A 5ADPH 4Q6IA 1B4LA 2A9ML 2CXKA 4HU8A 3QH3B 4N2FA 1E4JA 2C9PA 5C0BA 2UZIH 4PJAE 5T3ZE 1F4WL 2E6QA 3FAXA 5CO1A 2XVGA 3H56A 3ILDA 1X5KA 1IILE 4WCYL 4NUJA 4Z8FL 3H55A 4N0UE 3WY4A 3TGXA 4CNIB 1NEZG 3HPLB 2VM3A 3MA7B 5AW2B 5ABZA 3FT4B 4NSKB 4R8WH 3CODA 1KTLB 4Q9RH 1SOKA 4U7SA 1TJIH 5TFSH 1IQWH 1OPGH 1TEFA 1VZIA 4NJ9L 5TDPB 3ZXAC 2DMHA 2J6EL 3AROA 5GZOD 4L4VD 5LVEA 5IROC 1WZMA 4Y19B 4KNUA 1NL0H 3GLEA 5G5DA 3F84A 5K9JH 2PCPB 3T09A 5IHUL 3PJLA 3L3KA 1E30A 1BFVH 2AK1H 4WFGD 5D4IA 1C08A 2FE0A 4BFIB 4B0MM 2R0WH 4WW2C 2FGWL 2W07A 5ID1A 2IWFA 3OKYA 5C2BL 1UKTA 4KPHH 3LEVL 4PVLA 2NY6D 1YJDL 3V8OA 2OAAA 3VW3H 3S2AA 2BRRL 1PD0A 1X5JA 4QRFA 1JSYA 1WO2A 1YEDA 4QIDA 1AXSB 3E9TA 1J8RA 4K0OA 2QQLL 2Y02A 1UT9A 2AITA 3GMNA 3WTTA 1WA0X 3APDA 2DM4A 4PRHE 1JNJA 2J1XA 1E8ZA 3TYFB 3W9EA 1BVOA 1HNFA 1XD1A 1NPUA 4PH8A 2CCWA 3GJFA 2CO7A 1MCWM 2BY0A 2D7OA 3NP3A 4XHJC 4RNRB 4B60A 5F0LB 5EOCJ 2HJFA 3SJVA 5B6YA 1KXQE 3II2A 4G1MB 3WS3A 1CFTA 4NLAA 4YLCA 2WP3O 3O6LH 4GMTL 3SYCA 2BVQB 4QRRA 1U8CA 7FABH 5JW4N 2AJYH 2BNUA 4FNQA 5HY9B 3GUTB 3QXDA 2CIIB 3ZDXE 3FU3A 15C8L 3FTXA 5LAXB 1DQML 2YPLA 4M62H 4U3SA 5DO8A 4DKTA 5TPWL 4G6FD 4PV9B 5JHDB 2P80A 5I6PA 1HH6A 2WXHA 4MA8H 5L4FA 3V4LA 3BEVB 3L9RA 1CICA 3ZKSD 5L4JA 3PL6A 2VB5A 4BUGA 2B2XH 5D1QA 3I3DA 4M5YH 1EERB 5E4IA 2EUZA 2EDBA 2BIMA 3PWLA 3GO1L 4GW5B 2OL3B 3RVUC 1NMBH 2CJTA 4N8CL 3HE7C 1INEL 3O4OC 3UPRA 2NY7L 2NY5L 2NXZD 4L4TA 1A22B 4ZPVB 4WWOA 3V95A 1A8ZA 2WXNA 2JKWA 3PWVA 5KOVC 3MDJA 2E7HA 3CZLA 5IB3B 2Z35A 1DQLL 3L3OC 3T04D 3OAYK 5JQ6L 5DZOA 1B0RA 4G9DA 4RAVB 4Y2DA 1A6WH 3QC6X 4JDVA 4UM8A 4WW2B 1J86A 4ODXB 2G4GA 1H6FA 4KJPC 5B35A 5TDNA 2V5MA 2N1KA 3RVVD 1YEGL 1RZIB 2FLMA 2PPEA 2BP8B 1BQHA 1OAQH 2XTJE 3QZPA 4HS8H 4NP9A 1JPST 4RH4A 3RFZC 1QFUH 4LARL 3SDCA 3PBLA 3IDIA 4GRLC 2JK5B 3LD8C 4PRIB 2EEDA 4JZNB 3BP6A 3PJSA 4R26L 1IARB 4HFUH 4MMZC 2EXWD 2CKBB 4QXGH 5JPNC 1OT1A 4LEOA 3GHEL 2UZYB 1F4HA 4PW9A 2F58L 3AGVA 2ZKHH 1ND0B 2PWFA 4XNUH 3KCPA 3VQ1C 3S4SA 5KSAC 3VFRB 2YGPA 2NUPA 2WC7A 5I1JH 2ZOWA 2P5WD 1KNOB 6TAAA 3OMZA 2FH6A 1K3ZA 4NUPA 2WUBL 5B22A 3TN0C 2ZUUA 2XV3A 3I6KB 4UV4L 3MRDA 4Q74A 4YHPB 3WS6A 1BIIA 3UTSB 4EIUA 2CWRA 5DK0B 1O7SA 2VLJB 4XC3L 1MUJA 4HOXA 1RUAL 3K2UL 4JDZA 4LSSL 2ICWB 4HJ0D 4E0RB 1CQYA 1J1OH 1X4YA 4QMEA 2J57A 4X50A 5D7IA 4AXWB 2FSEB 1R5WB 5DS8A 5IOPB 3B3IB 4GSQA 3OXSB 2BERA 4R7VA 3RWHA 1BZ7B 2Z92B 3UL4A 2HKFH 3L9EA 4F7MA 2XT1B 4JM4H 3RVWC 4N1EA 3RWDB 4WI4A 4JFDD 3RX9A 3MR9B 1INDH 4OJFL 3SKUD 1OCZB 1I1YB 2DLIA 3MMEA 2AVGA 3OKEB 2Y23A 1AI1L 3PNWB 4ADJA 1I3RA 4P2OA 3AXIA 4I0KA 4DGVH 4WRLA 2IFGA 2WQVA 3PAVA 3I85A 3KJ4C 3LZRA 4OW6A 3C5ZA 3C8KA 5DC4B 1I7TA 4NRZB 5I8EB 3SZ6A 5KYYA 1CDUA 2OYPA 1J5OL 4LLVA 2DBJA 2APWA 5TE4L 4JVWA 3HE7B 1C5BH 3O4OB 4J4PA 4PGDB 1VERA 2B59B 2JJTC 4FQJL 2VZTA 2AXFA 2CCLA 1OCCB 4KWUA 1DBJH 1NGXB 3MZGB 3RG1C 2NW2A 2KKQA 4GIPD 4OQ1A 1VSCA 3L3OB 3T2PA 2VMFA 3C12A 1QSVA 3LVEA 5IW3A 1NLBL 4JY6A 3LKOB 2MCG1 1R3JA 3B8SA 4ZJ9A 3CFKA 4XWOC 1ZTXH 4AL8H 3SDAA 4GQQA 2A2QT 4U3HA 1MJ8H 1LEGA 3L1OH 1IBGL 4HSAC 3RFZB 3BAYA 2DI7A 4XRCB 4GRLB 5KSBE 3LD8B 1WVZA 4X5XB 4BFRA 3Q5OA 4GUOA 4MMZB 5JPNB 2CRYA 2Z4QB 3WLBB 1NOFA 3MRGB 3MCKA 4G8GA 2DIJA 1MY7A 3QIWC 1T7WA 5E6IA 4GUQA 5KSAB 4R3SA 5G4MA 3MXVH 3JTTB 3QS2A 1U36A 4JZJC 5J8OA 3MRKB 4X6EA 3GWJA 3GIVB 5A16A 2H5UA 4XXDB 1R33A 2MHAB 1G4RA 1YQVH 2FECL 3ARRA 4R90L 5D2LE 4ORZC 3TEUA 3TN0B 2H7WA 1IC1A 5F89A 4DP0X 3CV5A 4NM8L 5AOIA 5JHMA 2PCFA 1GZHA 3TJPA 4JRXD 4P3DB 3OSVA 2FEEL 5C0GB 3N1PC 3TO2B 3F7RA 3KPSD 1NDGB 1SOXA 3PYCA 4NNXB 5CEXA 1HWHB 5IB1A 2B1AL 3VXRB 4D0BB 3LPWA 3EO0A 4J4QA 3OPZH 3MRHA 1HHGA 2GTZB 1ZPLA 3A6BL 5EUKB 2HLAA 2F0CA 5G4NA 1SBSL 4AI7A 1S7SA 5D7LE 3C8HA 1FA4A 2ZKYA 3CN3A 3O9WA 1JZFA 1O9ZA 2JCWA 3MJ8A 1SDDA 3TNNA 4D2NA 5IR1B 2OV0A 3KJ4B 4JBSA 5EC1A 2O6EA 3IMUA 1NICA 3RWIB 2YRZA 2YAHA 1S7QB 3Q44A 5E51A 3TBVB 1OP4A 1P2CB 2Y5EA 5DJXA 5LQBL 3ATAA 3KL5A 4F37K 4YIQA 4X6DF 1LGVA 3CIAA 4UOW0 5IK3B 1FH2A 5CJOL 1RZ8A 1DCLA 5FLUA 4ZZFA 1VKXA 4P5RA 2W0FA 3D3VE 5C0RH 4Q2ZA 5T1LD 1DUZA 3I3EA 5ECJE 4WUUB 4LSVL 1WWBX 3DQBA 5IBUG 3AY2A 4OZIB 2AF2A 4NUQA 4NQXB 5EV7A 3NEXA 1G7MA 3BVNB 3HB3D 1A7QL 1I7UA 5T1KB 3KWTA 3S0PA 1I1CA 1HX0A 1P7QD 2OTWA 2DIAA 3EHBD 3DX7A 5DZJA 4GQPH 3L3DB 1DQDL 2VN6A 1A3ZA 1M7DB 5GRZA 4AY0A 3FHAA 1BGXH 2JXMB 3EH2A 4BSVA 3QIWB 2R51A 3F65A 3STBA 5CGBA 1KJ2L 1JFQH 2YD8A 4Q6YA 4JZJB 4CVXB 4AMXA 5A3IC 1DTUA 2CM6A 3TBTA 3JUZA 3WFHA 4PJCE 5AWNL 2Y6SC 1W2KT 3WIIH 1QACA 2WCSA 1VLXA 3BAIA 1K4DA 1GW0A 2GTWB 1A7PH 4KROD 2XKNB 2EC9T 4PJFE 1KN4L 1E9PA 1RZFL 4XCCL 3ZJAA 5GS3A 4JEGB 2FD6L 2K8QA 3OX8B 4OCRL 3CXHK 4ALAC 5SWSB 3UCRA 2V17L 4W9EC 2BJML 2H3KA 3ZYJA 4P4RA 3MOBL 4MJIE 4APQC 4EI0A 3IKKA 4QRSB 2XIDA 5DVOA 4R7DB 2EUWA 1BQUA 2NDFA 3MLSL 3D4ZA 3VXSE 2FRGP 3AS3A 2F7OA 2Z7WA 3CZJA 5D72L 5C71A 1XR9B 4GBRA 3GF8A 3ZRCC 4YXLL 2ATKB 4UDUA 1YEFH 2EYRB 4X8GA 4CN4A 4KZ0A 4WEMB 2EH8H 1ZD6A 4P9MH 5G55A 2WBWB 4TQ8A 3ATDA 3WXVH 4BYHA 1KIQB 2P9RA 2FO1A 3ZKNC 3GHPA 4WW2F 5CZVL 4WGKA 1YPZE 3OHXC 2FB4H 2BH0A 4MDJA 3QUMB 4UU9B 3NH7H 3AG1B 3FQ1A 1HILA 1UWYA 4I8DA 3O4LA 4ZS7H 3MTXA 3T4AA 3RA7H 3MACL 4I87A 3SKNB 5H2OA 3KPTA 3L6FA 2EYSB 7PCYA 4KUCF 3MRRB 5HDQH 4OT1L 4QRQA 2F7IA 3NTCH 4Z3IA 2G5BB 4WI8A 2TRHA 3UAEA 1XCQA 3SE4C 2ZUQC 3D5OF 1T5XB 2BSRA 3QQ4B 3RI5F 4I0PA 3QXUA 3PABA 4A7QA 2XRAH 3I50L 5I1AA 1J9TA 1S9VB 3LHPH 4PJ5E 5C0JA 1SEQL 4N1CA 4IEFA 4M7KH 3W39A 4QXUL 4IOFD 1YNKL 3ROOA 2AJXL 2PYEE 4PJ8D 4P5MA 4ZTPH 1FYTB 5JW5B 4JO4L 3BE1H 4OCNC 4N85A 5HHPA 4TNVF 1I1AC 4XPTH 5FKAB 4M48L 1KIUB 3T77A 1JGUH 4E41B 3QRGL 3VG9A 4K4KA 1JPFB 4JFHE 2Q8BH 3CG8A 3MV7D 4MXVE 1FWXA 2BIHA 3GSNH 1X44A 4WNQB 4NC1E 4PJBA 4APQB 2DQFA 4XBEH 1H9VA 5JW4M 1UM5H 4J8RA 2EDLA 3JZ7A 3PHQB 4M93C 4L3EE 3U4EA 5CP3H 5BZWB 1I8UA 3EGSB 2ED8A 4X5QA 2FJGA 1QVOB 2V6HA 3EJZC 3LRHA 5E0QA 3ARVA 2X42A 4LSQH 1K2DA 1E9QA 1S7RB 2DQDH 2VERA 1TNMA 1ES0B 4EDXA 4UM9B 3BQUA 3CC1A 1SOSA 4NQQA 4HAFA 2OS7A 1NANI 1RD6A 2P26A 3OHXB 1BVLA 3UJIH 1P4LB 3L3GB 4FD0A 4R84A 1MY5A 2O61B 5JHBA 12E8L 2AJ3B 4FTVA 4V1DB 4WK4B 3BYTA 5JLZA 4JHZA 4J6IA 3BKCL 5GS0L 2VDMB 3QFJB 3F58L 3L81A 1OKEA 2QFRA 3BD5A 3MLYL 4JY5H 2UZXB 3I3BA 1HTYA 2ZUQB 1AG6A 1DN0A 3GI9L 4OZHB 4Z7UB 3ES6A 1J48A 4N8PA 1IAMA 3P0GA 5B4MC 4UUJB 3QNZA 5HDRA 2WMPB 1ML0A 3QA3B 4X80L 4KK8D 2X4NA 2HTLD 3HG3A 3EOTH 1T20A 4X6CF 1E8YA 3BH4A 3BVTA 3G5YA 1SQ2N 3G08A 4BDVB 4JN1L 4GYBA 4MYPA 1F13A 4OM1H 1OAZH 4LF3A 4PM1A 2YMXL 3OKKB 3UYRL 2FX8L 2WO4A 4UB0H 5DJAA 2R29H 3V6ZB 3LSOA 1SUJA 2A83A 1HSAA 2DTMH 1KGIA 4Z7AA 2RA1A 4EN3D 3VFGH 2EUVA 3X1FA 2D3JA 4DZ8B 2A6DA 2V5RA 4OKDA 1F56A 1SJHB 2DWEA 5DJ0A 1U8IB 5G54A 3BJLA 5GGVY 5CCJA 1JYNA 4PJGA 3VXUA 5EU3A 4AG4L 1II4E 4PRPA 4M29A 3RVTD 3TO4C 4KX8A 4DP9X 3GLDA 5F7EL 4JAMA 2VITA 3B7SA 2XYCA 1YMHA 1A4KA 4XNYH 4M8UA 4A6YH 3SGJA 4M93B 3P40A 4IRZA 4KRMB 2XKUA 3O0RH 2CJUL 2ZCLL 3EYUL 2MEJB 1TTGA 1A1OA 2GY7B 4LLMA 3HE6C 4K3JL 2ZYRA 5C1MB 1EXHA 5F3BA 2QHRH 2LU4A 4PLNC 5IMLA 4LBEB 3C5JB 3RDTA 3WL9A 2D31B 4HEMA 2CK0H 4JANA 1F4YL 2JLLA 4OZIF 1NC2B 6FABL 1HDMA 3DBXA 4NKIH 5DLMH 4DVBB 4PJDB 1KF9B 1AJ7L 3CSYB 3P73B 4M8QB 3OE6A 1F88A 1F5WA 1FZKB 3BC9A 2VLKE 3LPGA 4LNRB 1ZT4B 3ULVE 5KTEL 2XU9A 4HKBA 5D2NE 3MX0A 5K9OA 2VDKH 1A6UH 5DMYA 2F7QA 4O00A 4K23H 4K8RH 4OD2B