4FA7B

Structure of recombinant cytochrome ba3 oxidase mutant a204f from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 49
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4fa7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4fa7B02
1P8UA 4UANA 4XXJA 4KNSA 1JFPA 3SN6R 1AS6A 5H2NA 5LWEA 3VG9A 2IDQA 4KNUA 2JAGA 3SBRA 1MDAA 3UTXA 2CUAA 2TSAA 3FYIB 1X9UA 1WA0X 4Q8BA 3RYMA 4MBSA 1KCBA 3SBPA 5A7EA 3PPSA 1F50A 1JV6A 3HAPA 4MQSA 2Q9OA 4HCIA 3AG4B 2HPYA 4FA7B 1ETJA 3MX0B 1NWOA 1XB6A 1BEXA 3ZEVA 1WA2X 2OV0A 1M0MA 9PCYA 1MZYA 2PPFA 2EIJB 4FAAB 3C75A 2IDUA 4DP9X 4YSEA 2XU9A 2GC7C 4KNFA 2BRDA 3QJQB 2UX7A 1SNRA 3PQRA 1XB3A 2DYSB 3NSDA 3KW7A 5I6PA 5B7EA 3RZEA 1M56B 5B2NA 5G2AA 1NINA 4YL4A 4JHVA 1PY6A 2ZZLA 1BYOA 1AP9A 3PBLA 5I5JA 3T45A 2VW7A 3ASOB 3A7KA 5F8UA 4MQTA 1SHWA 4QKTA 1TN5A 1SFHA 4BXVA 2YCWA 4KO9A 3N2JA 3WKPA 2F93A 3H56A 5H2KA 1JZIA 1C3WA 2PCYA 1JOIA 2UXGA 5TK2A 4YVUA 2BP8A 4DP5X 3RFMA 5B6VA 1ZPUA 3FSZA 2QPDB 4DAJA 3NJKA 1E65A 2ZWNA 2DWSA 3NJJA 4FBZA 5DYSA 4IB4A 5H2MA 3S3DB 1IUZA 1WS7A 4BDVA 2I1XA 1AS8A 2ZFEA 1AZCA 3FSWA 5D4HA 1TKWA 4YVNA 1PLBA 1JZGA 3PAZA 3OMNB 4NB7A 1BRRA 1GW0A 2PEDA 4GP8B 1GS7A 2EINB 3QJRB 2DV6A 2XV0A 5AKRA 3QJUB 2XYBA 1S51A 1T5KA 3VI0A 4AKOA 3X1EA 3FU9A 4PCYA 1ASQA 1RKRA 4X4KA 4DPBX 1E0PA 2YAOA 4YSPA 2J5WA 2YDVA 3OM3B 5AWZA 2BZ7A 3D4SA 2VMJA 4F7KA 4HYJA 5H2JA 2FTAA 1AG0A 5B34A 2FWLB 3COCA 3FPYA 2FNWA 4TL3A 2IAAC 1JZEA 1BQ5A 4UHRA 1NICA 1ET5A 2R7EA 3NJGA 5H2OA 2QDWA 4WKXA 5PAZA 2KSBA 4A2DA 3VVKA 1PCSA 2FT7A 5I6NA 3SBQA 1QNIA 8PAZA 3ABWA 3OQRA 1CWQA 3HASA 5B1JA 1VLXA 2I7SA 4L0PB 1ZV2A 1CUOA 2PCFA 2R4SA 4DPAX 4BXSV 4JQ6A 2AT9A 3HAQA 4GPOA 2AVFA 1L9RA 4BWUA 5B1AB 4WW3A 3VW7A 1E5YA 2J4YA 5IY5B 4WAVA 3VGAA 4IAQA 4RH4A 1M57B 1NWPA 3GDCA 4EF3A 2YDOA 3EHBB 1URIA 5B1JC 1JV7A 3C9MA 3WQJA 5A44A 5ITCA 3V9CA 3T9WA 4QIDA 2FQGA 2Z73A 2DYRB 1QKPA 1AT9A 1GUEA 4GYBA 3CG8A 1Q5JA 5H2IA 1OCRB 3ERXA 3FU7B 4HALA 4A67A 5AHZA 2VSMB 4HZ1A 4YSTA 1L0MA 3UTVA 3GYRA 1CYWA 3QAPA 5LDUA 1S8JA 4G7SB 3TA4D 2CCWA 1GS6X 3UTWA 3PAUA 1PMYA 3L45A 4P5SA 1S53A 2BW5A 4XT1A 3AG3B 2XV2A 3NSBA 4BWWA 3S8GB 1VJMA 1C8SA 2JKWA 1HAUA 4GY4A 1A3ZA 2PP9A 1UATA 1HAWA 3ZPRA 1NIEA 2GB2A 3FQ2A 3IEAA 1ADWA 2AANA 2BWIA 2JXMA 4E9WA 4MD1A 1P8IA 5H2HA 1NDTA 3D12B 4NERA 4E9SA 4PAZA 5B0WA 1B3IA 2F95A 4DKLA 1N70A 2NRDA 1JGJA 2XLLA 4W1TA 1EHKB 3QJSB 2Y03A 4HYXA 3QDCA 2AFNA 3FT0A 2BP0B 3CAPA 2GC4C 3EF4A 1TEFA 2Q5BA 5I6KA 4L6RA 2WSDA 3X1BA 4YSQA 5G2CA 1JXDA 1NPJA 1MG2C 2QT6A 2FJSA 5ETZA 3ZX1A 3PAVA 3WIAA 4K5YA 5DHGA 3DQBA 5AZDA 2VW6A 1RZQA 1H2SA 2M3GA 1A4CA 5G28A 1ASOA 1X0K1 1XIOA 5AX0A 4A4MA 1AZRA 1V10A 2OCCB 1KG8A 4A66A 3V2WA 4A2FA 1R84A 4AMJA 1OCZB 4DP6X 2IH8A 2BZCA 2VT4A 4GP5B 2X88A 2ZOOA 4YSDA 1J9TA 1KMEA 1QKOA 2YAHA 1UCQA 4M4RB 1NZRA 2VSKB 1FWXA 2AZAA 3ASNB 3V2YA 2PP7A 1RCYA 1SHXA 3CVDA 2VM3A 1OE1A 2R4RA 1PZAA 5PCYA 3X1FA 1HFUA 1M0LA 3CDZA 1J5CA 3CVCA 4X1HA 1A65A 2I20A 1PXRA 4GXFA 4JHUA 3SQRA 3FU7A 4E9YA 1PF3A 1M0KA 4N4WA 1SDDA 1PNDA 3UADA 4HHWA 3NP3A 4ENZA 3OE0A 3JT2A 3HARA 2Y01A 4QI1A 3S8FB 1IW6A 1GZMA 5BR2A 3QAKA 5B35A 1KDJA 3QPKA 4HCGA 1AANA 2E86A 1OE3A 5JJEA 3ZDWA 1GSKA 2DY2A 3AY2A 3HAOA 5J7AA 2P80D 2UXFA 2GBAA 3ABMB 4HHGA 3T6WA 1CURA 3S3BB 3NP4A 2I35A 1PAZA 3JTBA 2CALA 4N8UA 3MBVA 1F56A 2IWEA 3H4HA 1GS8A 4M3HA 1W6LA 4WTQA 3ZBMA 6PAZA 5H2PA 4P5RA 1HZXA 3G5WA 1AOZA 1E30A 2GIMA 3MBWB 1BM1A 3QQXA 4A2GA 4AKPA 4Q89A 4UF7C 5I26A 7PAZA 2CJ3A 4A2HA 1AR1B 1UAZA 2Y04A 3WG7B 3AYNA 2R7EB 3FQYA 3WNJA 4BK5C 1KV7A 2RACA 3HB3B 3UG9A 1RZPA 2FT8A 3UZAA 3TASA 3AW5A 1AAJA 4YSUA 2EILB 3FS9A 1Q5IA 1ID2A 2W88A 2I21A 5A45A 1YLBB 3X1GA 5B6ZA 5G36A 4UG2A 2H47C 2CBPA 3PXLA 2NTWA 3NY9A 1NIDA 4CSPA 5B6YA 2BO0A 3FSVA 4NC3A 4BEYA 3QBGA 5B6XA 5FC9A 3VHZA 1WA1X 1PLCA 4AI7A 2J57A 3QBLA 1O0AA 4XTLA 2YCXA 3QBIA 5JJJA 1AZUA 5I6MA 2I85A 5G2DA 4DP8X 4KLYA 1CC3A 1R2NA 5I28A 3X1NA 3OAXA 2HX9A 2W8CA 1A8ZA 2DWTA 3FPXA 3ABGA 1IBZA 3NS0A 5I6LA 1GY2A 3WNIA 4DP7X 1AACA 1ET8A 2LNLA 3EH4B 3CVBA 1WS8A 2BP0A 3UACA 2GHZA 5AHYA 1FA4A 4GYCA 3QJVB 3X3CA 2YAEA 3GXUB 4G7QB 3PDSA 1JZJA 2WJKA 3PWHA 4TXVB 2QPEB 1GR7A 1JZHA 1PZCA 3CODA 2B3IA 3PXOA 2JAFA 4BWTA 4LDLA 4BV0A 2L6XA 5B1KA 5H2LA 3CDZB 2NTUA 4XT3A 2IDSA 1ET7A 1MGYA 2P80A 1NIBA 4G70B 2FQDA 4JKVA 2AZUA 2N0MA 2YARA 4CSZA 1SDDB 1X0I1 2YCYA 3ABLB 4AZUA 5B7FA 5AZUA 2Y02A 4PXKA 3S3CB 3UZCA 1JERA 1JXGA 2VM4A 3HANA 5KKHA 1IXFA 1PZBA 2GI0A 1C8RA 3OE8A 4XTOA 3NSFA 1MZZA 1H68A 3NT0A 3NSCA 1ILSA 4YSOA 3AZUA 4YSCA 2YXWA 1IBYA 3UTYA 5DHHA 1OCOB 2FQEA 2XX1A 1NTDA 3IN2A 2BHFA 1J9RA 1OCCB 1NPNA 2X72A 2KSYA 3KJ6A 1ZDSA 2YAPA 2KS9A 3FU8A 2YCZA 3NYAA 3PCYA 5F7BA 2EIKB 2XXGA 3NY8A 4HAKA 1TEGA 3C9LA 2RH1A 1XB8A 1JVLA 4PXFA 4BVNA 1BAWA 1GU8A 1L9PA 2PPEA 3UONA 2Y69B 1FBKA 6PCYA 2EI4A 3T6ZA 5A8EA 1ILUA 4W9ZA 1V55B 3EH5B 2BW4A 1KGYE 3P0GA 3QJTB 3AG1B 4F2EA 1BYPA 4KO6A 1AZNA 4F2FA 4BDVB 4QRYA 3WI9A 3NJFA 1PXSA 1QHJA 2ZONA 1E12A 4QLWA 1F88A 2KSAA 1JVOA 3NJNA 1DZEA 1CYXA 1KCWA 1S8LA 1KBVA 1X9RA 1IW9A 1WAEA 2XX0A 4GRVA 1U19A 2HRHA 3FYEB 3BQVA 4KNTA 3UABA 1JZFA 1SF3A 2A3TA 2ZXWB 5D4JA 2IH9A 1OE2A 4DP2X 1BQKA 5EN0A 5C1MA 5JJNA 5FJGA 4JKNA 1S52A 4LDOA 4EJ4A 3DTUB 5I5MA 4YSRA 2H3XC 1F4ZA 1J5DA 1M9WA 2QDVA 1PNCA 2XVBA 3H4FA 4IARA 2CAKA 3NJIA 3OMIB 3PLYA 4A2EA 3KW8A 4NAJA 4AKQA 2FQFA 1OF0A 2PPAA 4FPDA 3IE9A 1EZLA 4K9JA 4G7RB 1LN6A 2YAMA 4DP1X 5EHFA 1OV8A 3NJHA 4DP4X 4L35A 3ZPQA 2Y00A 4AMIA 3DDLA 3N55A 4KO7A 4JR8A 1W8EA 2WO3B 2IDFA 2IWKA 1AIZA 1GYCA 3UAAA 1OOWA 5TK4A 3X3BA 3DKHA 1L9TA 2PLTA 4X32A 3AG2B 3EMLA 5B6WA 1ZIBA 1ASPA 3DIVA 4N6HA 5D4IA 1AG6A 1N68A 2VN3A 2Y1AA 5I6OA 1BRXA 2HX8A 2YQBA 4LDEA 4E9VA 2UXVA 1QM8A 3NYKA 1QLEB 1QHQA 1FFTB 3OE6A 1DYZA 2HXAA 5TGZA 1KYAA 3TU6A 4EIYA 1AQ8A 2ZIYA 4BEZA 3AM6A 4E9QA 4DPCX 3CZUB 5G53A 4X31A 3WKQA 2XUWA 4KOCA 5AFAA 2G87A 3UAEA 1ZIAA 1X0SA 1SFDA 2MTAA 5BR5A 5AX1A 1SJMA 2Z55A 4BWBA 2UX6A 1MG3C 2YXVA 1BXVA 2WO2B 1PY0A 1R1CA 2B08A 2PPDA 1TN0A 4ZK8A 1XJIA 4KO5A 1BXAA 4E9TA 1AS7A 1PLAA 2XV3A 2XXFA 1E67A 1GY1A 5ITEA 1L9OA 3OE9A 3T6XA 3FQ1A 5ANHA 2TSBA 2J56A 2BWDA 1IC0A 3T71A 3X2QB 1KGBA 4GBRA 4J4QA 1J9QA 2HX7A 1L9HA 3V9EA 1IKOP 2FT6A 4DP0X 3ODUA 1W6WA 1JXFA 1DZ0A 4MD2A 5B7MA 3UGEA 7PCYA 1KBWA 3AYMA 3EH3B 4YSSA 1I53A 2IDTA 1P8HA 2YAQA 2YAFA 2MRYA 2VW4A 3ZIYA 3NJLA 3REYA 1NIFA 2EIMB 3IBOA 1XMEB 2J55A 1BXUA 3HEIB 2IWFA 2OJ1A 3TBCA 1KG9A 1VGOA 1SF5A 3TBBA 4HIPA 2UXTA 4UAHA 2X87A 2HZHA 1S54A 5G54A 2HLEB 3BVDB 2WJLA 5B3SB 1L9SA 5F7AA 4EA3A 2BP8B 5I5IA 4GP4B 4DJHA 3QBKA 1FBBA 1A4AA 1NIAA 5B1BB 4YSAA 1V54B 4HWLA 1KDIA 4Y9HA 3NSYA 4E9RA 1A4BA 1ZDQA 1BQRA 2LLNA 2I7OA 3NJMA 3OMAB 3U25A 1AZBA 3T6VA 4AX3A 2PP8A 4HCFA 1BRDA 1TU2A 4XTNA 4KOBA 1J9SA 4OV0A 1L9QA 2JFCA 2HRGA 4A68A 2PPCA 3ABKB 3FSAA 4G72B 2H5UA 5E9NA 4G71B 4MFHA 4N4YB 2XWZA 3OD3A 4BUOA 1E5ZA 4E9XA 2GSMB 3IN0A
chains in the Genus database with same CATH superfamily
1KJ2A 2GEQA 5D96B 2IAMB 3O4LB 1P6AB 4L0ZA 4M5TA 5MHSE 3HBGA 2HWZH 3GI8H 3FB8A 3V0GA 2DWDB 4WZ9A 2FLMA 1DCEA 1JGEA 3K2UH 1WG3A 4LIQH 4JPWH 3U9PL 4EXKA 1CE6B 1U30A 3AS0A 1SXZA 2C9XA 1T2JA 3FT9A 1BJ1H 3SDXF 2A74B 2HPTA 5IMLB 1GYVA 2Z91B 1MZYA 4XAKD 4KMLB 4ZFZA 4C57C 2VDQL 4UM8A 2HUHA 2QGCA 4P59L 1BBDL 2QPFA 3GBLA 1AI1L 3QJQB 1TVBB 3BW9B 4HAFA 4ODUB 4PHXA 2WXQA 3DX1A 1SYVB 1BPLB 3JWOC 4M5ZL 3EO1B 2NSXA 4ETQB 2ZG2A 3KGUA 1BYOA 2WZ5A 3NDYE 1FH5L 5B22A 1GZPA 5ID0A 4ELMB 3QIWA 2HCZX 4FFZA 4GSDL 4I2XB 2Q7YA 1C8PA 1E28A 1IX2A 3IMRA 3TOPA 5D2NE 1RPKA 3I50L 4MJIB 4X99B 2OTWA 1MCWM 3GBDA 3MROA 4WWPA 2YPLA 5ITFA 5B4MD 1MWOA 1WHPA 2YUZA 3BCDA 3RE0A 2YS4A 3NN8A 1E5BA 5I18L 3FU9A 3BP5A 1F4XH 4UYPA 4X4KA 1XTLA 1MNUH 5H4ZA 3QUMA 2EH8H 3D4SA 4HS8L 2ZWLT 2FWLB 3BH4A 1ZTXL 3GMPA 5C0EB 1JE6A 1JZEA 1JK9B 3FUEA 1ZS2A 5F7FA 1W15A 5J6GA 1ET5A 1QTSA 3HJEA 3MJ8B 4ZZFA 4OUUA 2V3FA 5C7XH 2B39A 1OY3B 4H5SA 5I74C 3GSVA 4I3GA 1WUZA 1P53A 4HUUB 4D0CA 4DEWA 4JKPL 3C6SB 5CR8A 2XKNB 3SYQA 2VKWA 5LBGA 4N25A 1BDYA 4POZD 1NCGA 3MACL 1XGZA 1I3UA 2CGRL 5T33L 4EDWL 4WI7A 5DYFA 4H1LG 3HMXA 2VXUH 4JQXC 4BHUI 2NY3C 3CXFA 1IE5A 2FO8A 2WZ6A 3FO2A 4LNRB 5BNXD 2V2XB 1PFCA 5JMRA 3KXFE 2DQ6A 2VZUA 1N64L 3KPNA 5F6IC 2HLFC 2PYED 4GAFB 2JI2A 4ELKB 1AT9A 4BKSC 1T1ZB 5MEND 3FU7B 1GSMA 2V5SA 3QUYD 4HWEH 2FO4B 3WAJA 2KKQA 2AEOA 1BXXA 3K6DA 1Z9OA 3GRBA 4UOQA 3MRBB 3L9BA 5HVHC 1Z9PA 2HTLD 1RU9H 3SE6A 4GINA 4PS4H 3T0EB 4P23C 5F8QC 3REVA 2NY2D 4KJQD 1E4KC 4POUB 4BWWA 2X4TA 4TVPD 1Q1JH 4WCYH 5AKSA 2D7NA 3E9TA 3SE9L 4AXWB 3D4ZA 1OGAD 3LYRA 5KJ7E 3POCA 3EGDB 3KBPA 3QDGE 4HSQA 3FB7A 3KPRB 2PP9A 3RNKB 2FIKB 2YD8A 4NRXB 3L9EA 5H2HA 1HTYA 4NRZA 2QTEA 2BIQA 1X7TA 4WI3A 1UB6B 3LS5L 5SWZD 3QDCA 5ACZA 3QEUB 3D3VB 3GZQA 5IB5A 1BFOB 4N2KA 4B96A 2E8ZA 3DA0A 3AAZA 4HC1A 2J6EL 4N90E 3X1BA 5IWLC 5ICXB 5C9JA 4I4WB 2QT6A 4H20L 2A6KA 1TZAA 3MRLA 1OAYL 5D2NA 3G04A 1Q0EA 5C0GA 4UNVA 4IHOB 4R5XA 1UUNA 2F54E 1IGML 2R56H 1B0IA 3WHE1 2OCCB 3RWCA 2QVKA 4YDLC 1X5GA 2Z8WC 4ETYA 1UH4A 2HFFA 1F1AA 2XPZA 3RWDB 4UQ2B 1NFKA 3QPQD 4OJCA 2VDLB 2VLMD 1IFRA 1CI5A 3KWWA 4QRPA 1Z32X 2A38A 3M17A 1SVZA 3LN9A 3QWRD 4PJ5D 3ARFB 3QFGA 4GQRA 2O93L 4JO8A 5H2BA 5C2BL 1WCQA 2WXPA 1TCRB 3CVCA 5LXGL 4F7TB 1U8NA 4BZYA 5A16A 2DI8A 3FTUA 2YD7A 4Y4KD 1G7JA 3E80A 1N5YL 1ADQA 2OA9A 5EOQL 3HC0B 4OFDA 1YMHB 2Y01A 1IW6A 4Z7WE 4HWNA 5FYJL 3QPKA 3RVVC 4MKTA 3W0WB 2ROXA 1QMUA 2JQAA 4P5TD 3BH8A 3N1GC 4UDUA 3PP4L 3RBSA 1UOKA 5GGTH 1GPOL 2YLKA 2WMPA 4W4NA 2WQXA 1N5AA 2WJ7A 3VUAA 4FF9A 2WVSA 4NKDA 3T6WA 5DD5L 3E9UA 5DO2D 1DL7H 6PAZA 4HF5L 3GIVB 4OM0L 5EO0A 4I3SL 3B8YA 4MCYB 4P5RA 5ADOH 2C7FA 4WSGA 3Q8EA 3WTTA 1BOGB 3ARGD 1X5JA 2Z35B 3CZGA 4Q89A 4WY7L 4A2GA 5K39B 1R5VB 5I16A 3AYNA 1MJJA 2H0JA 1UQSA 3IFPB 3IDXH 3FU6A 5DFVC 1AAJA 1U42A 3WENA 5ID1B 3FU0A 4RRPA 1AKJA 2NW3A 4HK3J 4XPGL 5E7FA 3Q1EA 4U3CA 5EUKA 2BP3A 3PXLA 4K7FA 1KPRB 4BEYA 4GO6B 4HOWA 2FBOJ 3GJFA 2J57A 1I82A 2XIDA 4RGND 4LLQB 4BUQA 4XTRD 5L9DH 2GG1A 3CLFH 3DYMA 5F93C 2XPGA 3O2DA 4Y2DB 4OIIL 5DQDL 2CKNA 4LHUG 5KVEH 1T4KB 4CVWA 4M7ZB 4A7SA 1QG3A 3PWPD 4JFED 4JQIH 2WNGA 4K3HA 4PJGF 2PMZA 1CR9H 1E4XI 4GKLA 3ZE2F 4AYGA 4QRTB 4OD1H 4AT6B 4NKDB 4XNZB 5IEHA 3UACA 4PS3A 3IYLW 2R83A 3C6LA 4NZRL 2PYEA 2FR4A 5ILTL 1DEDA 1CF1A 3OMZA 4LEOB 4TTDC 3U6XA 4AQ1B 4ZQKA 4ZTOH 5I15L 1NFDA 1CFQB 2VDMB 3G9VA 3SE3C 1UACL 5CGTA 1PEZA 4F91B 2J73A 3CODA 2KL6A 3PXOA 4OLUL 4UMGA 1GKEA 5C09D 4ABVA 5IGXH 2UZXB 5FX3A 3RWEB 3GIZL 4XT3A 4C59B 1LE5B 1UCTA 1NCAL 2GITB 5D1XC 1NIBA 2FQDA 1BZOA 3B7YA 1MIML 2WB7A 3HCVB 1LM8V 3W0WE 5FLUA 2WXNA 1V27A 3NFNA 2JELL 4MAZA 4OQ1A 4I85A 4ODSH 1MZZA 5GS0C 3UTYA 4HIIA 3TYFB 1U0QA 1NGWA 1QFPA 5HYQB 5AAMA 1J5OL 4DO6A 3RB7A 2EDQA 2IFFL 5C6TH 2EIKB 2ESVA 5SWSD 5KG9B 5T1LD 5JW3L 4HAKA 1XB8A 3D39D 3GHBH 3HE7C 1ZLDA 1DHKA 2R29H 3DHUA 5HI3C 5HDLA 5ICZA 1GU8A 1LWJA 1RUML 4FHBD 4MAUH 4TLSA 4YWGH 3TFKD 3HG1B 3B83A 3K2UL 2BPBA 3NIGE 5B1CA 3NCJL 2IPTL 4PRNA 3S9DB 3RPIB 4UTCA 1DBKL 4OF7A 1AZNA 4WEEA 4Q74A 1QLEL 4WUUA 3QUYC 4G7VL 3P30L 4AGLA 3QQ9C 2K0RA 2VLKB 3E3QE 2WYIA 4ZTPH 3S3JA 1N0LB 3FQUB 4TNWF 3OPZH 2BVUA 4IU3B 3PNRB 4AEIH 4ZTEA 5FEBA 1EAPA 1ED3B 4RRPG 4JKNA 5CN2A 2H3XC 5LXVA 4H2CA 4OCXL 1EJ6A 3BKYH 3PLYA 3JVGC 4JFQA 4YQXH 2CUIA 1DQQB 5DMKA 4W9GC 5J13B 3ATFA 1X5AA 3KJ4C 3UTTB 5AD0B 4WUUD 3FB6B 2AJSL 5D93C 3D48R 5EOCJ 3WFDH 2UY6A 5DD6A 1KFAH 4L1DA 3FRPG 1FFQA 3V5KB 5CJ5A 3L1OH 3FB5A 3FQXA 5ITFB 5F7YC 4LASL 3SD2A 1MW1A 3LH9A 3HNVH 4N2CA 3EDEA 1NOAA 2KPNA 3LTVA 5CCHE 1AYOA 2YQBA 3P9MA 5AW5B 4WEUD 3Q2CA 4XWOC 5EC1A 5HYIA 1KXVC 2HXAA 4YGVB 1XR9A 4JFXA 3RY5A 4HS3A 5F7UA 4LCIL 4DWHA 5EDSA 4LLDB 2YPKB 4OGXH 1FL3B 3SE8H 3CXDL 3WJMB 4FN0A 3S34H 5CD5D 3IMVA 4G6KL 4P46A 4Z7QF 3QG7L 2OMTA 1O6SB 1OCWL 4LARH 3FL7A 1TCMA 3F7VB 3GBMH 2XG5B 3TJHD 4ERSL 4IEFA 2XKUA 3SOBH 5J3HD 1PG7H 1U8QA 4EIUA 5BRPA 3K81A 3MJ8A 2A74A 4NUPA 1DQLH 5D1XE 3ULVE 3ARVA 4MS8D 1YC8A 2BDNH 4HIHA 5ESQB 1TOXA 3GK8L 1JP5A 2NYYD 3B3BA 4KZDH 35C8L 5D96C 2D7TL 1DUZB 2NNAA 2CQVA 2J6WA 4ZFOL 5K59E 4LLYA 4KDTA 4XP1L 4HPYH 2YAQA 3GXDA 4U1GC 4XXDA 4ZFQA 4EI5C 4MRCA 3PWPA 1NIFA 1WISA 1WD8A 1VPOH 5IFHH 1O7DE 1UM5H 2AGJL 2BCKB 4M8VA 3STLB 5K9OB 5KYYA 1SEBA 1CGSH 3PJSA 4IRJB 5IQ7L 3TBBA 2AV7A 2QHRH 4R3SA 2NY0B 2I9LB 2QKIB 1Z3RA 3DVIA 1THCA 2BVYA 4PLOB 3W9DB 1IVLA 1OAUL 4L4JA 4J1UB 3BP6A 4XH2B 2CRZA 5I17B 4XBEL 4JANA 1RZGB 2YA1A 5DZVA 4LPVA 2LAAA 4MDJB 3GXNA 3IJ9A 4IOIB 4NSKB 1KCVL 3ATEA 2J44A 2A1WL 2VUYA 4YBLB 1XSJA 3MV9D 35C8H 2HT4C 1P5UA 3P2BA 3CBRA 3QHTC 1J11A 5T5FH 4IRSB 3BEVB 4GXVL 1E8WA 2JB5L 3MU3A 4AL8C 4JL1A 4NKOA 4LSRL 2X2UA 3AGWA 1YZZA 3U30B 1CFNA 3RLSA 1IZJA 2NDGA 4O4YL 5DRZA 1DDHA 1N59A 5LWEA 3VG9A 5F70A 3ZDXF 5JMOC 3H55A 5DJ2B 3MCKB 2A77H 1WA0X 3EJTA 3CIQA 2D3LA 2KC0A 4GUPA 4LOVA 3C60D 3SBPA 3PPSA 5B8CC 4P2AA 1XT5A 3B5TA 4WKZA 3NABL 3GRWA 1QRNA 3QDJD 4FA7B 5KSAA 5FA3A 3EJJX 5BJTA 1USQA 1VFAB 3RZCD 1CIDA 4U6VL 1KT2A 4FAAB 3P3UA 2NY5C 4I48A 1RQ5A 3ATDA 3S4SG 3VFMB 1ZCRA 5C0RH 1VAHA 3CXHK 2HVKA 1U2CA 5IMKB 4WI2A 4NM4H 3IWVA 4Y1AE 4ZS7H 1I7UA 1YEIH 2XN1A 1XZ0B 1PY6A 2XA3A 5TF1L 4PJAB 4MB5A 4BXVA 4RSVA 2A9AA 4Z3FA 4XVTL 1GGBL 4NJ9H 4QTHA 4ZUWA 5CGBA 4H88L 1A7NH 2YO3A 1EGJA 1S3KH 3GXPA 3D06A 2XTJD 3FU3A 2VR7A 3NIFB 4HOMA 4Y5VB 3OX8A 1BP3B 4GP8B 4PWEA 3AROA 3GMRB 3H7LA 4L48A 4AV4A 3MBXL 5FS5A 4Q2ZB 5JOFA 3TXAA 2EO1A 4HYJA 3PU7A 1UA7A 4APXB 4MB3A 4NQVB 4FFYH 1KY6A 2I9TA 4TL3A 3WN5C 3FCBA 4LPTA 3TJPA 2A7BA 2R7EA 2K8MA 1ECYA 3O2WL 3CN3A 3HN5A 3ULVL 4HC1H 1BCIA 4J3XA 2UYLB 4FXTA 1ZHLB 5EIVA 4ONHA 4FI7A 1AZVA 1KB5A 3VRLF 2TRYA 1GOFA 1MCBA 1CUOA 2CR0A 1RERA 2ZWSA 3MV7D 4FNRA 2AT9A 3HNTH 4AH2B 4HK0B 4YHKH 1FV1B 4C47A 1CGYA 4P46D 3MOBH 2R69H 3IWUA 4JFSA 4LLUA 2ADJA 3WS3B 2JLPA 2WOYA 1M57B 2ZXGA 1OP5H 4W9CC 3WXWL 4OUUB 2I5YL 1KG0B 4G9FE 5EU6D 1XR9B 5CINH 4PJAE 3P73A 5GGSY 5HPOA 4BA0A 5C0RL 2DWXA 5T1KD 2EDKA 1SRDA 3T9WA 3EFDL 3HG0A 1P9MC 2NY4B 5A3IC 1GUEA 2ZE0A 4GYBA 3CG8A 3ECWA 4F9PA 2A9ML 4PS4L 1OTSD 1G7QA 4OSUL 3ZPDA 5JLZB 1TQCC 4G7SB 4P46C 3WD5H 4HOZA 4OV6F 3UTWA 5FWQA 4UB0L 3C5JA 2EC8A 4JKKA 2BW5A 2YA2A 1EVUA 5DJ8B 5CCJA 3GTTA 4LSRH 5MI0B 1CT8B 1KPVB 4X4YA 4GO9A 5INCB 4PRAB 1XF1A 2VT0A 4WV1A 1BVNT 5L7XL 3L3GA 1OGTB 5I30L 4A7QA 5ID0B 4NBYB 4K5MA 2GJPA 4PJEE 4PIBA 4NPYA 2N7AA 4DN4H 3V9FA 5AB9A 1JGJA 2G4GA 3HB3D 2JI3A 4QJ3B 1I3RA 3U1SL 5KN5A 1F00I 1CK0H 5HDWA 4EN3C 4Z3GA 1ITBB 3CFBA 3SOTA 3LQMA 4QCIB 5G2CA 1JXDA 3BWUF 2ETWA 2G3MA 2JH2A 1K5NA 4BINA 3V0JA 1RK0B 5HYEA 3BN9C 2XTJC 3CGTA 1GRWA 3WIAA 4AE1A 2XN9E 1E27B 4GKSB 1TZIB 3L3KB 4P4KD 2VMFA 4V1DE 1QPPA 5D1ZB 3WJLA 1VSCA 4PRNB 5A6MA 5HHME 4K5LA 3O41A 2EE6A 4EOWH 5B38G 1S3RA 4A2FA 2D7TH 2VZ3A 1T7YA 2W9DL 4G43A 4MA3A 4RCAA 3GUTA 5F9WC 3ARDD 3GKWH 1PD0A 2M8XA 4JFOA 4R90L 5FV2A 1I1RA 3UL4A 5CXPA 3OKLB 2OMVB 2BOCB 4YLQT 2R4RA 4YXHH 4FQIH 5HYQA 1JPSL 1KCSH 3KGRA 1XF5A 1XEDA 2OK0H 1ZSHA 5B39B 1Q9WB 3Q8CA 3ULVC 3LEVH 1USZA 2J1KA 4FFZH 2VXTL 1R5WB 3G6JE 2JIXB 1MCSA 3U0PA 3PDOA 3VXUB 4FEMA 5BR2A 3CD4A 1DQDH 3B9KD 1NM9A 3AM8C 4PGDB 4MQXD 1IZKA 3VQMA 5E8NB 2DY2A 3CVHH 1JTOA 4Z95H 1DVUA 4JFDB 2BMKB 4Y4FD 2FK9A 2GJJA 3OF6D 4PJAA 4L37B 4FXGC 2DIJA 3QYNA 3X13B 3ISWA 2XXCB 2BNRD 1I7UB 4N8UA 2FR4B 5C0CA 4JFPA 1U8KB 3SIKA 5C0IB 1JV2B 4Y9GA 2EIDA 1SXAA 1P4BL 3UTZB 1HOCA 4PRHE 1RJCA 3IJSB 4EE2A 5T1JA 4MDRA 4Y88A 1HWWA 4UF7C 1A3LH 4Z7UB 2VXQL 1O7VA 4HFWB 2HT4D 2X3CA 4UQIM 4C83B 4MA7L 2WP3O 4HMCA 2BVEA 4WI5A 3T3ME 4PJIE 3ZTDC 1QRNB 4B5ZA 3H2PA 5KUMA 3KPQB 1UWXH 4GRWB 1I8IA 2LOEA 2WQWA 1Z5LB 3LIZL 3G6JB 4LLVA 4LEBA 2ZOUA 2VDOH 4JZNA 2PO6D 3PWLB 3MRHA 5EH1A 4NC3A 2F74A 2B16A 3E8VA 6CGTA 2NW3B 3RDJA 3VFTA 1IAIH 4WLCA 4L9LA 4YHIB 4BZ2H 2L8AA 3FAXA 1NCCH 3QUKA 3B6SA 4N2IA 1ZLUK 1HCVA 1NCWH 4KX7A 1YYCA 3BEVA 5K39A 5A43C 1HHIA 2WKOF 5D70L 5EZOL 3KYMA 3AC0A 3QZOA 3OAZK 4URTB 5GRVL 4BD4A 3WN5A 1B0GA 3NAAH 3QFJE 4DGVL 2YUXA 4FZEH 4IOIA 3CSYB 1WK0A 2XBZA 3X3FH 1UYWH 2GHZA 4NENB 4HQQH 4ZX3A 1CLOH 3X3CA 1ADQL 4DEUA 3L95A 3QCVL 2NSQA 3LXCA 1PYWA 2W0FB 3RWFA 5FHAL 3ET9F 4ODXA 5LBSL 4CNIB 3VWKD 1YY8A 2WIMA 2ZJSH 3EOBA 4OFKA 5H2LA 1NBZB 4GKNA 2UZIH 5IMMA 1JZ2A 1NFDF 3SDYH 2WCSA 4LOUD 5HVGB 4U6TA 5D1QA 5TDPB 4ANVA 1URZA 1BWWA 2BS9A 1X0I1 1I31A 2GEEA 2O6PA 3CFQA 3PL6A 4QPEA 4AZUA 5JA9A 5CO1A 5EF1A 3HE6B 1PZBA 4PJEB 1SY6A 1FAIH 1GHFL 4YC2B 3V52L 4WW1B 2GSGB 4YK4C 4YSOA 2Z31B 4K5OA 4FC3E 2AXFB 2XX1A 3BAIA 3DUUB 3TWYA 1IAOB 1ZA3B 3I9AA 1KY7A 4QRUB 3VFTB 1G1YA 4CVZB 5G2NA 5IUCA 1XQ4A 3KJ6A 1ZDSA 3MREA 4M61A 5GISH 2R15A 3PWLA 1MLBA 43C9B 4DFHA 1ID5I 3OKOA 3LPPA 1MF2L 1MCEA 5DTFB 2Y69B 1MCNA 2VE6A 4JHAH 5CEZH 3PWNA 3B9AA 2WAQA 4GRWH 5JXAL 3G3LA 1KJ3H 5C0BD 2F8IA 3QJTB 1JF1A 3RB5A 2EDHA 4WV1C 3IVKA 1F6AB 5H4YA 3CFIC 4XX5A 4J3VA 2YRPA 4JN1H 5BZXA 1F88A 1PPIA 1HOCB 2APXA 3FT3B 3IFLL 1S8LA 3MGTA 4HS8H 4X9IA 3WY1A 3MSPA 4X42A 4GRVA 2FD6L 3BEWB 3WO4B 4YAQA 5CCGE 3D3VA 2WBJA 2Y1VA 5DMJB 4F15B 1IC7H 1RZ8A 3QQ9D 4NQTA 3NSJA 3SB3A 1TYEB 2YZ1A 2WANA 3KW8A 4WEBL 3SPHA 1G7HA 1F3JB 4LL9A 3QNYA 4U1LB 2X4TB 1YQVH 1MUJB 1SBSH 4M5YH 4Q9CA 1J1OL 4KJYA 4TNGA 5EHFA 2Y9RT 3ZPQA 2P5WA 4GSDH 1I7TA 1X5HA 4UT9A 1LWRA 4GAYB 2LU3A 2QL1A 2PNDA 3ZK0A 4ZSOB 2GSIB 5DUPH 3LRSA 4G80A 1JXKA 2EAEA 1JYXA 2MIZA 3GDBA 3NCCB 4YZWA 3VCLB 4C4KT 3UYPB 2UXVA 3KNBA 1QLEB 4AIEA 3EBGA 3UTOA 3MLSH 2ZXDA 2P45B 4H1LH 4HJ0C 4LNRA 2VDNL 3PABB 4BEZA 3AM6A 1FSKB 1IGCH 4NWUH 4X31A 1KTLA 2RA1A 2O30A 3RP1A 1X0SA 4FTDA 2V3EA 5D71H 3BFOA 3U7AA 4E2OA 1H3PH 5BR5A 3HNSL 1GYUA 3RWIB 5IHZB 4ZJ9A 3SO3B 1BXVA 4NXKA 4QXTB 4L8SB 3HC3H 1IFHH 2AK4B 2XV3A 5K69A 3SZKC 3IGFA 2NMSA 1PCXA 3ARDB 4ISVB 4RBPH 3FQ1A 1S7VB 3JTSB 1PSKL 4LCVA 2HKFL 2XKNA 4FXGA 5E2UL 2E27H 3ECQA 4C4BA 5E2VH 3ULUF 1J8HB 3X2QB 4PSRA 4GBRA 5E6ZA 3V9EA 2R2CA 1Z5YD 4PWGA 4R26L 3HIZA 3M1CA 3GHEL 5DD0L 2AXFA 3DUUA 1BPVA 2WLKA 4YXLL 2ZUSA 5J7CC 3T6QC 3OZ9L 1S5IL 3EW3B 1XGYH 4JO1H 3UGEA 4AGMA 1JK9A 4G6ML 1OIOA 2PWGA 5C0DA 1IV8A 5D5MB 4XNBA 1PX8A 3O4OB 1MOEA 1OHZA 3MA9H 4F7PB 3D3VE 4LHUB 5TDPA 1C16B 1OAYH 4N3UA 1UC6A 3FO0H 2O5XH 3L4UA 2A9CA 2ALWA 2NY3B 3QNZA 5CJQH 3DDFA 2ESVD 1SF5A 1E4WL 2D2CC 1S54A 4H26A 5BUAA 2KLSA 3EIFA 2HFGH 5EZLB 3U4KA 1FBBA 4YSAA 2Y24A 4L9LC 4HWLA 1I8LC 2LTQB 4TS6A 5IROA 2BXZA 2NQCA 3LKQB 5DFVD 3WIFA 4AQAA 4TTGA 4NM4L 3CSYA 3T6VA 3AABA 1NBVL 2ATPA 1B0GB 2HKHH 4FQCL 5AYTA 2XHNA 3QA3B 1BF5A 3UMTA 1OHQA 5D1QD 2C9PA 4OCSL 3QUXB 1LDPL 3KVQA 3WJJC 2Y72A 4FADA 1KCLA 1XIWC 5C71A 5DVPA 4LDCA 3GJEA 3MUGA 3V5HA 1YEFH 3QUGA 4YDVB 5KSUB 5HDBB 1CICB 4KNUA 2IDQA 5GGQL 3QHZH 1HL4A 2FL5A 5HHVH 3UTSA 4Y7OC 3TEZA 4HBCL 4HUWB 4O9HL 1ZHLA 3RYMA 4NKMB 1CD1B 2DMCA 3OHMB 3KWUA 4ATTA 5J0BA 4DQOL 2X1OA 2ZG3A 1KFGA 5ITBH 1XCTB 5A3ID 4P49A 4CKQA 4HXAH 3TBVA 3BESR 2PPFA 4BK8A 1F6FB 1IRAY 1G1OA 1I3GH 1AOHA 1NFIA 1X5KA 2BOBA 5E70A 4A6YB 4DGWC 1CGVA 3LRKA 4PJ7A 5I0DA 2CLZB 1QPKA 3O4LA 3OJMB 5B2NA 2O6CA 1VEPA 4GRLA 5D93B 1QO3B 3J27A 3T3PB 3OB8A 1JV5A 1E7VA 2MCPH 4L8DB 3MV01 1ZT7A 5K9JH 2X0WA 1RV6X 1OSEA 4RISL 3SE4C 2V7HB 4MMZB 5DEGA 3EJYC 2EDRA 2B8OT 2UXGA 3RFMA 3HKFA 2IBGA 3ZE1B 3FSZA 1A3RH 3M88A 4U4BA 5AYUL 3D2UD 4P2YA 4X6DA 5I5JA 5FB8B 5GZNC 1U2YA 4KXAA 2ZFEA 2P7TA 4B41A 1SM3L 1BRRA 2C3XA 2KZWA 3FN0H 1G7JB 2UVEA 2ITFA 2QADC 1FGNL 3HN3A 5C0BB 5EDXA 3VI0A 1EJ8A 1RIVL 2J1YA 1U3HB 2H1XA 1WO2A 2EACA 1EBPA 1RJLB 5DC9B 1NBQA 1XL4A 2R0WL 3OPUA 5EZPA 2DQHL 1OAZL 1QTYT 2BHZA 4Y4FC 2NZ9C 4A6YH 3T8XB 1EXHA 5BPPA 3O6KL 1ZSDA 3QS2A 4LSQH 1ACXA 4MJHA 1U8IA 4ADIA 3C6LC 3CFEB 3S98A 3V7AE 1BECA 1TZHA 5K33A 2XWBB 4JG1H 3RWGB 3R4DA 2NY2C 4XO5A 4A2LA 1T7WA 3UJJH 1A7RH 5ICXA 4BWUA 4JAMA 4N9GB 3PV7A 4UQ3B 1KGCE 4LCYA 2FWOB 4ZMYA 2LW3A 3QEUA 2YSSB 1U8MA 4N2BA 3CFBB 3ML8A 5BS0D 3CHPA 4HKXB 4JRYE 4W70A 1SUHA 3MLYL 2VDRB 4HEME 4LQFL 1CDUA 5T1LA 3S3PA 1HSBB 1NCBH 4PJBF 3HHMA 3RZCC 2NNRA 5HGBA 4DCQB 4JLRB 2JWYA 5EEUA 5C07D 5I1EL 3KPRA 2OL3L 5H2IA 1ULVA 3T65A 4U49A 3QDJA 5GHWH 2F53E 3BHBB 5HVFB 3G6DL 1CO1A 4X4YB 4JHWL 5DI8B 2X3BA 1NJ9B 3PGCA 3D6GA 3F6LA 2D3VA 2EO9A 4B9ZA 1GZQB 5F9DC 4PJDB 4FQ1L 4U1NB 3AG3B 4O2FA 3FOLA 2IQ9H 1A9EB 3AWFA 3HUJB 1E4XL 4JRXA 4HGMA 1EHXA 4N6QA 1VJMA 1GC1C 2K9UA 2LLGA 2COVD 1HYSC 1DUZA 1D6EA 1MFDH 1T1YA 2NNAB 2LQRA 2CZNA 4NERA 4HP5A 3D12B 4ZOBA 5D2LF 4GSRA 2CA4A 1AIFB 4YEEA 3AQDA 3IVKB 1GOGA 3MLTB 4Z76A 2O72A 2A6IA 2A73A 3VI4A 4MA1B 1UJTA 5KTEH 3MUY1 3CN0A 4UWQB 2COQA 1RUMH 3JVGA 4JPKL 2EQDA 4AZ8A 1JGLH 2YKLL 4ZFFA 5B4MC 2BNRE 3TL5A 1FV1A 1LXMA 1K4CA 3EAKA 4KK8D 4BZ1L 3TN0B 1MIEL 2BNRB 2IOOA 1R3JA 3O0LA 1WZ1L 1IAOA 1ZA3A 5I73C 1AFVH 1IAKA 1V10A 4A4MA 3F65A 3LPOA 4LOEA 3C8KB 5IBUG 4CSSA 1AH1A 1OCZB 2A6IB 1ZVYA 3U7YH 2Z7WA 3DUSB 4PLKC 4K3DH 4PJEA 1F2XK 3GSUA 1SHMA 3V2YA 1CXFA 4BBWA 4NZJA 2D31B 5F1IB 5IUSA 2Q2LA 1A65A 5C0JA 5IB4B 2V9UA 3QZNA 4EPSA 4N4WA 2Y6TE 1PNDA 3U4BL 3UEZA 3UG5A 4J3UA 2AJXH 3HA0A 2OTWB 4MHHI 4QI1A 2R23B 1MJUH 1MRCL 3P0YL 3VWJA 3WTUA 2NSMA 3BFQG 2VIRB 4U33A 3WN5B 1GSKA 3LCYA 4PGZA 2AQTA 4QXUH 2XN9D 4YPJA 1PJWA 5CBEB 5LAPA 2L7EA 5F3BB 5I74B 4XCEB 2JCCA 4YZFE 4ETQA 1ZEAL 3QAZB 4NZUH 1N4XH 2W38A 4JRYB 3V4PL 1TTGA 1IM3A 3ILPA 4I87A 3V0WL 2MQ3A 4OAWA 3WBDA 4DTGL 3FFDB 5LGYA 5FO8A 1RJYB 2Z8VC 2RACA 2D4DA 3K6SA 2HT3D 5I0VA 2ZXBA 1GGUA 4LZKA 2I21A 3DSNB 2E7LC 3TBTA 4AJ0A 1P1ZB 5FA3B 5G5DA 4KAQL 5LGHL 3A6BL 2R8SL 5EUOA 1Y0LA 4XMKL 4D7PA 5KAQG 1NIDA 4KC3B 4EXPX 3BP7B 3PV6A 4M6NL 3ZR5A 1DEEA 1B3JA 4Z78B 1OT4A 2IANE 2WKGA 5AG8A 3U9WA 1PLCA 2P8LB 3GHPA 2EIZA 3QRGH 2E4FA 4KQ0A 4OIAA 2YGVA 1UXMA 3MKGA 5DSCB 4R7DA 2HVJA 3V79C 1CC3A 4RQQB 1X9LA 3KS0H 2XA8H 4OB5H 1ZGLM 4IM8A 5TJWK 2HX9A 2GCYB 4OR1A 4UT7L 3DX9B 2DWTA 4TSCH 2FATL 1QD0A 1JDCA 2YIHA 1YPZA 4OD2A 4Z0XB 1GY2A 5GS0H 1AACA 1Q72H 1QWUA 1UOWA 2IXQA 5CU9A 4DVRL 1WS8A 2ZKYA 2BP0A 5GRJH 2EXYC 3GZOA 3HAEA 1DCLA 5D7LB 1H8SA 5EU6E 2YAEA 1XR8B 4OCRL 4MYWB 2Q7AA 4J4PA 4KX8A 3BSHA 3GRGA 5A7BA 2W0KA 4F58H 1IEAB 1B90A 2DJSA 4Z7AA 3K3QA 3W9DA 4CMHB 4YOKA 4BE5A 3L54A 2XNAB 5B1KA 2EKJA 1BVKB 3CVHA 1EAJA 4EI5B 4NLHA 4Z8FL 1HS6A 5BRZA 5FKAA 3MNWA 1MNNA 2L7JA 2I07B 1WE5A 1PZSA 3GYRA 3UZCA 4RNRA 4TOYL 1BGXL 1C5CL 1K8IB 1MCOL 5D1XD 4M02A 4I9WD 1NCNA 1R24B 1QASA 2F53D 3ULUL 2FQEA 2XZAL 3BT0A 3P4OB 1AQKL 4FYQA 4UCFA 4HCRA 4GKSA 4G11A 1QR4A 3VD3A 1T1WA 3ESNA 4HUXA 2QFPA 4K7FB 5EZJA 2EUXA 4G1MB 2VOTA 3FCSA 2DMKA 2CGYA 1E4XH 4TUKL 2J6EH 1ML0A 2Z93B 4UTBL 5E23A 1DQJA 1TZGL 1B0RA 4AL8H 3LIZH 3BGAA 4W9ZA 3ZDZF 4X5XA 2XTJE 1KLUB 3EH5B 4F2EA 1U93B 3WJMA 4G5ZH 2WPGA 4BDVB 4NO2A 2JCCB 2E7CA 3L5WA 4WDIA 1QHJA 3HHSB 2CDEA 2VC2B 4KROD 4P4RA 2R0KH 5D71L 5DMGD 2D3JA 3L3GB 1WAEA 4GAGL 3GIVA 5EO0B 4XMWA 2Y06H 5I6XB 1IGJB 1CGXA 2BSEA 4DP2X 1IT9L 4MS8C 1KBKA 1QVOA 2YHGA 4PJGA 1H0DA 1F4ZA 2OXHB 3HOGA 3SO3C 2ITCB 5L6YH 3JWDL 4UAOC 1M4KA 1SZNA 1JYVA 5E03A 4FX5A 1JUFA 2I25N 3IFNH 5FCUL 4ZYKB 4HVBA 3IE9A 4TLKA 5BZWB 3ROLB 2YAMA 2ENQA 4WWOA 1UVQB 3CFMA 4MS6A 4H8UA 3N0AA 4ZI8A 3NG5A 1BQLL 32C2B 1C16A 3CC5A 3RNQB 3T0AA 3EJPA 1WQVT 1HHHA 5CZKA 5D5MA 2A9BA 1N64H 4DGIH 4LSPH 5DEFB 3Q6GL 3QORD 1J9CT 4MAYD 2QSCH 3FO9B 3MLSL 4GMTL 4L29A 1R3LB 3OC5A 3K71B 1WCBB 3MDJA 3WS3A 2CK2A 2H6OA 4XGZA 2BNQA 3F01A 3EJRA 1NCHA 4PJCA 2NW2B 4GIPD 1S7VA 3JTSA 4J3WA 2J6EA 4MA8L 2EDDA 1H8NA 2IPUK 3KPMB 4RFNB 4E9QA 1S5HA 4DAGH 2VDOB 3NK3A 2JIXD 4RAUB 2UYLA 5SX4H 4DT2A 3TS8A 4H1LB 3K6IA 2XQYA 4QXUL 1UCBH 2B08A 5CP3A 4XBGB 5ANME 1T22A 4ZX5A 3ILQC 2A9DA 4E9TA 1XGRA 3BVWA 3UPAA 4ZTOL 3I6KB 3VI3B 5JXAH 2GTZA 3IU4H 1WFTA 3PABA 1PD1A 2BWDA 3SGJA 1G9ML 1PEWA 1F4XL 1MAMH 4PY8I 1BD2A 3PL6D 3L1FA 3FBQA 1ZOXA 2FT6A 3OR6B 1A9EA 3EOYG 3U4BH 4DP0X 1B9ZA 3GUFA 2B4CL 2JKRM 2PETA 1EHAA 1MVFA 1KBWA 2HH0L 1CFMA 4GMTH 5C09E 3NJLA 2ATAA 4NI3A 4HKJB 5GGUB 2O4EA 5JHLA 1DBJL 2BIHA 2Q8AL 2DYPB 4KJYB 3TBCA 5IKCA 4HLZG 5CWSB 4HKZA 5FKPA 3QUZD 5G54A 2PR9A 1DFXA 4OTXH 4FQLH 3CDYA 3H0TB 1FN4A 4G6JH 4E9RA 2XN9B 1IFGA 1ES0A 4HKXA 3H3KA 5DZPA 1E50A 4L4TE 3DX8A 1QNZL 1NGQL 5IEHB 4YAQB 2AJZA 3PREA 3VFSB 1HE7A 3J07A 4LSTL 4FLRA 3KM2A 5F9OL 2ESVE 3FT2B 4LSPL 3JWNG 5BV7C 1OF2B 5MEQA 1KB5L 4E0RA 2LVCA 2AQ2A 2KMWA 1T5WA 4X5WA 1AGFA 3S35H 4IBSA 3ULSA 3IU3A 4PGBB 3HMWH 2EE0A 2AQRA 3BUTA 5ISZB 1SJHB 3RU8L 2LU5A 1S9YB 2ZQKA 1O75A 1NAMB 4D0CB 1KCBA 2GPZA 3D07A 2Y2YA 1HIMH 1DN2A 3VXQA 5IT2L 3Q3GA 4JPKH 3MX0B 4EN3B 4W4OA 4NNPH 3U2SB 2EIJB 2OR9L 2CPUA 3IM1A 1CXKA 3S0PA 3QPXH 2FYVA 5GGVY 1U4EA 1J8KA 3C08H 1LTXA 5JUEH 5J13C 4ZO9A 4U31A 1NINA 2BRQA 3ZL2A 5JPMC 3S96A 5C3LD 3BP6B 4XH2A 3MJWA 2YGPA 2BP5M 3CPLB 4GW1B 1PKQA 1QZNA 4X2UA 5E4OA 3HZMB 4AEIL 5E5MB 5F7EL 1MRDH 5CU5A 3WKPA 3E38A 1TMQA 3NCFB 3MNVA 3Q5TA 4UTBH 1C3WA 1CDBA 4IRJA 4ZX4A 3T0XA 1C1EH 5TTRA 4OF8A 2XPYA 1CDYA 4FBZA 4K5NA 4IB4A 3S3DB 5EBMA 2YN5A 3EDJA 3KLAB 4AM0Q 1RI8A 2Q76A 3BC9A 3RU8H 2B1AL 4ELMA 4GQ9L 1RUAL 1RL1A 1XH0A 3OKEA 2F58H 4LLYB 4W9HC 3WGUB 2O61A 5I1DB 1RP9A 4XE0A 1RHHA 4JDTH 3VB8A 1NEPA 4OF6A 2XV0A 4IDLA 1MLCB 3MXWH 1T5KA 4PW4A 1DJXA 1Z1WA 2VLME 5EB9A 3X1EA 5F7WC 1DBJH 2B7DT 3N1MC 3RFZB 3ESOA 4YSPA 4Q6IB 5EPMB 4A6YL 1F6LL 5B34A 1H9DA 1QNZH 5DO2C 1M3JA 4WU5B 4R7VA 4FQIL 4Y9EA 3RA7H 1CG9B 2WC7A 4FG6C 4FTVD 1MHPH 1NAML 1NGXB 3PQYE 3QDGA 4LU5H 1OEZW 1A1MB 1UM6H 2JELH 1JSYA 1OAKH 1OTUC 2VDNB 1E7UA 1G7MB 1NDGB 3DJZA 3GKWL 2X6UA 3SJVD 3D85B 1MKFA 1VLXA 4B60A 4L0PB 3FW6A 3EJZC 5LCVH 1K9TA 4CBZA 1LEKB 3OKYA 2QGBA 4Z76B 4C83A 4R4FH 1DQMH 2DZEA 1TNNA 4JRFA 4GLRI 3B3IB 3VGAA 3WFHB 1O9WA 4HWEL 3KPOB 3QIWD 2C9VA 1NWPA 1FNSL 2VN6A 2IOIA 5FGCB 3WIFB 4AQAB 5F9JB 4X80H 2CDGA 1BJ8A 3F5WB 1AY1H 1MVUA 4JR9L 4LPXA 1LEGB 1KN4H 3T1FA 1OGAE 2W60B 3IETA 4UZGA 4JFFA 4TVPE 4QIDA 4MX7A 4XT1C 1JWSA 2OKMA 1U21A 3IRCA 1HL5A 3FN3A 1II4E 5KW9H 1PQZA 5J11C 4YSTA 3TZVB 1N2RA 5KVDE 4K4KA 3SY6A 1S8JA 2W92A 3TA4D 1GS6X 2EUWA 5JYMA 3SYAA 2J1WA 5CHNB 4DGIL 2WLHA 1NFDE 3JV5A 2AJYH 4RGNE 2EDLA 4Z3TA 5MEOA 2PYEE 1GZHA 2JB6A 1N18A 2P1YA 2D0HA 1A3ZA 3PQYA 1HSBA 5F6HJ 3VXTB 4LIQE 3FF8A 3DMMA 4KMTH 3VQLA 5L4FA 5D7IF 4H8WH 4O2CA 4M62L 1B3IA 4TRPL 3X17A 3GUTB 3KMDA 4NQCD 3WKYA 2FX8L 2RHEA 4UTAH 5L0QC 1WFMA 3QFJD 2Y6SC 3DO3A 4JUSA 5D1ZA 5A2LH 3P0YH 4WAFA 1J5HA 4K71C 4AYFB 1QP1A 5JNYB 2MQ0A 4DEPC 4A7GF 2VDKH 3UG4A 2AXWA 3NA9H 2SEBA 3RTQB 4JVPA 3T0EE 4DUVA 1C8QA 3DQBA 3W9EA 1T04A 2CCLA 2GJ6E 4X0KA 1DVXA 1GC1H 4EI0A 2X1PA 2CHDA 5AOZA 2B59B 2AQSA 5AAWC 1C7TA 2X88A 1UD8A 1DFBL 3NFNB 3JWDC 4Z18A 5B39G 1LQBC 2AEWA 4X6BA 1ZVHA 3VWKA 1OPGH 1SHXA 5E0QA 3UDWA 2R1YB 2YPVA 3CUPB 3TYGH 2P7TB 4QWWD 2B1AH 4WV1B 2E46A 4E9YA 4KXZH 1NKOA 2FECL 1OGAA 4PJ5E 3P3TA 3JYCA 1KELH 2OMZA 2X44D 1LHZA 2IH1A 2JVUA 3S8FB 3TO4C 2PYEB 1NC4A 1KDJA 1UJ3C 3F5WA 1AANA 4JPWL 3TO4B 1KTRL 5BVJB 5I8CB 3CH1B 3A67H 4XNQA 3ZW3A 2G3ZA 4R97C 2A4ZA 3QWRA 3G6DH 1VFUA 4QHNA 3BKCH 1GZPB 1PAZA 1MI5D 1YCSA 2WWMD 4FFWC 4H20H 5T1DH 3T3PE 1TITA 4Z7OE 3NTCH 5JORA 2EDWA 4A6YA 4M1DH 5KSBE 1LMIA 1E30A 3UC0L 2GBUA 4DVRH 5E56A 2CJSA 2EYTA 2RJMA 2CWRA 3BCFA 1M6OA 5KBLA 1KENL 1CG9A 3TH2T 1RIHL 1KV7A 4I89A 3IDJA 1FPTH 1A1MA 1EZVY 4LP4A 5HY9A 3TEUA 3VXRA 3II1A 4ATWA 3ZIMA 2OCJA 3FBKA 2H47C 4UG2A 2EXWD 4BSWA 2J5LC 3QO1B 4P8QA 3V5HB 1YNLH 3NY9A 3LZRA 5HDRA 5A2IH 2RALA 5B6YA 2XQ0A 5SWQB 3MV8D 3KAAA 4HD5A 4AI7A 5B38B 1BFSA 2Z35A 4ZMPA 2RH0A 4JY4B 5KVGH 2FX8H 2BIIA 2APFA 4JPVL 4V1DD 1S7XB 3OXSB 3RAJL 2A77L 1G5GA 3D09A 3F05A 4GKNB 1NGQH 3ULUC 4GH7B 1IBGL 1TJHH 4Z7NE 4LESA 1JPTL 1YY8B 3EOBB 4J4PD 4NZ8A 3AWGA 2B4CH 3WE6B 3KD4A 5F9AC 1Q94B 2J8UE 4PS8A 5SV4A 3EH4B 1XIWA 1MAML 1E9PA 5LB1A 3QUZA 5AWNL 3ZYZA 1KYUA 4LSVH 4RWYH 4M48H 4PB0L 1EUTA 1G9NL 1QSFD 2ZX7A 3TZVD 1F4WH 1BZQK 4LLMB 3PWHA 3F7KA 4OH2A 3KCPA 4TXVB 4KAQH 2VR4A 1DQML 1O5PA 2DQJL 4O51A 4WHTA 1GH7A 2PR4L 3OLGA 4JJHA 6TAAA 4YHOL 2P5EE 4OJDH 5C0DB 1OM9A 3TPKA 4NIYE 4CMHC 5IB2B 1P7QA 3EH2A 1IBBA 5GGTA 7FABH 3AT0A 1MWAB 4ALAH 5I1KH 4CSZA 3PNWA 4DAGL 2PXYD 3R0MA 2J8HA 5FM5O 4JFFE 3I6LD 1I9IL 4G6AD 1F2QA 2EUZA 3Q3GB 1NAMH 1IKFH 1OSPL 4NZUL 4QRRB 5IEKA 2F7IA 4AM0B 2OZNA 3D2UA 4IU2B 3VRJA 1IGIH 1KT2B 3D4YA 3L3HB 4I48B 1UASA 1OCCB 4KTDL 5IQLA 1XDTT 2YK1H 4UOW0 1AMYA 3KL0A 1UZGA 3RHWF 5I1IH 2EH8L 1FZJB 2IWGA 4P2QD 3NY8A 2K70A 4OZHB 1BAWA 2CBOA 1AGFB 1NC2D 5GZOC 1P69B 5EORL 2DQFA 1YEKL 3HG2A 5BQ7A 5MEQB 3SPGA 2UWEF 1O9VA 3DECA 4HPOH 1ILUA 3WKNA 3CH8A 2P44B 4HBCH 4XMTA 1BYPA 4QNPF 1GCFA 5A1AA 5ACMA 3RGVA 4QRYA 2XCMC 2RB8A 3KCWA 1OB0A 4PJGE 4NQQA 4RGMC 2XACC 5GRWA 2WQSA 3HHRB 5FKPB 3CHXA 1GHFH 1IW9A 1F41A 1FFNB 2FIKA 3V52H 3FQ4A 5IBUB 1ZXQA 2N1KA 3NZUA 2GY7B 3WIHA 4IRJD 3T8MA 4NQDA 2NY4D 3EKCA 5I5MA 3DTUB 1IM3D 3B2VH 2WINA 4JO4H 4YSRA 5FM8A 2FZ3B 2NZIA 3ELQA 2P5WB 2YLHA 3VGGA 3LOWA 2BC4A 3TH4T 3VQ1C 1ZLVK 3A5VA 3GMLB 4RA3A 4JJOA 1CF8H 3S2CA 1EZLA 2Z31D 4G7RB 3R4RA 2GAZA 4D8PA 3UO1L 2YMXL 4XVJH 1K4DB 1S78C 4YE4H 4DSYA 4X7SL 1A0QH 2XXMB 3FO0L 1OLLA 1OGSA 5B3JE 1HT6A 2AXJA 4LF3B 4APQA 1SLWA 2VN3A 4BSVB 4NBXB 4CN4A 1M7DB 1WV7T 3O6FA 3BQUD 1G6RB 3W56A 4DQAA 4NYLA 4FTVA 4JKWA 4OM1L 1CFSA 4YNYA 1MCOH 2H8PA 5J89A 2G4EA 2IAMD 2C9RA 3EYOA 4N2MA 1JTPA 1J1PH 4OF0A 4HH9B 3FFCB 3MGAA 1XL6A 4DPCX 3QI9C 2WWOA 5IHHA 4XNDA 3RFRA 4ZTPL 5GS1B 1CFVH 5IW6B 1GC1L 2A5UA 4KJWD 1PS3A 4K8RC 4PV8B 3IJYA 5I8OL 3QFDB 5DJAA 2YXVA 1PY0A 2DKMA 3MA9L 2CM6A 4XGZB 3TGXA 1TQVA 2OJEA 2WWKT 1KGUA 3BQUA 2GJRA 4L29B 2WTOA 3T6XA 1RK1B 3OZ9H 1EDHA 5EORH 3T2LA 1YNTA 1TG8A 1ETZA 2EEDA 5DMIL 4NWUL 5GXBB 3UJIH 5LAXB 1PFOA 5INCA 3TTYA 4TOYH 3BVVA 1YPZE 4UOZA 1LE9A 2ERJC 1NKGA 3I84A 3OKNA 4TUJA 3CC5B 3RNQA 4BQ8A 1CD0A 2ZP8A 3SY0B 4YHMH 3B2UD 3BVTA 3ELAT 2ITCA 4WWKD 3EH3B 3ZZLA 1QW9A 4AE0A 2DDQL 4CW1B 3OAYK 1U91A 5AD0A 2FHBA 4AG4L 3MV9E 3T4YB 4HUNB 3OGOE 4U0QB 3JV4B 4K94L 4N0CC 1HL8A 3HTLX 4M8QA 4NPJA 3D18A 4Y5XB 2BP8B 4D0BA 1ORQA 2CIKB 1G4RA 3HAEH 2YK1L 5H37H 1RURL 4AIZA 5E0FA 3OMAB 2D7PA 5CLXA 2HJLB 4ZMZA 1G9NH 4MB4A 4KMTL 1TU2A 3C09B 3KJ6H 5KAQF 4NLAA 2HKAA 3G5ZA 2NR6C 4A68A 4ANKA 1EMTH 2AABL 3QDMA 1V3JA 2N7BA 1PY9A 1OTTC 4TL5A 1UD2A 1JGEB 2VL5A 1PZDA 5FYKH 4UANA 2GK2A 3X14A 5LGJA 4N6RB 5KVFL 1NLDH 1L6PA 5H2NA 3DVGB 2ZUWA 5E2WL 4UYQA 1IQDB 4IBLT 4N68A 2ZX9A 3FYIB 1EDQA 2O5YL 4PLJD 3P54A 4JDVA 3I74A 3VWJC 1WZMA 1NCOA 2EECA 3V6BR 4GSXA 3MNWB 1P6WA 4Z7VF 3VVVA 3IJEB 5C08B 4XCFL 4OT1H 4PJ5A 1NGWB 4F7CB 2ID5A 4HJJL 1MI5B 2GC7C 4U1KB 4YBHA 5IV2B 1FL6A 4MJ6A 1D7CA 1GVIA 3M6DA 4KI5D 3DV6B 1J1XL 3KW7A 4JY6B 5F89A 1IBGH 3L1EA 2ADGB 2G5UA 3DBXB 4NCC1 1IEBB 1ZJAA 4IGBA 4X4ME 5EF3A 5D7LA 4ZQTA 2KT6A 3G7TA 4J3OD 4PBXA 5EG6C 4DETA 4FA6A 3VD0A 3ASWA 3T0BA 2VW7A 1QWHA 2WSPA 2NUPB 3ZGIA 4PQXA 1U8JA 2CJTA 4ZBJA 5ITBL 4PFEA 1IEBA 3O3DB 4HGKC 3IGAA 5I1LA 2KDYA 1KNOB 3NJKA 4F1SA 2P5WE 4GQ9H 3NJJA 4WNQA 2BX5A 2Q20A 2WNXA 4GNKB 4BA8A 3RGVB 4EMZA 4WJ5B 2QR0B 4G8GB 3BAEH 1MI5A 4X9BA 2UZYA 1ZK9A 2CKBA 4K3GA 4NB7A 5K93A 2WUBL 3RGVC 3ZO9A 1BVOA 4V1DB 1CLOL 1REIA 3UAJA 3ZDXB 4OI7A 2DV6A 1XGTA 4FKKA 3VD1A 1SXSA 5HHOB 2QKIC 4A7GA 4N5UA 4ZODA 3LJ3A 4MA3B 2J5WA 3FRPB 5J11B 3O6LL 4MJID 2H2SC 4D8OA 3RJDA 1QRND 4TSAH 2OYKA 4DKFH 3IPEA 3X14B 2XV6B 1TZ8A 2R69L 3DBSA 4P23B 1K85A 4F2MA 2PCXA 5C0AB 3DX7A 1IM3B 4TTDD 2BHYA 1QEWA 3LAFA 2EVFA 1ZVNA 1VEOA 4X7SH 1CL7H 4F8QA 3U9UA 4ONGH 3BAXA 1BVNP 3UBGA 1KCRL 3TT1H 2VDOL 2D73A 3HZKB 3ILPB 5IB2A 4ZD3L 4IRSA 1RFDL 1Z6JT 4JM4L 4PJ8B 1XH3A 5BZDA 2YQ2A 3O2WH 3VW7A 4FYTA 5IY5B 2ALAA 4MVBD 1XGQA 4XB7A 1FLRL 3VJ6A 4XP6L 3QORB 1JK8A 3CZFA 4R84A 1URIA 4XCCH 2FJGA 1KGIA 4FOMA 2XWDA 4P9ML 3WFZA 2N59A 1LO2L 1H6TA 2Z73A 1L7IL 1Q94A 1G9MC 1IGFH 3PDDA 1K5WA 2FATH 5IB4A 4TMPA 5T1MA 2ZICA 4QHKI 4A67A 3W2DL 5FHBH 1OSZB 4BM7A 5CD3B 4M5SA 5EA0L 4HD9A 2BJMH 2Y7SA 3AMLA 3UCQA 3IKCB 4HEPA 5LDUA 4LBAA 3V4VH 1SJVA 4FULA 3X12B 4KK9C 5I19L 2GW5A 5LAXA 1HHKA 4OCLC 4OCRH 1OXYA 3S35L 2WO4A 4AK1A 3QUXC 3NSBA 2BRRH 4AK2A 1HJBC 4NX0A 2WCPA 3OKDA 1BVZA 3WUWB 2NOYA 3QWOB 2Z6FA 4PJXF 3HPLA 5E8PA 1BJMA 1ZA6B 2ICWB 3QR0A 4ANUA 2NXZB 1YQVL 4M5YL 2WZ0A 4EI6A 3ZL1A 2AANA 2JXMA 3B1TA 2BNRA 3CC1A 3N43B 3IXTA 4NQED 3UFIA 4QAMB 1N70A 4P2QA 1NCDH 1W9XA 4OW6A 4OIFA 5DQJB 5KBNC 3FUDA 4G9FB 4JG9A 3PHQA 5GS2H 4G7YL 3WGVB 3VNZA 3BLPX 2M1KA 1TEFA 1MIMH 5IHLB 2ORBH 5KBKA 1A4JA 1MAJA 1MG2C 4N5ED 2AQ1A 2ICWA 1A14H 2QPSA 1NL0L 1RD6A 2XN2A 5SV3A 2MCAA 4YEFA 2OXGB 3V8OA 5EEXA 4K5YA 2H26B 2ICCA 1PG7X 3SN6N 2MHAB 5IJDC 1MFCH 4QY8A 5DJ6A 3KG5A 3SDCA 4GT7A 4UV4H 5IFAL 1A3RL 2I9TB 3VDBA 1F58L 4A66A 3MRFA 5EU3B 3HE6D 4I3RH 4MMZC 3DGGA 4YSDA 5I8EB 4ZMNA 1QKOA 4D8PB 4YDLB 5L88L 3LZFH 3QPQC 1SLVA 4MXQC 1JGUL 2CXGA 1FGNH 4O2FB 4PRPA 4Y16B 5ISZE 4GBXD 1J5CA 3A4FA 1HOEA 2D9QB 3NIDF 1EH9A 1TTAA 3LD8C 2GK0A 3ML9A 2FZ3A 3MRPA 3RDTC 5DCCA 4Y1SA 3ARGA 3KPLB 1A14L 4OJAA 3OJVC 4Y2DD 5IW1B 2CLRA 1FFNA 5FGRA 4MD4B 3MRIA 3VYNA 2E86A 4LKCA 3UH8A 1VPOL 1CK0L 4M4PA 2YSSA 5GQBA 3KS0J 1I9JL 1KXQE 1R3HB 3LHPL 4FE9A 3VFRB 1ETA1 3CLEL 3QYCA 4BV1A 2O6EA 1KWKA 1FPTL 1EEYB 1M2VA 3S3BB 4PRIB 5F0PB 1U8MB 3SDAD 3MUUA 5JNYA 5KS9E 2CALA 3KM1A 1JG9A 5AW0B 5H37G 2C34A 5DK2A 2XWBA 3S36X 3Q6GH 5DA0B 1I8MA 5JXED 1FCCA 2V2WB 5HI4C 2ZP9A 3CFEA 1X7QA 5J1SC 3N6YA 2N56A 3F7PC 3LXBA 4HX1A 5GPRA 3RKPA 2WM0A 3KWTA 5C09B 3ZU8A 5JPNC 1JPFA 4PBWD 5HI5C 5FR3A 4AM0A 4AYDC 4PLNC 4FG4A 1JD7A 3CIAA 3EOAA 2BWQA 1QBBA 4X8GA 3IFNL 5FCUH 2UZYB 2HUEA 3WCYA 3U46A 4X7TA 3ILEA 1RJZB 4UUJA 1X4YA 4YJZL 3F2LA 5C0BA 3VHZA 2ZOKB 3DPBB 4CADA 3EJUA 3UPCA 3X3FL 4ECNA 4IMKC 5JJJA 2AAAA 2EKSB 2JF1A 1F97A 4RWHA 4XVUC 4TSAL 4G2AA 1JFHA 1PQZB 3BP5B 4FFYL 3I9GH 4JANB 2HRPH 3CZKA 1H3XA 3ZQXA 3AB0C 1NFDB 1Q9KA 2IALB 1PLGL 3NCBB 4JDEA 3A23A 3KPPB 5IB3A 3MLVH 1D5XB 1MW2A 2G2PA 5DRXB 3W82A 3CNKA 1N0XH 4X0NA 3SQBA 5H94B 4MXVF 4L4VE 4I2XE 1BQHG 3AXIA 4JHWH 1VESA 1DJIA 4KTEL 4LDLA 3A47A 5KS9B 4MGXA 5DQ9B 2L6XA 5ESAB 2OP4H 1MW0A 3V6OE 3ZZQA 4DK6A 1ZK5A 1GGBH 3FCTA 5AAMC 1FFPA 1N6UA 4BK4A 4IIQB 4Z5RB 1JN6B 4G70B 5ABAA 3TJEH 3IDYC 2AQPA 4QUOA 3ABLB 2A99A 5FGCE 5B7FA 2Y02A 3VD9A 3MLUL 2CBMA 3I02A 3HE7A 1G7LB 3MCLL 4DEPB 4DESA 3NSFA 1KPRA 1SUJA 5KJ4A 2DQTH 2Y23A 1ESOA 3IN2A 5DR5H 2ADFL 4ZFZB 1A1OB 1ORSA 5MENE 4U6HB 3BUPA 4YPGA 1P4IH 2BSCA 3L5XH 1BD2D 5FW7A 5KSUA 4HEPG 1AR1D 5D2LA 4N0UE 5G4MA 1RZ7L 3ZE0F 2X10A 1M1XA 1P5VA 3HN8A 4WI8A 4H0LC 1COBA 5FW6A 1U8LA 3QUXA 4TLTA 5F7MC 3P0GA 1U8PB 2AK4E 4BGDA 1QTPA 2W9EH 3BXNA 2DQGL 3MRDA 1S9XB 5LDSA 1MJ7H 3P3SA 3WIIL 3MZTA 1EA9C 1I1AB 1QBAA 3PHOB 4HWZA 3IB4A 3L9RA 3G5YA 3T0WA 1QFUH 2ZXWB 4K07A 1I1YB 5CILH 3L3JB 3FB5B 2NYKA 2PTTB 1AHMA 2K3HA 4TM9A 4PJEF 4R2GD 3V6FA 2XVBA 1I7RB 3H4FA 4XXWC 2CAKA 3ZE0E 4A2EA 1RURH 3BDXA 4K7PH 4HWUA 1MFCL 1OB1A 3CLFL 4OV5B 1QFWL 1UFUA 5E9DE 4BUGA 1INEL 4M7JH 4X8CA 1YECH 3S5LG 1OV8A 3PAYA 1T6BX 1EO5A 2OSLB 4GW4A 4MLIA 3UAJD 4QRQB 4HV8A 3M17B 5DLML 5JW4R 3QFDA 4FQQB 3DNKA 1EAPB 3I6LE 4FS0A 2PLTA 4OLZH 3MRJB 2AJXL 3GSQB 4DUWA 5B6WA 5JHDA 2QEJA 4HJTA 2E9JA 4MMXA 4N6HA 3ZTJH 1D5RA 3DXAA 3FFCA 4XPBL 2IH3B 4I18B 3TVMD 3D4GA 2XWTA 1FL5B 2CDFB 4YZFF 2VXVH 1DYZA 3T09A 1M7IB 1KJMA 5FCSH 4Z7VA 5I30H 3RPIA 4JJ5A 2EVGA 2V7NA 3ZHDA 3VA6A 1WBZA 1U8CB 2A6KB 4BSVA 1MFBL 5EU5B 3FT2A 3WSQL 3BPLB 3FUHA 1EFQA 3DX8B 4JW3A 3UTQB 5ACZB 3ZKSD 3BPLC 2VQTA 2TAAA 4YK4B 2VLJE 2HN7A 3M7FB 2ZUTA 3DETD 4JO2H 4FNSA 3VFRA 1G7PB 5IVNA 1TUPA 1Q0XL 4KO5A 3TCLA 4YHML 2FRGP 3HC2A 3T2NH 4XAKE 2XQBL 1FIEA 3LKOA 2XY2A 1JGLL 4NRXA 2YD3A 3GMLA 4Z7NF 4WWNA 4IRZA 2A6DA 2C3HA 1EWHA 1CDCA 4WY7H 1L9HA 3UIZA 1IKOP 5J56B 1YUHA 4EO5A 2QJDA 5HHXH 5MHSD 1VDGA 3O4OC 4KRLB 1NPUA 3WNMA 3F58L 2ZWKA 1RZ8B 1MUJA 2E76C 2Z7ZA 3WLBB 1EX0A 5CN1A 2E74C 5L4IA 1ONQB 1TVHA 3JWOL 4LEXL 1A7OH 3MRMA 4N24A 3IETB 2X9WA 1TZGH 2YEVB 5ADPL 4GEJA 3Q13A 3BAYA 3HLAA 3GS0A 3CFDA 2DIEA 2HLEB 3DJRA 3L4WA 5BQ7B 1S9VA 2MOVA 2FCBA 1MSPA 2FAUA 2VC2H 4QJ4B 1A4AA 3QO0B 3GSNA 5BS0B 5IVXE 1VERA 5AB1A 1NCJA 2MKWA 3MA7A 3IF1B 4IS6A 5AAWA 3TZVC 1AZBA 3HNSH 4HCFA 4JJ5B 1SHSA 3BISA 2Y7LA 2FX7H 2D4FA 1R4XA 5AVQB 2PPCA 3F04A 3DTXA 43C9A 3PWNB 2I26N 4NNPL 4MFHA 4KTYA 5F3FA 1KFAL 1CICC 3PJLA 5L4MA 4L1BA 2GSMB 2W94A 1JAEA 4OLXL 3H53A 4FRWA 4I77H 4WU5A 3ZVVA 5CJXA 4KNSA 1ZT4A 3GINA 1QLRB 4Y2OA 2JXMB 3EFFA 1CF8L 3A21A 3J8F7 3AU1B 4V2BA 1PAMA 3R1GL 1L9NA 3HE6A 2DD8L 1QATA 2J2ZA 4C55A 1JV6A 4AY0A 2CD0A 1N7ML 1WWBX 3NIDE 3KCPB 4HCRH 4HIEB 2VDLL 3ZEVA 1WA2X 2OV0A 3ECBA 4KXCA 2X6VA 3ZDXE 1A1NA 3JYBA 3MV8B 5SX5H 3S4SA 3SDAB 2VXTH 4TUOA 1DJHA 4FI6A 1Z2KA 2E9GA 3I2CL 1CFTB 2BRDA 4WW2A 5HTSA 3ZKNC 5L2KA 2YPLB 2DYSB 2HAZA 3IJ7A 5DDHA 1JPSH 3BPCA 2DM3A 4G8AC 3MV7B 1J7VR 4RAVB 1UH2A 1AP9A 2OQJB 4W4OC 1R3IL 3AMKA 4MQTA 3FTGB 4P3DB 3B9KA 1LP9F 2W9DH 5BOZG 2F93A 3JV6B 1JZIA 2AJ3A 3B9DA 3MNZB 2Y5TA 5DT1H 1UADC 1YMHA 1Y6KR 5BOJA 4NBZB 2ZWNA 5H2MA 1IILE 4NQCE 2JTDA 2ROYA 2PR4H 4NAMA 4NZTL 5AL0A 3ZDYE 3E2HC 4BDVA 3MACH 3STZB 2OAAA 2FLBT 5FOJA 4F7TA 4BCYA 1RSFA 4BSWB 3VGFA 1KBPA 4AEFA 4UT6A 4UQBA 1AXTH 4NZRH 2EINB 2F5AL 2F74B 5AKRA 1DJGA 5T5NF 5IIEA 5GS1C 2QQLH 4JGMA 4LLVB 3DX4A 3FF7A 4UQ2A 4WIQA 3LS4L 4AQEA 2GTQA 3C60B 1HE8A 2DQDL 2EXSA 4XP1H 4M8UA 4JN1L 3DK2A 3MYJA 3P77B 5BOPA 4FL4B 3QXVA 5C7ZA 2QDWA 4XX1G 4PGEA 4Y5YA 4XB8A 1XCQB 3Q01A 8PAZA 1FORL 4I5BB 4IOSA 4ZDHB 4NFDA 5DEZA 2X12A 5E6RB 4Z3IA 3D0LB 2ED8A 4GJTB 1RZ7H 2NXZC 3CMGA 1R47A 1AE6L 3H1ZA 2MCPL 5T1KA 2WXMA 2DDQH 4R96B 3KPPA 1T0OA 3MOAL 4RDQF 4W93A 1FFRA 2AI0H 1V7MH 5E1AA 4L4VD 4PJ8C 4NQEE 2RIKA 2BMKA 3EHBB 1ADQH 3APDA 3RZCB 1B4LA 3V4UL 4EIGB 4TLUA 1F42A 3RTQD 4NI6A 3FB7B 3VACA 3MCLH 4CBPA 4F8NA 3NPSB 4OFYA 5HI4D 1ZLSL 3QZWG 4K3DL 3OLIA 4U1SB 1N7MH 2R2HA 4MB1A 1MREL 3BZ5A 5CGYD 3PWVA 1UXSB 3APMA 2WP3T 3Q7JA 2HLAA 3DX9A 3KPSE 3THML 5HGDA 5EU6B 4JFDE 4XOEA 3S35X 5FK9B 1F90L 3JTTB 3V6OA 3Q2NA 4DS7E 3I2CH 1H9VA 4U1KA 2PCPA 4X7TB 3R7QA 2DQEL 1PMYA 2JMRA 2OX5A 5EN2A 4B9FA 3OR7B 5D7KE 1JF5A 1IAIL 5J9PB 2XFXB 3L9YA 1LO0L 2OMVA 3WFDL 5CJQL 2Q6WB 3RGBA 1L0XA 2JSFA 3VDCA 5CEYA 2BOLA 1R9FA 1SPDA 1ADWA 3DJTA 3FQTA 3REWA 3TA3C 5GSVA 3VYOA 5AZEL 3P3RA 4N6RA 1A64A 4Z0BL 2F95A 1QSVA 4JO1L 5DK2B 1K5NB 1XF4A 2G5BB 2VC2L 4NUMA 3M1BA 5HPMB 1BX2A 2ZCKL 4R2GB 3GMNA 2GC4C 5D7LD 4MD0B 5DZOA 1BMGA 2JQMA 5FF6A 2AEQH 1PDKB 3MLYH 4HUUA 1S7QA 1MWAH 2YD0A 3UO1H 5JIKA 4OKVA 4KKRA 1YYMH 5EN3A 2HJFB 3S5LB 2B2XL 3SPVB 1BMZA 4ELMF 5AUMA 1MHEA 1X0K1 3TNNA 5AX0A 3BLBA 3R8QA 1MFVA 1WEJH 3GSXA 5TPWH 2P52A 4RMTA 3V2WA 5D1ZC 3OL2A 2AMUA 4YWGL 3TZVA 4DP6X 4UTAL 4XPTH 1PZ2A 1L3NA 1RZJC 3OTTA 1OK8A 1MHCA 3IDNA 3QQNA 2VM3A 5HHQB 3L3JA 2OSYA 5G4NA 3DVNA 2YZ8A 5D6CA 3VH8B 1CXIA 4X99A 3OG6B 4QRAA 1PF3A 2K6ZA 1MDTA 3QUML 3A22A 1E28B 3HUJF 4Z77B 4HW6A 4ENZA 4PUBH 4UT6H 4P2OB 3B3IA 1CVSC 2YEQA 1IAII 1KCKA 5IBTH 1G5AA 3UBXI 4ES8A 1MHEB 3DUSA 2VMDA 3MLXL 4ICWA 3WL9B 2VZTA 2ADJB 5CZVH 2B4CC 4NO2B 3FC8A 4TQPA 4M7LH 4GEIA 3ILDA 4FABL 5AYUH 3VNYA 1J0IA 1HZHL 4G9FA 2FEEL 3H4HA 2IWEA 1BX2B 3QWQB 1W6LA 1D6VH 2AQNA 4OF5A 3LZFL 3GS7A 3QQXA 3QS3A 4FNTA 4OZ4B 3SYPA 4GAJH 1ND0B 3AS1A 2R7EB 1U58A 5ALBH 1ZAGA 3BZEA 3WUWA 3F7RA 1F4HA 3DRQB 5DVKA 2F61A 4K8RL 4LF3A 1IE4A 3SGDI 4NN6C 1TTCA 3HPJB 3OKEB 5IQMA 3FO1B 3B43A 3X12A 1KLFB 3BGFC 4H8WC 2MKLC 3FUNA 2XOTA 5EN2B 5BV7H 4B0MB 3GMRA 2VR8A 2APBA 5F3HB 4JQVA 5AWNH 2V2TB 2YD9A 2IVFC 2Z0UA 3RVTC 1ODUA 4FNLH 5DRXA 4XPFH 3HR6A 4CILA 5I6MA 2XNAA 3M1OA 2I85A 4X5RA 3RL1A 3OX8B 3B37A 3D87B 4XHQA 3TN0C 4B0MM 4HU2A 3T0EC 3E8UL 4U3XA 5T5FA 1M6UA 4DKAA 4X8XA 1C5BH 4I0PB 5AENA 4JLRA 3WNIA 4BH8A 1LLAA 2ZYHA 3HFMH 2J21A 1B4JH 4HDIA 2UY7A 2QVFB 1JBJA 3HKZA 3WS6C 4LPCA 1XH3B 2XJKA 1CE1H 4BHUA 4HF5H 4YX2L 3PYCA 2X70A 2DLFL 4E5XA 5D9SA 1WFJA 5T3ZH 3SDXB 4I0KA 1OSYA 4LCYB 1HZKA 4HPYL 1PZCA 5JIMA 2W9EL 2G0LA 3EO9L 5I8KL 4WI9A 1NAMA 4P4KA 4IGBD 4LCWB 3QUZC 3Q48A 4LRIA 3H3PH 2AZUA 1BHGA 2VQ1B 2R2BA 4JFUA 3VXMD 1CQKA 4XMVA 3FONA 1JXGA 4IIQC 3IAPA 4OCSH 2GI0A 2PO6B 3D9AL 3M86A 4KGJA 3U6RA 4Z3HA 2NCMA 2X53A 3WTWA 3RTQC 3S37H 2GIXA 3KXFA 3GSOA 4YSCA 4XRCA 3MKKA 2DQIH 3DX3A 2CPCA 4KI5C 3N1FC 4FD0A 3U36B 3BZFA 1TQWA 1A6TB 5D9SB 5F7BA 1IBDA 3PL6C 2WYHA 3SDXA 3TV8A 1MFAL 4HGWA 3V6OC 5C1MB 4BZ2L 1NH6A 3OGCA 3RVTD 3MLVL 5E8EB 2PPEA 4BH7A 5C8JB 5IQ7H 2PF6A 4QF1B 3T6ZA 2F8OA 3MRIB 5D7SL 1UM4L 4XZUB 3EYFA 3GI8L 2YMOA 5CBEA 4ANXA 1PVHA 4J1UA 4Z0BH 1GAFL 4I1RA 1ODAA 4B27A 1BFVL 2XETA 3NA4A 3O6LH 5AOIA 5J1AA 4HS6A 2I9LA 2QKIA 2XSKA 3VWJB 4DZBA 2XQYK 1JPST 4P5KA 2XTSA 3UYRL 4JPIB 3V6ZB 4B6ZA 2DYPD 2HYMA 2O5NA 1CLYH 2F08A 4WW2B 4YHNB 1J5DA 1A22B 2YMXH 1P1VA 1YNKH 3MV8A 4Y2LA 3RL2B 1S7UB 1X6NA 3FKUS 3PWPB 3H8NA 4KI5E 3U1PA 5FDWA 2BK8A 2BFVH 2OL3A 4MAYC 3B4NA 2VN7A 1GIGL 4XN2A 2J2ZB 3NJHA 25C8H 4CL7A 4DP4X 3MHZA 4N0CD 3EYQC 4KO7A 3SGDH 3TURA 1Q1JL 1XCTA 4G8IA 2H26A 3OHXB 1UURA 2ZX6A 3WFCL 5F7NC 4JREB 3RIAK 2VZVA 3R19A 2X1QA 5FFLA 1F11B 5JW3H 1J1OH 4ZOCA 1GGYA 4GI9A 2EABA 4JB9L 4PJ7F 2LT9A 4KHXH 4QHUB 4DZ8B 1UWFA 4IK6A 5EO1A 1XH2A 3ZSTA 4FQJH 3NCXA 1Z9MA 5TGZA 1KYAA 4R90H 1SN0A 3LNHA 1K72A 3HG3A 4IOSD 5L8JB 5KEZA 1AP2B 2FD6H 3QFJB 1G94A 3CZLA 1JHLL 3K2IA 1YVLA 1IBFA 4ALAC 5A2CA 4WU7B 1H3TA 4JFXB 4D9LL 5HP5A 2AJVL