4FA7B

Structure of recombinant cytochrome ba3 oxidase mutant a204f from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
source organism Thermus thermophilus
total genus 49
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4fa7B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4fa7B02
3ABLB 1UAZA 2P80D 3FSAA 3IBOA 4HYXA 4BK5C 1ADWA 5I5JA 2CALA 1S51A 1A4CA 2PLTA 4A2FA 4P5RA 3BVDB 5F8UA 3UTWA 2XX0A 2YXWA 3T9WA 3UACA 5B6WA 5B6YA 4AMIA 3NP3A 1PZBA 4E9SA 2J57A 4CSZA 5DHHA 1WA1X 1KDIA 2FTAA 4WAVA 2XWZA 5PAZA 4EF3A 7PCYA 1QKPA 1ET8A 3JT2A 2I7OA 2YDOA 2OV0A 3EH4B 1SDDB 4UG2A 3FSWA 3GXUB 3FPYA 1JOIA 1V54B 3WKPA 2YAQA 4A66A 1FBBA 3G5WA 4WW3A 4NAJA 4KLYA 3A7KA 3PAVA 4DPCX 1S52A 2GIMA 1BQKA 2BP0B 2BWIA 5B2NA 1EHKB 4WKXA 2VW4A 3ABKB 4YSQA 2YCYA 3NJLA 3UG9A 2VW6A 1GR7A 1C3WA 4UF7C 3ZPQA 2HX7A 1OCCB 2VMJA 4YSDA 1YLBB 3S3CB 1PY6A 5D4IA 4TXVB 3TU6A 5JJJA 1SHWA 2FQEA 2Z55A 4XTOA 4HHWA 4UAHA 3T6WA 1E5YA 4XT1A 3REYA 1HFUA 2JKWA 5J7AA 4A2GA 3S3DB 1BXUA 1BM1A 1MZYA 1NIBA 1CC3A 5E9NA 3WG7B 3TASA 2KSYA 1FBKA 2I35A 2YAHA 2PP7A 1S54A 2NTWA 1C8SA 3QDCA 3EF4A 3U25A 1NDTA 4YSEA 3FU9A 1SJMA 4DAJA 5B1KA 1CYXA 1XIOA 5FJGA 4YL4A 2EIKB 3UTXA 1ASQA 3T6VA 5TK2A 2IDFA 4ZK8A 1E12A 1OE3A 1B3IA 1JZEA 3CVDA 1RCYA 2RH1A 1AACA 1W6WA 1P8HA 3HAPA 3T71A 1AP9A 4HALA 1MZZA 2QPDB 1ET7A 1GUEA 3X2QB 1FA4A 2R4RA 5B34A 1WAEA 2UX7A 4JKVA 2EILB 1CUOA 5H2OA 1J9TA 4GBRA 1AQ8A 1M0MA 2YCZA 2XLLA 1OCZB 4MQTA 2CCWA 2I1XA 4JR8A 4N4YB 4HYJA 3V2YA 2BP0A 2MRYA 4DPBX 3NYAA 1URIA 3KJ6A 1W8EA 3BQVA 3NP4A 4IB4A 2XVBA 3EHBB 5AZDA 1IW6A 3CG8A 3T6XA 4E9TA 1IXFA 2VM3A 1J9RA 1KYAA 2VN3A 4FBZA 4DP7X 5PCYA 3SBQA 3ZEVA 1OCOB 1MGYA 1L9HA 1V10A 4QKTA 3UZAA 1AS8A 1KBWA 3FU8A 3X1NA 5I6LA 5D4JA 2G87A 6PAZA 2H3XC 3QJTB 2YAEA 1KMEA 2TSAA 2X72A 2DWSA 2UXFA 3NSCA 4DPAX 1PAZA 5JJEA 1Q5JA 1HAUA 2AT9A 5LDUA 2LNLA 4NC3A 1J9QA 2YDVA 1KCBA 4QLWA 2OJ1A 3QJSB 3OMAB 1ZV2A 2J55A 5ITCA 1BYOA 4HWLA 2GC4C 2Y01A 2YXVA 2WJLA 3N2JA 3V2WA 4AKOA 4BV0A 3QPKA 5JJNA 4YSCA 3ZPRA 3NSBA 2J5WA 4QI1A 4N8UA 2Y02A 2ZOOA 2BW4A 2DYRB 7PAZA 2PCFA 5TGZA 2HPYA 1L9SA 2HZHA 4IARA 2AVFA 2LLNA 3NJMA 3ZX1A 1AR1B 1IKOP 1NZRA 5G28A 4YVUA 4YSUA 1QHQA 2A3TA 2W8CA 3OMNB 4EJ4A 5AX0A 1ZPUA 1N70A 5F7BA 5TK4A 1RKRA 1BRDA 4L6RA 3CZUB 5G2AA 1OV8A 1AZNA 4DP9X 1PY0A 3X1EA 1GS8A 5G2DA 3EH3B 3RYMA 3T45A 1QLEB 4LDLA 1C8RA 3OQRA 1NPNA 1KG8A 5B35A 4DKLA 1J5DA 1IBZA 3VW7A 1Q5IA 5ETZA 4A67A 4KNFA 1MG2C 1U19A 1X0K1 4BWBA 1R1CA 2Q5BA 4KOBA 1O0AA 1JVLA 4G7RB 3X3CA 2AANA 2FQFA 2UX6A 3CVBA 3GYRA 4HIPA 2YCXA 1BQ5A 2FQGA 3UAEA 1JZJA 5DHGA 3UTYA 2JAGA 4DP1X 2VSMB 4KO7A 3SQRA 1KDJA 3AG2B 5H2MA 4JQ6A 4YSPA 3QAPA 4QIDA 2XX1A 3SBRA 3TBBA 4W1TA 4YSSA 4LDEA 1E0PA 1X0I1 2PCYA 6PCYA 1LN6A 4YSAA 2WO3B 5I6OA 3PXOA 1KCWA 2BO0A 2Y00A 5ITEA 3ABMB 3NSFA 4F2FA 4HCGA 1L9PA 2IDQA 2VSKB 3VI0A 2JXMA 1GY1A 3NSDA 3UTVA 1A8ZA 2TSBA 2JAFA 1KGYE 4AX3A 1KBVA 3WNIA 1PNDA 4N6HA 3V9EA 4MQSA 4PXFA 1PNCA 1PXRA 1UATA 4YSTA 2AFNA 2QPEB 1MDAA 1SFHA 5FC9A 2J56A 1AS7A 5H2PA 1AS6A 5A44A 4DJHA 1M0KA 1BYPA 3S3BB 3RFMA 5BR2A 1N68A 2IDTA 2XXFA 3ABGA 3HANA 1E67A 1RZPA 4FPDA 3EH5B 3OAXA 5H2HA 1QKOA 3HAQA 3NJIA 3S8GB 2M3GA 1PLCA 2MTAA 1NWOA 4FAAB 5H2IA 3FT0A 1I53A 1J9SA 2DWTA 3COCA 2VW7A 3H4FA 3MBWB 4F2EA 2Y04A 3QJVB 4G7QB 2J4YA 1JFPA 3PDSA 4XTNA 1A65A 3NT0A 5F7AA 3ODUA 2ZZLA 3NYKA 3OE6A 1JERA 4J4QA 2Y69B 5A8EA 4PXKA 1R84A 3H56A 3AYMA 5AX1A 4UHRA 2N0MA 3VGAA 1M9WA 3DQBA 3HAOA 3VVKA 1GU8A 1EZLA 2I21A 1BXVA 1NIFA 3FQYA 4BWUA 3FS9A 3KW8A 1BRRA 5G54A 1DZ0A 4JHUA 5I28A 2HLEB 3FU7A 3HARA 1F56A 2BP8B 1GSKA 1P8IA 2WSDA 3NSYA 2UXTA 2XYBA 1RZQA 1FWXA 2EIMB 1OE1A 2PPCA 4NB7A 2B3IA 3CVCA 1J5CA 3NJFA 2IAAC 4A2EA 1JV6A 2IH8A 4KNSA 4QRYA 5B6ZA 1AT9A 5EN0A 1NIEA 3ERXA 4BDVA 1P8UA 1ID2A 1JZGA 2YAFA 3DIVA 4PCYA 2IDSA 2IWEA 5B1AB 3VG9A 4EA3A 2YQBA 3PAUA 4KO6A 3ASOB 1BRXA 1IC0A 1F88A 3HASA 3FPXA 2FWLB 4BXVA 1JV7A 5B1JA 1JXDA 1H2SA 1ZIBA 2I7SA 2WO2B 3OE8A 1TN0A 3PLYA 5B3SB 3CAPA 2DY2A 4L0PB 3PCYA 4G7SB 2BW5A 3IN2A 4DP5X 1ILSA 1GYCA 5A45A 4BUOA 2XUWA 1AIZA 3MX0B 4M3HA 3PWHA 1PZCA 4GPOA 4AI7A 1BAWA 4GP4B 1TEFA 3D12B 5G2CA 2VT4A 4MD2A 4XT3A 2FJSA 3AG1B 2HRGA 1WA0X 3WIAA 1E5ZA 4E9YA 1AANA 1KG9A 3OE9A 1WS8A 5AWZA 2XV2A 2F95A 1X9UA 2NRDA 3FYEB 3QAKA 4X1HA 3CODA 2QDVA 3X1GA 1SF3A 4EIYA 3N55A 1X0SA 5AKRA 2IDUA 2CAKA 1NPJA 1FFTB 2BP8A 2FNWA 4E9VA 2F93A 5H2KA 4YSOA 4HHGA 1DYZA 2Y03A 4WTQA 4ENZA 1AZRA 4BVNA 2H47C 2HX9A 2JFCA 2KSBA 5H2NA 4X4KA 3NJNA 4NERA 1JXGA 4N4WA 4BEZA 5G53A 1GY2A 1A3ZA 1ZDSA 3OD3A 2IWKA 3AG3B 5ANHA 5I5IA 2YAOA 1OOWA 1HAWA 5H2LA 1JZHA 2ZWNA 1PCSA 2BWDA 4GXFA 4IAQA 2ZIYA 1BQRA 2PPEA 2FT6A 1ET5A 2XXGA 4XXJA 3L45A 1SF5A 1CURA 1F50A 3OE0A 1IUZA 5I6PA 2FQDA 3ZDWA 5G36A 1NTDA 1DZEA 1CYWA 3PPSA 3MBVA 4X32A 1AZBA 1T5KA 2YARA 4HZ1A 3AW5A 4BWTA 4HCIA 2E86A 3CDZB 5I6MA 1XJIA 2XV0A 4GYCA 2IH9A 1X9RA 5IY5B 2BRDA 4KNUA 4Q89A 1PXSA 1ZIAA 1R2NA 2P80A 2Y1AA 3DTUB 3FQ1A 2X87A 1BEXA 3OMIB 1AG0A 3DKHA 3FU7B 4DP0X 5AHYA 1GS7A 2UXGA 5B7MA 1NWPA 1L9OA 1AZCA 2YCWA 1A4BA 4E9QA 1VGOA 2DV6A 1QNIA 1W6LA 1HZXA 5KKHA 3X1BA 2EIJB 4AZUA 1WA2X 2R7EB 3X1FA 4P5SA 4GRVA 3QJUB 2GI0A 1ASOA 5EHFA 1L0MA 5I6NA 2BZ7A 4BDVB 1SFDA 2DYSB 4LDOA 3FYIB 1AOZA 1SNRA 3WKQA 2GBAA 1IBYA 1MG3C 4Y9HA 2L6XA 3C9MA 1JZFA 1JVOA 1VLXA 2ZXWB 3AY2A 3JTBA 4HAKA 1KGBA 3QJRB 4BEYA 1ZDQA 3NJGA 3UGEA 4K9JA 3WNJA 3NY8A 1ASPA 1NIDA 2WJKA 2AZUA 3IE9A 1XB3A 5B7EA 4AMJA 4BWWA 5I26A 3AZUA 1GZMA 1XMEB 1BXAA 2EINB 2PPFA 1TKWA 1L9QA 3ZBMA 2XV3A 1L9TA 5C1MA 3ZIYA 3AM6A 4A2HA 2H5UA 9PCYA 1ILUA 3PQRA 5B0WA 1PZAA 5H2JA 2PP9A 2YAMA 2BZCA 3FSVA 2ZFEA 4KO5A 3CDZA 3P0GA 3UABA 5I6KA 3QBKA 2CUAA 4A2DA 5D4HA 2FT7A 3RZEA 4M4RB 2PP8A 4DP8X 3QBLA 1JXFA 4MD1A 2AZAA 3TA4D 2R4SA 4FA7B 2GC7C 4JKNA 1S53A 2CBPA 1OE2A 1TEGA 1AAJA 3UADA 3V9CA 1S8JA 3SBPA 1F4ZA 3WI9A 3NJHA 1UCQA 1WS7A 1XB6A 2Q9OA 1S8LA 3VHZA 2CJ3A 3PBLA 1QM8A 2R7EA 3C9LA 2QDWA 1L9RA 5B7FA 1SDDA 4E9RA 8PAZA 4CSPA 1E30A 1M0LA 3DDLA 2B08A 4K5YA 4GP5B 4W9ZA 2KSAA 3SN6R 3EMLA 2PPAA 5B1JC 1CWQA 1E65A 3QQXA 3WQJA 4DP4X 4E9XA 1AG6A 2PEDA 5BR5A 2XU9A 1NIAA 3HEIB 2GB2A 4DP6X 5B6VA 5DYSA 2FT8A 1M57B 2ZONA 1NINA 3AG4B 4MFHA 1M56B 4YVNA 2I85A 2OCCB 2VM4A 4AKQA 2NTUA 3TBCA 1A4AA 2HX8A 1JZIA 3NJJA 4KO9A 3UAAA 3X3BA 3PAZA 1PLAA 4GP8B 3T6ZA 1IW9A 1PLBA 3ABWA 3NS0A 3PXLA 4YSRA 2Z73A 1V55B 2GHZA 1QHJA 3IEAA 1OF0A 1XB8A 1TU2A 2HRHA 1OCRB 3OM3B 4Q8BA 4BXSV 3ASNB 5A7EA 4KNTA 5B1BB 4XTLA 3QJQB 4MBSA 4OV0A 1PF3A 4F7KA 5AZUA 3D4SA 4GYBA 4RH4A 1H68A 1PMYA 3NJKA 1TN5A 3QBGA 2UXVA 4A68A 1NICA 1KV7A 2X88A 2PPDA 1JGJA 2BHFA 3FQ2A 3NY9A 1GS6X 4L35A 3GDCA 4G71B 2RACA 4KOCA 5LWEA 4PAZA 4E9WA 4HCFA 2HXAA 2YAPA 3H4HA 4UANA 3IN0A 3QBIA 3UONA 3FSZA 3UZCA 1AZUA 2I20A 2GSMB 5AFAA 4G70B 4TL3A 3C75A 4X31A 1GW0A 1VJMA 2EI4A 4DP2X 4AKPA 3S8FB 2KS9A 4A4MA 1ETJA 3HB3B 1SHXA 4JHVA 3KW7A 4GY4A 4G72B 3AYNA 2QT6A 2IWFA 5B6XA 2W88A 5AHZA 5I5MA
chains in the Genus database with same CATH superfamily
1AKPA 1UAZA 5GZOA 4BQ9A 1QMUA 1RZJH 2G5BA 3GZKA 5JHDA 2NXZD 2NX5E 4YHKL 4K7PH 4P5RA 3BVDB 2FO1A 2CMRL 3E7JA 3PP3H 4R26H 3LB6D 4Q56A 4OZIA 1VACA 4UYQA 5DZOA 3LZFL 3P9WB 5F96L 4EF3A 3O81A 3J7HA 3O2VH 2WCPA 4I48B 2H2SD 3CXHJ 3U36A 3N43B 5C7XH 4ORZC 3RWGB 2IWGA 5DJYB 4KLYA 2VYRE 2Z31D 3QDMA 4PJAF 5ADPL 5EEYA 3O3DB 3V9FA 4KI5C 4KUCD 2C3XA 4NHCL 1ORSB 3A3YB 5B2NA 4NNPL 4ORGA 5IFJA 1J8HB 3V52L 1EXGA 1XH1A 2PR4L 3G5XB 1KBKA 5KSUA 4BK8A 4U1IB 1S9VA 3W9DA 4OKVB 1MRCH 2N59A 3VFNA 5FKAA 1OGTB 1DUYA 3RZCB 3PWUB 1UEYA 1PY6A 2O6DA 1J0IA 3HE6C 4A7QA 4UAHA 4XB7A 4X9YA 4TF4A 3RL2A 3K1KC 1MZYA 1SXAA 3UTSE 4BRVA 2ZCKH 3WFHB 2OULB 1U4EA 2ZUXA 1KTKE 4S2SA 1X5HA 2EVJA 1HHGB 3FFCA 3O6MH 1RZKC 5AB1A 4MA7L 1X5GA 3QDCA 3MJ8B 4P23B 2CLVB 3VDAA 3ISYA 1XR9A 4QHKI 2KKQA 1ZA3A 1KBPA 1CYXA 2H3KA 3FTZA 3UJJH 5DRZB 2OMXB 1E4KA 3QI9B 3BO8A 2H0JA 1OTTC 4NNYB 5JPMA 1MHCB 4O58L 2Y7MA 1H8SA 1MPAL 1VAHA 3P73A 4MDRA 5SWQB 3AXLB 1JXKA 3WUWG 2EEAA 3RA7L 1CGXA 4WW1B 1DLFH 3AJ7A 2ICWA 3QJFB 4I9WE 4O2CB 2OSLB 1EDQA 1Q9LB 4JY6B 1AP9A 4WI8A 5DVOA 5LN8A 2Z93A 1JWUA 1CLOL 4HJSA 5HDQL 5JQHC 3HC0B 1DUZA 3PV6A 2GABA 3H8NA 4JQIA 3BP5B 4LLMA 5DFVD 5E08H 4TL5A 4YK4B 2AMGA 2VO8A 1NBQA 3ATFA 1R5VB 2UZIL 43C9A 5DZJA 3INUH 1U8OB 4UDTA 4HD9A 2NSQA 3TYGL 3MRNA 4LSSL 1JCVA 5D1ZC 4Q0XL 1N2RB 1SGKA 5IT2L 3IU3A 3N06B 3KM2A 3I6SA 1OCOB 2NY5H 4G6AC 3LKPA 2QTEA 2YPKA 4A38A 4X99B 5I6LA 1RZKL 3RGHA 3BRDA 2X4UA 1G9NH 3VFSB 4A55A 3HKZA 4X4MA 2RH0A 1DL7L 3KYMB 5T3XH 3N42B 4KWUA 1GMEA 4FYSA 1J10A 5BVJB 2AT9A 1FNLA 4MJ5B 3W1ZA 1T04B 5DD0L 1CLYH 4AC2A 2EH8L 3QQDB 2EUVA 1ZE3H 2N7BA 1K8DB 5F9OH 3BSHA 3M07A 5T3ZD 4Z3FA 3NSBA 3GSQB 4LCCA 4PTUA 1N5YH 2HJKA 4NZRH 4LLDB 4P5MA 2NY2B 2LLNA 3ESOA 2CUIA 2WYZA 4JREB 5DD1H 3VXTA 2NXZB 5DD5H 1DBMH 2QLYA 3X11A 3M17B 4D8PB 4P5KB 3MLYL 3H42H 4UTBL 3SYPA 3T2QA 2B3RA 1W0VA 3WY4A 3FH7A 2YUVA 5A16A 1HJCA 3SE4A 3S36H 1WAAF 2ZWYA 4LPVA 4JG1L 3GMOA 2Z31B 1KC5H 2UV3A 5F0PB 1U19A 2O6EA 4OGAD 1JVLA 4OI8A 5KSAC 4YO0B 3DX9B 5HYJA 2FBOJ 4KO7A 2EUZA 2ZCHL 3T1FB 3OB0H 3QRBA 3BFOA 3QUYC 4MNGA 4TUOB 4LRNH 2J8UF 2UZXB 3CHXA 2VAAB 3KVQA 4M93C 3PJSA 2IV9A 6PCYA 5KYYB 5F96H 2EYRA 3G6DH 4LCUA 4F15C 4AK2A 3ABMB 3R4RA 1FDLH 1HESA 2J1WA 1HL9A 4MQTB 1GZQB 5ADPH 3KPSA 3ILPA 5CP7A 4NHCH 1PNDA 2AQ2A 2WN2A 5ERWB 1SOXA 3CMOL 3LZPA 3V9EA 3V52H 4I3RH 2AQ3A 2VJXA 1PPIA 4UI2A 3C60A 5E5RB 5IW6A 2FH8A 1JWMA 2VJ8A 3FQXA 5B39B 1M05B 4QIRA 1QAWA 2DBLL 2XFGB 2ZSVA 4LHUB 4DOHB 3DETD 3BX7C 4UNUA 4KDTC 1OGAB 2ZUQC 3LKQB 4N8CL 4PGBA 1XCTB 2HTLD 4QCIA 5K59E 1T7WA 2X1XR 2XXFA 4BQ6A 2ZXAA 3QZWA 4BFBD 4WWPA 3PP3K 2YZ8A 1G7QA 3L5XL 4MA7H 4FADA 1E6JL 3EADA 4BIKA 5GS2D 3O9WB 5DA0B 3TM6A 4R6UA 4ELMA 2HT4D 1I7TB 3P9MA 2K6WA 4O58H 4QXTA 1MPAH 4NSKA 1UEMA 2WXPA 4HEPG 4KK5D 3C5ZA 3X12B 2A4EA 4UM8B 3RA7H 5ESVB 4L18A 2APWA 4UNVA 5C07B 2P8LA 1S7WB 4FQQA 1HQRB 1CLOH 5HDQH 3KPLA 1BXVA 1NIFA 5LUMA 5CZXD 1OARL 2OXGB 4AVJA 5I6XB 1LE5B 4PJ5D 2BOCB 2HLEB 3O11A 4ZW6A 3D4ZA 4NZUL 2UZIH 4KKAD 3QORB 3KPNB 5EO9B 4XC1L 3HC2A 5CGTA 3TNMA 4LSSH 4WHYG 2GBTA 2B3IA 3N0PB 5GJTL 4KX9A 1Z5YD 4MAYD 4YXKL 2FAUA 4NC2B 4TLUA 4ODVL 5J9PB 1RZKH 2BSRA 4NN6C 1GAFL 5GRVK 3QJOA 3QWRD 1Q90A 3HS0A 5J6GA 1SRDA 4P5TC 4BEIA 2BS8A 3RU8L 2FUTA 3MRKB 1O7VA 5DD0H 4J6RL 4L3EE 5J13C 1E42A 2C9AA 2EH8H 1ES0B 3QFJA 1CB4A 1TJGL 1MCRA 4RSYA 3GK8L 4IJ3B 3PDOA 5BXFA 4HIIA 4PGZA 1PZ3A 4EI5D 5DQJA 1AANA 3CDFA 1IRAY 3NCFB 2NQ3A 2DQHL 2BHUA 4URTB 2BP3A 3K46A 3KLAB 4K94C 1CF1A 3IMVA 4YDNA 5AAMC 4OT1L 5KJRL 1Y6NR 3L4TA 3UZEA 3N55A 2DLTA 5FA4A 4AV5A 4DGVL 4KAQL 3TA3A 2NY1D 4PJ8C 2BSTA 4CVXA 2DI7A 5H2KA 2R51A 3ZMRA 4OLXL 1DYZA 1KT2B 3DO4A 4X80L 3U30C 4XPGH 4EDXB 1PJWA 3FU0A 2F5AH 2DTSA 2O5YL 2QQKH 3QH3B 1CVSC 4JG1H 4X4KA 1CD1A 5JUEH 4N4WA 5I73C 1J87A 3OAYK 3US0A 4ICWA 3PXHA 1DBKL 1GZPB 3CXHK 1D5MB 3PUCA 3QC5X 4R7LA 3LTVA 4MYWB 4LPUA 2Z8SA 3EF7A 2ZCHH 3ARPA 5J12B 4PFEA 5G36A 1BF8A 1AOHA 3OAUH 3B3IA 3THML 2WXJA 1ACYL 1UUSA 3PIQB 2E86A 3WHE1 3QP3A 2X4OB 4HUXB 2PWHA 1ADQL 4GYCA 4JKLA 1UGKA 5K1NA 4KI5E 4JO4L 3W39A 4QHPA 1S5IH 1THCA 1LEGB 2WLNA 4HUMB 4K94L 4PP2A 2WBJD 4JHWL 3CMOH 4RDQG 4O2FA 2YS4A 4PJ7A 4JY4A 2UZYB 4FXGB 4PWEA 4W4OC 2XBDA 4Q58C 1Y18A 4PRIE 4W4OA 2GI0A 5D5MF 2WZ5A 2FX7H 2XTLA 4Y9BA 1U3HA 2DBLH 4XCYA 1CT8A 3S5YA 4EN2A 1M71B 3MLXL 4Z7NE 3VXSB 1YZZA 1YEGL 4N8CH 2RQEA 5ABAA 1LMIA 4FN0A 2A6IA 1NGWA 3UG5A 1MAJA 1IBYA 3UEQA 4B3VA 3L95B 3FT4B 5KBDA 5BZDA 3NJGA 2J1YA 3L5XH 4PJ5B 1NIDA 4ZX6A 1EJOL 2ENSA 2HT2D 1S9WB 2LU4A 1E6JH 3AWFA 5IROC 1GZMA 1XT5A 1RFDL 2EE2A 4PPTA 3RNKA 3VAEA 3IFPA 2KC0A 3QZMA 1ILUA 4HJUA 5D7SL 5EBMB 4MAYB 3KPOA 1NKOA 1DVUA 3ZKNC 1LLAA 4OZGA 1OAKH 2ZAIA 5HHOE 4M8UA 3DBXB 3U9PH 2CUAA 5L7XL 2Y6TE 1D7FA 5BUAA 4ZAKC 1OGSA 5EUKA 2Y7SA 1KLGA 4K7PX 5F9JB 3BZEA 1OARH 3VTAA 1XEUA 2RCSH 1KN4L 4WO4B 5AW1B 5KS9F 1A1OA 1I1CA 1ZLEA 3HJEA 4GSUA 4NZUH 4ACPA 4XAKD 2H6PA 3GBMH 4IGBB 1XIWB 3FUIA 4XC1H 2QDWA 4ZFZA 3TH2T 4XBPB 2I9TB 1IL1B 4WFED 1HHJA 1Q0EA 3GPEA 4YXKH 2CR3A 1I1YB 4FMKA 3ZVVA 5KVGL 4KJWD 1A3QA 4ADIA 4MJHA 5BS0D 5HHMD 2XU9A 2PYFB 4W9IC 2F19L 5B6VA 3MLTB 5C3LD 5I74B 4TVSa 1M57B 3RU8H 1A4JA 3OX8B 2ZX8A 4J6RH 1IC4L 5KN5B 2VB5A 5JXEC 4LL1A 1TJGH 3HG1E 3WE6B 3VQMA 1QSFB 1NAML 3QK0A 4QTFA 3GK8H 4AW4A 4AENB 3PXLA 1AD0B 1V55B 2I27N 2VDMB 4X8CA 2F7RA 1NMCC 1U3JA 3ARDC 5DJCB 2DQHH 2ADGA 2AXJA 1SYVB 1MOEA 4GKOA 1QACA 1LD9B 4HLEA 1NGZA 4OT1H 5BRZE 5KJRH 1BQHG 1KG0B 2Q76B 1TN5A 4JHBA 2WTRB 4DGVH 3MU3A 4KAQH 2BY3A 4LLQB 3LN4B 4XMKL 4YBLB 1F6FB 5IB5A 5JHBA 3DX8A 3ARVA 3ECUA 4OLXH 3IJYA 4PB9L 8FABB 4X80H 5HYSB 1L7IL 2Y2YA 4I85A 5F1KC 4NKIL 4EQ3A 2EDOA 2J8OA 3D2UA 3ULSB 4J1UB 1BCIA 5DQ9B 3VFOB 3ETBJ 5CBAB 4M6ML 3BRGC 3O2DA 5FYJL 3LPGA 1DBKH 2KS9A 4PJFA 3GT6A 3OKMA 4NOFA 3DJZA 3QNXB 4CADB 3KW7A 2E75C 2VLKA 4GY4A 1PBYA 3ARTA 2V2WB 4N2BA 1DE4B 4DFHA 7TAAA 4XMUA 3THMH 1OLLA 2ZICA 1ACYH 3ABLB 4GUPB 5JMRA 4AYBA 4JFHE 1CXFA 1O6SB 4JO4H 4XBGB 2XX0A 2Q6WA 5DJ6B 2DWEB 3BWSA 3CQQA 4K94H 1MIEL 3QQNA 5E24E 3OHXC 1CICA 4O2EA 1PZBA 2FCBA 1GYWA 1NUFA 4XMVA 4JHWH 1QA9B 4V1DD 1NCTA 1E3FA 2DJSA 3QXTA 2GK0B 2I7OA 3KBPA 1ZA6A 4DEPC 4DO4A 1P6AB 4KI1A 3FPYA 4I0PD 5LO7A 5B3NA 2BIQA 3MLXH 4LCWA 4OFYD 1YEGH 4GW1B 3FU5A 2FD6L 3KAAA 3UL4A 2FO4B 4WV1B 4JCMA 4YSQA 1DQKA 4OJAA 2YCYA 3VO0A 1FO0A 4J3BA 4UF7C 2X3AA 2P24A 1OCCB 4LPYA 3SQBA 3QIBD 1QFUL 1EJOH 4JM4L 1OB0A 1M7IB 4XTOA 1SHWA 1RFDH 1T0NB 3ALWA 3MLZL 2CO6A 4U7KA 4JG0L 1HILA 2EDMA 3KL3A 3NK3A 5TQ0L 2Z34A 4JO5A 5EUOA 5D7SH 4ODWB 5K39A 5K9JL 1SYSA 3QSKB 3U25A 4DGIL 5E95B 3FU9A 4A04A 4N24A 3GPSA 4OZFG 5HSFA 1MJ7L 4JG9A 1U93A 1DP0A 3HI1B 2ISDA 3ULUH 4JE4B 1KN4H 4U1MB 4UIKL 1BAFH 1DANU 1W6WA 4GQ9L 3HAPA 3OLIA 2DYPA 2DI9A 3GS7A 1W2KT 1UOKA 2PWFA 4RA0C 4BH8B 3I50L 4N28A 4CC1A 4HSAC 1DLHB 2QR0B 3O3DA 4QRQA 1CMOA 2XLLA 2P48B 3KXFB 4YZWA 5I9QB 1G43A 3V2YA 4DPBX 3G5XA 4DKAA 4U1IA 3V5HB 4PJAB 4OKVA 3D0LB 2AEOA 3RZCC 1KJ3L 2QV2A 1MEXL 4N0YL 5CN3A 4N20A 5IVXF 2F19H 5C09B 3SBQA 2NLJB 1PZDA 5I23A 1Z5LB 3MV7E 1SLUA 3P2TA 4JFXB 3DX6B 1BOGB 4LSPL 3WFHA 1NAMH 1RURL 4ZUTB 2WK2A 5AG9A 2YAEA 2Z0UA 3UMNA 1JGIA 2X4NB 1ITCA 3SN6N 2R4SL 4HUNB 4P23A 1U8JB 5JJEA 1NUDA 4HUUB 3KL5A 2Y3AA 1GJWA 1YAIA 3QI9C 2PCPB 3JVFC 1WC7B 3QI9A 5J11B 3B9KD 1SJHB 4UILL 2AV1B 4JO1L 3V8CA 5SWQA 2BH0A 2GTWB 3AXLA 3T0AA 4M8QB 1I8KB 3QJFA 4NUMA 4JFSA 2OSLA 1VZHA 4GAJL 5D72L 3V2AR 1FFNB 4PB9H 3U4AA 3WJMB 2UZPA 4TS6A 1L7IH 1A7OH 2BOBB 3RVTD 1M6OA 4POZD 2KL6A 5GRJL 2A3TA 2D31B 4YK4C 1Z0NA 4KRLB 3V7AG 4M6MH 4V1DB 5FYJH 4C8XA 2HKHH 1GS8A 3MRFB 5IBUB 1C8RA 4R0LB 5TF0A 1N2RA 1IBZA 2XWBB 1ZGLB 3RIFK 1MG2C 5FDYA 3P2BA 4C59B 2MOGA 3DVGA 1KGWA 4X99A 2H4EA 2YCXA 3G5VB 4IEFB 3MRMB 3VFSA 1R9FA 1PEZA 4JHAL 1JK8B 3GB7B 4YDIL 5GRXG 4X98B 4FTVA 2BVOA 5H2MA 3OQ3B 4N3TA 1MIEH 4YSPA 3O6FA 5J06A 1X4YA 5AVXB 2Z91B 2ADJA 3B2PA 4LMQE 5D6CA 4P3CL 3PWVB 3QQDA 1I82A 1V7ML 4NZDA 5DMJB 1XGZA 4GW4B 3QDGD 5C2BH 3GSQA 4HCGA 2GIYA 1WT5C 2NY2C 4XPAL 4WI6A 4HQQH 2LU5A 4AV0A 4CU8A 1NC4D 1HWHB 2FD6H 2ZOLB 4HKJA 5AL8A 4LOEA 3Q9PA 4PGDB 1MVUB 3O2DH 5KVGE 3ZYJA 1S5HB 1ZVSB 5EIVA 4P5KA 2Q8AL 1QFUH 3B6SB 3NIDF 5EIIG 3MLZH 5TQ0H 3A4DA 2VXTL 4JG0H 1GW6A 4WTWA 1WZKA 2NSMA 4JFDE 3FB8B 2CA4A 2Z31A 3NDZE 5K9JH 2X28A 4WFFE 4DGIH 5IJBC 1CLZL 5HD8C 1UCTA 1ZGLM 3MRDA 4YO0A 5GGRB 1QWUA 3RJOA 5IWLC 1EXUB 1I3VA 3VSQA 4MMYB 1VRSA 3B2XA 2DM4A 5DI8B 4TUOA 2MCPL 3BIBX 2VAAA 1N4XL 1HL5A 4X4ZA 1URLA 4GQ9H 4KRPC 5E2WL 1QRNE 2EECA 4K3JH 4U1HA 1UXLA 3DNKA 4KPHL 4G9DA 2OMUB 2ICEB 3HN3A 2J8UB 3HLKA 3I50H 4XVTL 2GYSA 2ITCA 2IBBA 1GYAA 3GI8L 4O02B 4J8QA 1YEEL 3B9EA 1I9JH 3UO8B 1SVCP 3NTCL 5FYJE 5BNXD 3Q06A 3QIWB 5F6IC 4Y9CA 1KJ3H 1MEXH 1OW0C 2IAAC 5D1QD 4G6JL 4IKIA 3GQFA 4F2MB 4N0FB 1OGAA 3VRJB 1XCTA 5LGKA 2EYSB 2C9XA 1OZTG 3CSFA 1F3RB 3FUKA 1IGML 2IOIA 1B88A 4YHLL 5HY9B 3Q2WA 1ZIBA 2R4SH 5EMYA 2OK0L 2WO2B 3O9WC 5DTFB 1P84J 2G2PA 2OYLA 1T2XA 3CAPA 4CUCA 3IN2A 3WY1A 1GMIA 5MP6H 1XGUB 4BUOA 5FO2A 4BH7B 4JO1H 4X6BB 1D5IL 1PZCA 3KPPB 2QVKA 1E8ZA 4W9JC 3QUMB 4J3OD 1CDCA 2W0PA 1B9ZA 3F7QA 3FOMA 5D72H 3SCMD 2X3BA 4MQSB 5BVPL 4HWUA 3D18B 5C07A 2CG9X 2PF6A 1HYRC 1KLFA 2IJ0C 5GRJH 5MENE 4CSSA 5I6XC 5HJ3A 4JFFB 4EIYA 1D2OA 1TT6A 5GJSL 3QYNA 1FYTE 3Q2VA 3QORC 3E9TA 4ZMTA 3P02A 3QORA 1J18A 4TVPD 2J20A 1ITBB 1GOGA 5FW7A 5EO9A 2M1KA 2PYEB 4Y19E 3OGOE 4B97A 4Q7DA 2O61A 4DH2A 3KWWB 2K9UA 1CL7I 3S98A 3OR6B 2DLGA 4AQ1C 1ZDSA 4OUUA 3UYOD 4XOCA 4ZFQA 3MCG1 1INQB 3E2HC 3ZK0A 4BV1A 1JZHA 2AP2A 3CH1A 1BQRA 1RULL 4JHAH 4MBOA 4YDIH 5F72S 1HWWA 3HHRB 3OE0A 1YEHL 4CMMB 1IE5A 2P5PA 1KN2H 4PRPE 5J1AA 1RJLA 4YJZL 4FQXD 1CYWA 4P3CH 1ES0A 4PJEB 4IJ3C 3NCBB 1XJIA 3SE8L 1GGIL 4J27A 5EOCJ 5ISZE 5J8OA 3L17A 1PXSA 2G30A 3SJVE 3GMQA 1IU1A 5EZJB 3SE9L 3UTTB 2EIEA 4NDMB 1QR1B 4E9QA 1NM9A 1VGOA 4PRHD 3MJ9L 1CDBA 3DRTB 3L7FA 2NZ9D 2OX5A 4PG9B 1XL6A 3JVGA 3E8UL 2Y7OA 3D34A 3X3FL 1SNRA 3L3HB 1U95B 2VXTH 2VSDA 5HDWA 2VLME 5C9KA 4DN4H 5K69A 3S7GA 3RY6A 3SQOL 1CLZH 3DMMB 3CHRA 2WLLB 1T03L 1BZ9A 1D5MA 2F5BL 1L9TA 4PRNB 5JW4R 1C7TA 3NA9H 3ESPA 3VGBA 2FVNA 5LVEA 1N4XH 1AMXA 4W68A 3TIDB 5E2WH 3U48A 1KACB 3PIQA 4HUXA 4KPHH 1Q38A 3R8BB 1J8HE 2Z4TA 3GTVA 3ZKXB 4F8NA 3IXAB 1LEGA 3H7BB 5F1SA 4ZQKB 3GI8H 3MUJA 4FXGC 1A14H 4R3SB 4JLRB 1F4ZA 3E6FB 3NTCH 4J3OG 1GYUA 2KBGA 2ORBL 4PVNA 5DT1H 3VDCA 5AB9A 3LX9A 1JN6B 2CJ3A 3OSKA 3PBLA 3S8WA 2WQ8A 2Y1ZA 3NEOA 3PP4L 3F83A 2B7DT 4G6JH 4FF9A 4FX5A 1M71A 2TRHA 1AC0A 2B08A 3K2KA 4W9ZA 2KSAA 3HZVA 2HPOA 2XZQL 5CD3B 1XF2B 3NFPB 1JK9B 2IGFL 4ZX5A 1OQOA 1QI4A 3FT4A 3L95A 1CGSH 4A7SA 1QSED 4PJ5A 3HEIB 1V27A 1OP9A 3UYRL 4NO0D 4Q52A 4NKDB 2QHRL 2ZONA 3DK2A 4TOYL 4F7MB 3N1MC 2R1WA 4H40A 4G8IB 5FYLL 5IBLD 1D5IH 4W6YB 2CNYA 5EBMA 4MAYA 2WD0A 3ROLA 4BXSV 5BVPH 4L1TA 3GMLA 3W5NA 1PKQA 2X53A 2V3FA 3QWRA 5F9JA 4WO4C 4EZMA 1PMYA 5GJSH 2XWCA 3LPOA 1NICA 2K1MA 1FP5A 4PJ9B 5C0CD 1CE1L 1FVEA 1D5BA 3GIVB 2CXGA 4PW9A 2WLIA 3ARGD 4G71B 3MNZB 2RACA 4IGBA 1XIWA 4KOCA 4Y5XA 3WY2A 1TR7A 3ZUNC 1FORL 1N8ZA 3HI5L 3G9AB 1CU4L 4EI5A 1JGEB 4QRAA 4U2YA 1COBA 2VXQA 2G9KA 3SKNB 3WL9B 5DHEA 3TEYA 5B8CB 4LPWA 2NUTB 3RJQB 3P4NA 1ETJA 2XNAB 4I1PA 3NSXA 2Z8RA 1RULH 3QR2A 4ZXBD 1OL0A 2I24N 4ANVA 5IV2B 5I74C 4OZHA 1E2ZA 1SJVA 5DHMC 3MLTA 4FFZL 3HRZB 3KD4A 4OAWA 3P0GB 5CFHA 1IBGL 3QRGL 4A2FA 3FB6B 3K0WA 3WE6A 2Q3AA 3QWOB 4JRYD 1QSVA 4I3GA 4M7LL 2VN6A 2F54E 2Z35A 1AD0A 2QQNL 2ZOTA 4QXGL 2APTA 3RVVC 3KJ4B 3B8YA 4FI8A 4AMIA 3PABB 3SE9H 2CGRL 5DJCA 3LRHA 1SY6A 2PWDA 3VGGA 1NFDF 5E6SB 3RFZC 3MJ9H 3MBED 4M7LT 3GIZL 4X7FC 2X40A 4ZYKB 1KG0A 4UG2A 5IG7B 1U3YA 2R0KL 2WTRA 3LN4A 4WW3A 3PAVA 3E8UH 4DZBB 1BQHA 3BKCL 3X3FH 1SUHA 2BP0B 1ZMYA 4LSQH 1IM9B 5HYSA 4KBPA 2AQ1A 3GSOA 1AGCB 3A67L 5SWSD 1HXMB 3IJ9A 4FNQA 4HS8L 4PJCF 4J1UA 4H44C 1MCEA 1MWOA 4YSDA 5DQ9A 2WBJA 3SQOH 5CBAA 3TU6A 1T03H 2AVGA 1HHKA 3A6CH 1K2DA 2F5BH 1ZEAL 3QNXA 5ACZB 5DJDA 3BPLC 5L8JB 1CC3A 5E9NA 3RWIB 4ZMYA 2WGNB 2V2WA 2YAHA 1DE4A 1S54A 1B0RB 2GTZB 1QLFA 1NDTA 2J5LB 3KDMB 2VDML 1QFWL 3JTTB 1BP3B 4C4UA 5FJGA 4ES9A 5AW4B 1O6SA 2NY0D 3G6AB 1KGXA 1S46A 4XBGA 4UQDA 5CCJA 4QLRA 3KLKA 4LRIC 3X3GL 4N2MA 4IKJA 3H2QA 5LXGL 1HI6B 1TZIB 4GLRI 2G2RB 2ORBH 2GK0A 3BH8B 3X2QB 5LBVA 4MRCA 1JGDA 3PP4H 4NS0A 2YGOA 1P84K 1YDPB 3RWHA 4WV1C 3P3YA 4PV9B 4X6EB 1F11A 3BT0A 3B7UX 5IHZB 2XZQH 1A9EB 2IGFH 1WO2A 1YPZE 2FL5B 3ZYOA 2CDFA 4XR8C 5GPRA 4DKTA 3SODB 3FB7A 3F62A 3IKCB 5C0CB 1DANT 2P26A 3RDTD 3F8UB 3UYRH 2QHRH 1A66A 2K0RA 4TOYH 4PMFA 3LRGA 1QUPA 3D52A 1J0KA 1VGEL 2G87A 5HGHA 4RDQF 5L8LB 2RR3A 2ITFA 4LLYA 4G8FB 1PAZA 4FNPA 3X14A 5EBLB 1MH5B 3V6FB 1FHNA 1MI5D 5F89B 1SEQL 4XVSL 1ZXKA 1A22B 1TIUA 3V6OC 4N2IA 4N9GB 5JIPA 1Q0XL 1I7UA 3MXVL 4OZFA 5F6HJ 4PJHF 2GBVA 4NC0B 1MLBB 3PF2A 4MTMA 3L3IA 4JL1A 2HVKB 4XB3A 1DBAH 5D7EA 2XA3A 5C08D 4H8QA 4OV5B 2VR9A 1FORH 3HI5H 4KK6C 3EXLA 3ARBC 5K1VA 3QHZL 4Z7OE 1CU4H 3C09B 3FO2A 5I9QC 4TULL 5ITFB 4PI2A 4EI6A 3SGEI 1FCGA 2V2TB 2BIOA 1A7QH 1LM8V 2X0WA 4NQUA 4XXDB 2CK0L 3FZUD 3EH3B 4Y4FC 3D0LA 3S6CA 4E42B 2GEQA 1XR8A 3DI2B 3S5LB 2W0KA 5C09A 4LHJB 4KKCC 5BV7B 3L3KB 4R7NB 4ZUUA 3M1BB 4D9QD 4FFZH 3IF1B 4N2CA 3FULA 1Z5LA 4U1NB 2XQYK 1IBGH 3DX6A 2HMIC 3QRGH 4FMFA 1BOGA 4W93A 5KUKA 2MWCA 4ZUTA 2ED7A 2F1BA 3HPLB 1KDJA 1G7HA 4M7LH 1RJYB 2QQNH 4QXGH 1U8JA 3GSWA 5ECGA 5DJZB 4HUUA 1GGCL 2CGRH 5KYXA 5J11C 2I5YL 2CUMA 2OFQA 4PM1A 1HYSD 2AAAA 3GIZH 5GS1B 4B9GA 1KCWA 4QRTB 3VGAB 4H1LB 2R0KH 4KZ0A 2IDQA 2L4OA 4WZ9A 2JB6B 4PS7A 3BKCH 1FFNA 4KJYB 4U6XB 4AUUA 2A73B 4RMQA 3WJMA 1GYVA 2BOBA 1KGJA 2ZYHA 1JPSL 4YEEA 1YNTB 2OL3L 1PNCA 1LO5A 3A67H 2NY0B 1S8DA 3FT2B 4HS8H 2D31A 1CDJA 3HB3C 1GTFA 4KTGA 1U8PA 5H2PA 5GS0C 4V1DA 1PEWA 1JPST 4IU2A 4R0LC 4WUKH 5BR2A 4C57C 4HU8A 1ZEAH 4WEMB 5FYLE 3S2CA 4I0PA 4XH2B 3MZTA 3EH5B 4WU7B 1EZVY 1ZGLA 1E40A 1QKOA 3HAQA 4PWKA 4MSWB 2Z7YA 3FO1B 4OFYA 5LGHH 4YHYB 3CGTA 4C56D 5J6HA 5JW4M 5CN1A 1VA9A 1QFWH 2VDMH 3G5VA 3QYCA 5LCVL 4F7CB 3GO1L 1FH5L 3HUJE 1QVOB 1T3FB 4WVRA 1JK8A 3F7RA 3GB7A 4X83A 3SOBL 1VERA 3C6LB 3QJVB 3VXMB 4X98A 4JNXA 1E27B 2J4YA 3PDSA 1XTLA 3OG6B 3TC9A 4EZKA 5EIQA 4X0NA 2Z91A 5MI0C 2F1EA 4NZTL 3OE6A 1C1EL 3CD4A 3E1F1 3NCMA 3H56A 4PW4A 4TNWF 3NZUA 5AWNL 5LXGH 5EEWA 3GSVA 2CIKB 3C12A 4UHRA 4KH9A 4GW4A 4KKQA 4XP4L 5K1JA 5JDSB 4NP9A 3GSNA 1M9WA 2OZ4A 4BKLB 4CC4C 3VVKA 3ECWA 4L37B 5DFWH 1EZLA 5IESH 5DFTA 5JW3L 1DJIA 4GINA 4YDVB 3WFDH 1IQDB 5KZCD 2BNUA 3WNOA 2GBUA 4KROD 2ZOLA 5FXCH 2D03L 3SDXE 4HJ1A 4OLEA 2HKFH 2W94A 4PGDA 4CNIB 5D2LE 4TTDD 4MB1A 4FG6D 3CX5K 4MJ4A 4TRPL 3CHSA 1V05A 3VI4F 4FQJL 4ONOA 4P2RB 1BFTA 1UVQA 2MKWA 5I0VA 3Q2LA 5CLYA 3WMQA 5LAXA 2O5ZL 5C08B 4QRBA 2KLRA 3ZW3A 1VGEH 4XODA 1F88A 5EIIA 3DOIA 3VX0A 1DQQB 5BOPA 2XWRA 3STLA 5D96B 3NIDB 4RAUB 1CTOA 2A74B 1U8CB 4F8QA 2BNRB 1LNUA 2OMBA 2YMOA 3BN3B 1WAAA 3D69B 1TN0A 5FLVA 3U79A 3SKMB 1L3WA 1QEWA 1EXUA 2VUYA 1YY9D 3MX0B 2IAMC 4FNSA 4MMYA 5DQDH 5EWIL 3MXVH 4QO1A 5DI8A 4GPOA 3RGBA 1E8WA 2VIRB 3HMXA 2DQEL 1UZ6E 2FJSA 2V5RA 2YSTA 4H0HB 5E8NB 1WA0X 4PREB 5C0AB 4KVPA 2ICEC 5BZWB 3VFMB 2NRDA 3ZHFA 3CODA 3QHZH 1SVZA 4RMUA 4TULH 4Y4HC 1OPOA 1X0SA 1Y0LA 3LAFA 5JPNC 1BDYA 2Q2LA 3NCYP 2J8HA 5F3HB 3E6HA 2X4PB 3QIWC 4HHGA 1AP2A 2CK0H 3ARWA 3ZZQA 4N0CD 5IMOB 4NGHH 3MLVL 1T4WA 2AQRA 1UZ8A 2MSPA 1QSFE 4L9LB 4N0FA 1QEXA 1N0LB 1QI3A 5C0BB 6FABH 4BRJA 3CLEH 2PPEA 2DLEA 2J1XA 3LIUA 2EEFA 1C7SA 4D8OA 4R4NC 4HF5L 4FKHA 5CMAB 3JV5A 1GGCH 3HN8A 2ZX6A 1T5KA 4P49A 1XGUA 4HZ1A 5F0LB 3IDYC 4BH7A 3P69A 1XDTT 4WUUD 5IY5B 1ZIAA 5I2IB 4PYHA 3DKHA 1CO1A 4NQDB 1NWPA 3QDJE 4FNRA 1V3KA 1A4BA 2DLIA 4Y1AB 4ATTA 1PQZB 4TUJA 1JPSH 1WEJL 4G8GB 1TSRA 3T0EB 5H4YA 3TO4C 4JFFA 4IQHA 4AZUA 1II4E 2R7EB 5IHBA 3BZ5A 4GRVA 2FYYB 3FBKA 1I3GH 3BUQA 3MUZ1 3ZDYF 1L0MA 1MCBA 2BZ7A 1OTSD 4Q4IA 4IKNA 4B9KC 5AVSB 3TEXA 4BE5A 2W65B 3F00A 2EIBA 3N41F 4BK4A 4IRSC 4IBUA 1KB5L 2OM5A 3QDGA 3OR6A 4HAKA 3QJRB 1CK0L 4HJ0C 1BVOA 2WIMA 2EC8A 2KT6A 3BWAA 3UH8A 5I8OL 1INQA 1EGJH 2OW6A 2HCZX 5JO5B 3OAZH 5LCVH 2EINB 1FNEB 1TCRB 2AJUL 2CR6A 2PPFA 1FH5H 2WMPB 5TFSH 4YQXL 3ISRA 3SOBH 4F27A 4RFOH 5C71A 3PGCA 3VB8A 4UV7L 5L8KB 3QUML 4GSDL 3CN3A 1AFVH 4NZTH 3B1TA 1EO8L 4H88L 1C1EH 2ZFEA 4PJEA 1WQVT 5AWNH 4OLWL 3T04D 2DOCA 4XP4H 3AU1A 5FCUH 1IVLA 5D4HA 5A43C 2PP8A 2DDQL 4FHJA 1K8IA 2Z1KA 2AZAA 3P3UA 5EZJA 4WGKA 4GRWE 4FFVD 4FJ6A 4NDMA 4P48A 1U2YA 1QR1A 4K2UL 2MQ3A 2D03H 3IPFA 3SBPA 1NFAA 4RGND 4AIOA 1UCQA 2MJWA 2WW8A 3DRTA 2NNXA 5GS0H 1XSOA 4GXUM 4MWFA 4PG9A 4WI5A 1CD9B 5D1XB 4RX4A 3EGDB 1WBYB 4U1LB 4GG8B 2H3NA 2FJFB 2IPUK 1CZ8L 5INCB 1U95A 3U46B 4Z7AA 3SE3A 2OTUB 4APQB 2FECL 3DMMC 4DWHA 4NYLB 3RWFB 1B9KA 2VZTA 3PS6A 2DJUA 2WLLA 4QI3A 4CJ1A 3LRLA 4MFHA 3FUFA 2I85A 2JQZA 1AGFB 1A4AA 2HX8A 3QUKA 4WO0A 5EWIH 3LS4L 2R4RH 3T6ZA 1U8IA 2YMXL 5D1QA 2VE6B 3NACL 2ROYA 2DQJL 2M2DA 3MJ6A 3HZMB 3TIDA 4I87A 2Y07L 4NQVB 5KYWA 5E70A 2ED6A 2Z7WA 2ROXA 2VR8A 2F53B 4OV0A 1S9YB 4NUJB 1CF8L 3ZDZF 4OJDH 4B27A 2WXLA 3O3EB 3H7BA 2J21A 4PJAE 1C5BL 4H25B 5DC4B 2Z64C 2OP4H 3GDCA 2SEBA 5KWYC 1KGIA 2A9ML 1JN6A 3MLVH 4AJWA 4GQPH 3GXPA 4WUUB 2N1TE 3ARFB 3BYYA 3QR0A 3QBIA 4HCRA 1X5FA 2H45A 4NC1C 3VD2A 1CBVL 2JTDA 4J3VA 1NCWL 2RMNA 3QUZB 4FFYA 5DO8A 4HOWA 5ESAB 5IJKC 1QBML 5EBWA 2O6PA 5CD3A 4WLCA 5AAWC 1BWMA 3BW9A 4A7TA 1J1OH 1ZLSL 5E8EA 2X9YA 2UWEF 2V5MA 3MACH 5EZIL 5CJ5A 4ZFOB 2E9WA 1KCVL 4S11A 3DUSA 3CVIL 5FHAL 2WNGA 3JSSA 4IYKA 4QWWC 4G8IA 3LKOA 2CALA 2CRIA 5DMKA 2KDGA 5TH2B 1G1YA 2VR6A 1P5UC 1IAIM 3CSBA 5D2NB 3MR9A 4B96A 4GG6B 4O02H 2LVCA 1KDIA 2B2XL 4Y9FA 1WEJH 1R19A 1WH0A 5DMGD 4PJ9C 1H3XA 4OLVL 3ZUCA 4KZDL 5AW3B 1NC2D 2YAQA 5DJ8B 1IB5A 4PG2A 4A66A 4BUHA 4NQEB 3GIVA 4GI9A 2R69A 3NESA 1JPGB 1WE5A 3ABKB 5KEZA 1KB5H 2V3DA 4JGJA 2RJMA 1I1AD 5GZND 2KI6A 4JKMA 5MEOB 1JGEA 1JNLL 1TTFA 2EDQA 2VMJA 3K4AA 3WL9A 1MCWM 4PJDE 1BLNB 5B8CC 5FLUA 5I8OH 2RD0A 4RMWA 5LBSL 2B4CC 2BS9A 2FQEA 4HS3A 2XNAA 4PRHA 3VYPA 2AJUH 2Z1PA 3REYA 1BMZA 1J8KA 3WN6A 5IV2A 2EIDA 3ZSSA 4RBPK 3FB5A 5FYKL 1X6LA 3IS1X 2KSYA 1ORQB 1ZT7B 3HRZC 3WJJC 4UV7H 3QUMH 1XF4A 3WJJA 4GSDH 3B9VA 4OIFA 1EO8H 3QUXB 4AEEA 1JSYA 1KXTB 4OLWH 3ZZLA 5A40E 2XN1A 2BINA 3VACA 1MAMH 4Q4EA 3RX9A 2DDQH 2OJEA 3MSPA 4ZK8A 3PABA 4TL4A 3ZOAA 1AZZC 4DSYA 1U3ZA 5GIRB 4K2UH 1AACA 1VENA 3WAKA 2UYLB 3ILQD 3V6ZA 1DCLA 2H6OA 3GS4A 2YWYA 1MZZA 3KPQB 1DBJL 4ZYKA 5IG7A 3NUKA 5ICYA 1EHNA 5J1SC 4EUPG 1UXMA 2NDFA 4U1JA 3FONA 1V7NL 1NFDB 4Z77A 1SJEA 1OCZB 1RZGB 2I1XA 4N4YB 2BP0A 1QKZL 5F1OB 5IMLB 1IM9A 1CZ8H 4JAMB 3KJ6A 1DQDL 2Y5QA 3U0TB 3TEZA 3NSJA 1HXMA 3Q2CA 5L2JB 2B4CL 5HPMB 4RQQB 2DWDB 4M1GH 4HUWB 3LQZB 2BNQD 5CLWA 2EXWD 1A1MB 4W4NA 5AW0B 3QC6X 4XWOC 2IO5A 3K2MC 3OKKB 5ACZA 4PJCB 3MLUL 4A39A 4IIQB 5KAQG 2FUQA 3T0DA 1UWEL 1KY6A 2YMXH 3NBNA 3NACH 2J5LC 2J8UE 1X7QB 2DQJH 3OKOB 1JAEA 3N5AA 1TETL 1BD2B 2C1PA 1TZGL 1IKNC 1E4WL 4D9RD 1UKTA 2Y07H 4LDEB 4EO5A 3REWB 1NMBL 1BFOB 2HG5B 1CF8H 3V4UL 4JVUA 1QSEA 5EU6E 2DQTL 2ZWSA 1EHAA 3V2WA 4YSCA 1C5BH 2A6JA 5IB1A 4NO0A 3UP6A 4BSWB 2G9HA 2DYRB 7PAZA 1Q72H 1HI6A 4IARA 2X4RB 3BH8A 1IKOP 5G28A 1CXHA 4MD5B 5LGJB 5TTRA 4X5WB 2WZPD 5E51A 2X70B 3KMDA 4OZIE 1CBVH 1YDPA 2IBZX 2ZG3A 2XVKA 1F4AA 4X6EA 1QBMH 4ELDA 1A9EA 4DP9X 1PY0A 1RK1A 1Z3RA 4H0GA 2BVPB 2DQFB 5TD4A 2WVUA 4ZMVA 5B38G 1ZLSH 3VXUB 5BCAA 1QLEB 2C9QA 2FL5A 4NQCD 4AQEA 5EZIH 5E03A 5ESQB 5C0CA 5ETZA 3QDME 1KCVH 1E90A 3CVIH 3W2DH 3VI3F 4ZFGL 4ONHB 3S96A 2FQFA 1KV3A 3ARGA 3RWJA 2JKJA 1BQ5A 1S9XB 4YN3A 1W8OA 2EKSB 4R8WL 3SQRA 3MGTA 4M8RA 2VN5A 1OZUA 1U8KB 3QT2A 4HKZA 1EEYA 3IDNB 1MH5A 3QHFH 5AKTA 3AM8A 4PLKC 5F89A 3S2AA 3TBTB 2EC9T 2X9XA 2B2XH 3EFOA 1IM3D 1TQUA 2ESVD 4ZXBA 3L4ZA 4N9GA 3PXOA 1PZ5B 3VYOA 1IIKA 4MA8L 4CBZA 1QSZA 4OLVH 4RMTA 3WXVL 4E9LA 1ACZA 3RUGE 2AI0L 4GNKB 3BDYL 2HFFB 4IBLT 5EOTB 1PIGA 4JPIB 1U6AL 4PJHB 4X0KB 2G3ZA 3DPBA 3UJTL 1GGYA 5CKAA 4JRYA 1VKXB 3SPIA 4N90E 2C4FT 5C9JB 4D3CH 5FC9A 4XT1C 4H8WC 5LBSH 4DJHA 1BYPA 2YN3A 4UMSA 5H37A 3HOGA 3JV4A 3GZPA 1EUTA 3MBEA 1N68A 3MA9L 2NT1A 3LRSB 1NCGA 3SGDI 3BP4B 3RKDC 3LNGA 3WIFB 5JR1L 4GRLD 4LCYA 1ZANL 4QRRD 4U1NA 4BA0A 3OKNA 2NTSP 1IZKA 3C2SA 2BIMA 3RX7A 5H2IA 2HFTA 5SWSA 3HPLA 3EG9B 2XT1B 2W80C 3MBWB 5AOIA 5GGTL 1O9WA 4LO9A 1RJYA 5K9KB 4WHTB 1W8NA 4XTNA 3B3BA 3BYTA 4Z0BH 5F7AA 3T2PA 2F8OA 5A1AA 3IPBA 5GS1C 3STZB 2Y0SA 3E0GA 1KCRL 3VGAC 4A6YB 5GS1A 2N0MA 1DBJH 3VGAA 2G4EA 2VZVA 3M46A 3GD1C 1HDMB 4QRTA 4Z3TA 1NLBL 3MRRB 2CRMA 1R3HB 1R3JB 2X44D 1V7NH 3VQ1C 2JB6A 2Z0BA 3FS9A 3KW8A 2DPKA 4FRWA 1DZ0A 2ZKHH 4U6XA 3LV3B 4OJYA 2Q87A 1QKZH 4JGUA 1J8RA 1YNTA 2WLMA 3D50A 4RWYL 5FECA 3FTGB 2CM5A 3FT2A 2B4CH 3S88H 5E6ID 5JA8B 1O5DT 2KQNA 3TONA 2ADFH 3K0YA 2BM3A 1LYQA 4ABQA 3TFKD 2AKRA 4RIRB 3D39B 4S1QL 3KNBB 4GAYA 4UQCA 3DJSA 2BXYA 3MLUH 3UZQA 2X6MA 4XH2A 4WU7A 1UWEH 2ZWLT 4JGNA 4YHYC 1TMCB 3FO1A 4ZPVB 3H7LA 4UT6L 2ZQKA 1MCOL 1TZGH 4F7CA 1NGXB 3PLYA 2OAAA 2NTFA 1SLVA 1HQ4B 1TTCA 3C6LC 1QVOA 1T3FA 4WSKA 2R27A 1AIZA 3MC0A 1E27A 4M62L 3D12B 3D1MC 3GWJA 4ZMXA 4GBXB 3RKPA 1Z9OA 4PEEA 1Y6MR 3MFGB 3NMEA 2XV2A 3ZE0E 5HYJE 3VFWB 4BKLA 4ZW5A 3KJ6H 2CU9A 3QEQB 4QAWA 5D5ME 1E4XI 4WI2A 3TCLA 1OAXL 1IQDA 1MI5A 4OLYH 5T33L 3D08A 2WBWB 4PV8B 4PGJA 1TQSA 4R84A 4UT9A 4CNIA 1KTCA 4BVNA 1USQA 1KGUA 4OSUL 5FYKE 3CDCA 4NERA 4MKMA 5AVRB 2V33A 4GQQA 3TTSA 1GY2A 5EBGA 4ZFGH 2PN5A 3AG3B 2X6VA 4L8SC 4HAGA 1HHIB 1NGYB 1OOWA 3CZJA 3GJEB 5C08A 4AIEA 1PCSA 1SXBA 1YEDB 2EDBA 4TUKL 4R8WH 3ZQWA 15C8H 3VI4B 2A74C 5L4MA 4MAUL 2X2HA 1JRHI 2A74A 3MRGB 1U8CA 1TEYA 2ITDA 4JJ5A 3C8DA 2VL4A 3RVWD 2MKLC 1ZLUH 1T4KB 4WGVB 3BGAA 4CVZA 3MX0A 4IHOA 4MA8H 2OTWB 3WXVH 2VIRA 4C4BA 5CP3H 2HUEA 2RHEA 1WBZB 4TLTA 4Y5VB 2QSTA 5KS9E 2WWMC 3OMIB 1AG0A 4PREA 4QRRB 3BDYH 3OXSA 2N0KA 3VFMA 2C9PA 2TAAA 1U6AH 1EFXD 2DQGL 4MGXA 3VNZA 5EF3A 4U1SA 4A63A 2IV8A 3A21A 2VL5B 2YA0A 3QZLA 5ICXB 3D2TA 4HC1L 5HGDB 2CJUL 3AAZB 3J8F7 1VESA 3IRPX 2AEIT 3F85A 3O8XC 5F3HA 1OSEA 2W0FB 3OC8A 4MBRA 2R23B 5IMOA 5T5FL 3H2WA 3VE0A 1AQDB 3CZNA 4P57B 3A5VA 4XRCA 4YBQC 2JJWA 4B9JA 4P99A 3GTTA 4L9LA 1QBLL 4ODTH 3UGEA 3FTWA 4E41B 3NY8A 2DMBA 1ZANH 3UX9B 3BKJL 1N0LA 5C86A 1HINH 5C0BA 5F6HI 3PPEA 1XMEB 5DEFB 3EYSL 4L3CA 5I1DB 4GPVA 5GGTH 1PW3A 5KW9L 5C1MA 2DTML 1JD7A 5E6IB 5F0MB 4A2HA 4IRJD 2VZUA 1H6TA 4MB4A 5FOJA 3PQRA 1N67A 1ZHLA 1ZHNA 1O5PA 5I17B 2YAMA 2BZCA 3FSVA 1GRWA 1KCRH 3QXDB 2OQJA 4F7TA 5I6KA 1KTJA 3CBJB 3NPZB 4OCYL 1FZMB 2YGVA 1N64H 1CGWA 4C56A 2FWSA 5TPWL 5DJ2B 1JHLL 3T0EC 4GSRA 2J7LA 4G8GA 1FH2A 3NEEA 2YD4A 1K5NB 3ETSA 4H8WH 2V4LA 4RWYH 1JDAA 5H37H 3T0EA 2R7EA 1I75A 2EKJA 4AG4L 1IBBA 1RUQL 4FZEH 3K6OA 8PAZA 1G0YR 3TPUB 4S1QH 5T1LD 4IU3B 4K5YA 2L04A 2XOTA 2Y24A 5B1JC 3SDCC 3TO2A 3ZDYB 1RZ7L 2J3SA 4NP4L 1DTUA 1KBGH 2XACC 1T5XB 2JJUA 4NIYE 4OD1L 2BC4A 2IANE 4UT6H 3WTWA 1YMHB 3BZFB 3FTYA 2OI9B 1FNEA 1TCRA 5F7KC 1KFAH 2WMPA 1SPDA 4EEEA 3BPCA 1TZOA 4I77L 4M62H 1MELA 3FCGA 3FHEA 3AITA 4H1LH 3LKNB 2G3XA 1XCXA 4Y4KB 3OM3B 3LZRA 1DVXA 3HLAA 3EAKA 1KGCE 3FCSA 1R0AH 5AB2A 1KWGA 3QBGA 3LNFA 5T33H 4IRZA 2FJHB 2KS0A 3KH3A 2OYKA 4HJJL 5IQMA 1NAKL 3FQ2A 4G42B 3NK4A 4XX5A 3CJJA 5J1TC 5D1XA 3FQNB 4N2KA 1WBYA 4U1LA 5AFAA 3GSRB 4XP1L 1PU0A 4GG8A 2FJFA 3FMGH 5TE7H 3S8FB 4TUKH 3VWKB 4APQC 2YJQA 2WZAA 3D7PA 4ZMLA 2E7BA 3EO9L 3TBVA 2D4FA 2VISB 2V9UA 4G72B 4RFNB 2EYTA 2R39A 1HN1A 2E59A 3DROB 1YMMD 5AHZA 2ZX5A 3I6LE 4N3UA 1AGFA 2AXGA 2YO3A 3MLPA 2PLTA 3FTUA 2VE6A 4K0OA 5FO7B 4AYFB 1FZKA 3HZMA 4UQEA 4MQXD 2R2EA 3P0YL 3I2CL 2J57A 2HN7B 5E00A 1S9YA 1F3DH 2DQGH 4NUJA 1ET8A 1ONQB 1I3RB 4P46B 3FSWA 1G7PA 2C7UB 4HC1H 5C0DB 1VCBC 2CJUH 4CDHA 1ZWIB 4KMQA 3U2SB 4DPCX 4MB5A 4OZGE 4EPSA 4P2OD 1CDYA 4KK8C 3ZDZB 4F1ZA 5GGSB 1BIIB 3ARFC 3ZKSD 3VVWA 4BINA 3W5MA 5T5FH 4WUUA 2NUPA 3QUZC 4G43B 5IVXE 3UG9A 1QBLH 1DFBL 4AGMA 1YLBB 1Z7JA 3BKJH 3DURB 3MOAL 4FD0A 4NQXA 2XHNA 1A0QH 3KPRD 5KW9H 2DTMH 1BAGA 5D7LE 5IREA 4PJXA 2GJ6B 4NHUB 4NFDA 1CBJA 4Q9RL 3TH4T 4I13B 5DO2D 1B4JH 1QQDA 4R2GB 4ZMNA 2G3MA 2UWEB 1U8QA 3B2UD 5F7EL 3KPTA 5TH2A 1WHPA 2P5WD 4IBZA 1WBXB 3RTQD 2JTYA 1O9VA 2FGZA 4GG6A 5D2NA 3FUNA 5D9SA 3EYUL 2EP6A 1B3IA 4A7GF 1DEEA 4J8RB 4PLNC 1OGPA 4LNVA 4P0DA 1RCYA 2RH1A 1JHLH 5TPWH 5HP5A 4PBVC 5JQ6L 5IQ9A 1PDKB 1XVSA 2WNXA 1KYOJ 2DMKA 2D73A 3HNVL 3MV11 5I82A 3VJ6A 3W0WD 4XZUB 4AJYV 4GBRA 4ZI8A 4JFED 3IFNL 3ULAB 1JGUL 4DCQB 3RFRA 1JPGA 3TZVB 4F58L 5IIEA 1W8EA 4FDWA 3QNYB 5HI5D 3CFEB 2WINB 3EHBB 4YZFE 1KENL 1PKOA 1RZ7H 4NP4H 4POUB 5CIPB 1P7QD 3CG8A 1BLNA 4OD1H 2XG5B 3VXME 1UTDA 4N9OB 5PCYA 3G04B 4ZSOB 3ZEVA 2FEDC 4JRXB 4KKRA 4LU5L 1IEBB 1AS8A 1T2QH 4QKTA 5HJGA 4Z7UA 5C0FA 4I77H 4LBEB 3BP7B 3VMNA 1IGCL 3QUXC 3NSCA 4JMXA 1N3NB 2PTVA 1AR2A 2NR6A 1BJ1J 1F90L 3DX7B 4PYGA 2WANA 3VWJD 4ENED 4PLJC 4IS6B 4AUJA 1OWRM 3TS8A 1I85C 4KJQD 2MQ0A 5IZ7A 5EU5B 1B0WA 2VLKE 4HKBA 4NX0A 2P49B 2YA1A 1UM6L 4MYPA 3VXQB 5GSVA 5I66A 4HJJH 5GIRA 3T4YB 4UQAA 2UYLA 1IFRA 1NAKH 4XXCA 3VD7A 2XWEA 5K9OB 2HZHA 2XWJB 1UYWL 3KPQA 4P2RE 4CA4A 4TQEL 4OUOA 5ETUB 2GJZA 2OXHA 4FQPA 3TIEB 4XP1H 1P6WA 5DHYB 4EUPA 3I9PA 5IMLA 4KKLD 1BRDA 5FKPB 4TQ8A 3KGSA 2BNRE 1TF4A 3FQTB 5FGBA 3VFPA 1M53A 2EDDA 2NY6D 4L0ZA 5L2JA 1FAIH 3BAKA 5HGAB 5HPMA 3EO9H 4RQQA 5T1MB 3OQRA 1KYDA 4QY8A 4KNFA 1OSPL 1L5GB 3TJPA 2WLYA 2KZKA 1WCBB 3OKKA 1ZKAA 3CVBA 1LWJA 4OGAC 4HPOH 4YX2L 4IIQA 1MFCL 3MNWB 2AEPL 3WKNA 2IH3B 2ZNWA 2VSMB 2IFFL 4OLZH 4FULA 1X7QA 3SB3A 3OKOA 1CYGA 2ARWA 2XZAL 2YPLE 2NXYD 3AREB 4F5CA 3IJ8A 3TBBA 3P0YH 3I2CH 4LDEA 4W1TA 4BCXA 2AJ3B 5I15L 3WFBL 3REWA 1BFOA 2HG5A 5E56A 5CGYD 5EUOE 1QBBA 4N5ED 4BSWA 2OLDA 4ZTOH 2QFPA 4H20H 1YEWA 2AQTA 2KH2B 2Z4QA 5KYUB 2JK5B 4MNQE 1ZHBB 1CPUA 5B21A 1BF2A 2QMJA 2ZSWB 4PR5B 4K71B 1LE9A 5A3IC 1WFUA 3RAJL 2L0DA 1DFBH 4AJVA 4CN6A 4KUZL 2XKNB 3WN5B 3O4LD 2F61A 4LOUD 1AS7A 2H32A 1UQSB 5HI3C 2BVPA 4P06A 1QPKA 2BIHA 2E74C 4N0UB 3CFJA 4EBQL 2WBXA 1IAIH 5B38A 1NC2A 1HH9B 2ZCZA 3TVMB 3QUHA 2MOQA 3KL0A 4LHQB 4ONHA 4TLSA 5DZNA 3ZN6A 2M3GA 1JMZA 2IADA 5EB9A 2WXKA 4P2QD 2B1OA 4TTGA 3RWCA 3LHAA 4M1CD 2OCFD 4DESA 2EKSA 3EJYC 3BFWA 3SDAC 4ZOBA 5GZNA 1A6UH 4Y5YB 3VI3B 1P5VA 1FG2B 5DK0A 3Q2NA 3VXPB 1JFPA 3EYUH 5KVMC 1DQML 2WB1A 3U4KA 1M1SA 4WJG3 2GVYA 1SOSA 5ACLA 5JQ6H 4L05A 2XDHA 1H8NA 2MEJB 3HNVH 4ZDHB 3DHMA 1FNGA 3FUMA 1NBVL 4BWUA 3EO0B 5DUBA 1JG9A 4DAGL 3IFNH 1Q94B 2F8VA 4M03A 1JGUH 3FU7A 4KKBD 4JPIA 4F58H 1GSKA 1E6OH 4JDVB 1XO8A 2XYBA 1KENH 5H2BB 3RGVD 4KKAC 3LEXB 4Z7WF 1QLEL 1OE1A 2ICWI 1I8LA 2AQSA 5E1HB 5EO0B 4F92B 3NCJL 3ERXA 2FGWL 4PCYA 2IGTA 4LU5H 1G7IB 4ZZFA 5I1IL 4JFQB 1IGCH 3BP4A 5GGQL 2F7PA 2I25N 3WENA 3PQYD 4YHIB 5E7BA 3R8QA 3DK0A 1TSHA 3F6IA 1QWHA 2QVIA 3QRFM 5DF0A 4F91B 1UH2A 4QHMA 3VFTB 25C8L 3FFOA 5IKCB 4HMEA 4L4TB 2BNQA 2EDJA 3WNLA 1UM6H 1BAWA 5HBBA 1W0YT 5G2CA 3MVSA 4MD2A 1JWSA 2D3VA 1BLIA 1VFMA 3BPOC 2A2QT 4PCKA 4JL2A 3STZA 4PS8A 1UYWH 3UO1H 3HE7B 1R3JA 3ES6B 3N1QC 4Q9QL 4LCVA 3W9EB 3KEHA 2HLFC 4WWKD 2DEYX 4YSOA 1A4KA 1CD0A 1Z9MA 3C87A 1U41A 2GSGB 2HX9A 4HUVB 3QCVL 1OM3L 2P42B 5BO1L 2JFCA 4RRPG 1B4LA 1KTDB 4F8PA 3IFOA 4XCNB 3PL6D 1K85A 4HDIB 2VLJD 4AJ0A 4BEZA 5G53A 1AGBA 4B9IA 1XAUA 4IOIB 4WI4A 4N86A 5EH1A 2PXYB 1HAWA 3K5RA 2XTJD 5DEGB 1MFCH 4YX2H 4IAQA 2IFFH 1XHHA 3QCUL 2WZPA 3HJ0A 4PBDA 1HKLL 2F53E 2G75B 4XC3L 1MFMA 2ED9A 1XF3A 4ZPVA 3RI5K 2DKMA 4QTIL 4KZEL 2XZAH 2D7PA 4QDGA 4F80A 1KLUB 1HQ4A 5I15H 3WFBH 2RB8A 2YARA 2DQCL 2VRAA 4S1RL 2I32A 4A6YL 4P04A 2NX5D 1A21A 1X9RA 5JOFB 4GBXC 4WHYH 3AROA 2P80A 3H2PA 1DQJB 4OQTL 4X9FA 3VM7A 4FNLL 3ARXA 2UXGA 2VQTA 4N2LA 5E2VL 5I1AB 5F1IB 4ODUB 5A2LH 1QNIA 3VFWA 4Z7VF 3NRQA 2VRKA 3QEQA 4ISVA 5D7JD 5LKNA 4YLQT 3EJUA 1T22B 3RAJH 3ZO9A 4NZFA 5ABZA 2IFGA 4KUZH 3TJHC 2AS5M 4G8AC 3QEHA 1HC1A 4L3AA 2ESVA 3FU3A 4L4JA 1OD7A 3SY0B 3V4VB 3BEVA 3QXAB 3L7EB 1VFAB 3W56A 3QZOA 4UAOB 5FUOL 2N56A 1L7TL 5JIMA 1Z2KA 1S7RB 4AM0A 1NCBL 1OP5K 2F18A 1AJ7L 3LVTA 3D5OF 1HHIA 1NGYA 2K78A 3IRZA 3L3JB 3LDBC 3EGSB 4Z7UF 1YEDA 1Z9LA 1KYOK 4WSJA 4Y89A 2EZ0D 2V5SA 1UFGA 2FLMA 3MRGA 1NL0L 3AUWB 4Q2ZA 1DQMH 1Q9KA 1BZ8A 4GKNB 2PP9A 1T4KA 4P4KD 1UWFA 3WS3B 4G80B 4KO5A 4DKFL 1UZGA 3MLRL 3V0VB 1W72L 5CSBA 2VLRD 1U42A 4MS6A 1X5ZA 2WLZA 3EFFA 4Y5VC 3L9BA 3DO7B 2FLRT 4GRLA 1NBVH 5IW1A 2Q7YA 3BSGA 2R29A 3TA4D 4DAGH 1AKJD 2YWZA 2FBJL 1S53A 4QRRA 2CBPA 1A2YA 5E94B 3ZTJG 1TEGA 2AITA 2NY3D 3CFTA 4JZOB 3UYPB 2WXFA 3NJHA 1FBIL 4G8EB 4BFNA 1H3UA 1R33A 4UIMA 5ICXA 1D6VH 1QLEH 3NQIA 5HGDA 5B7FA 1SDDA 3AAZA 4Q9CA 2E27H 2P44B 4JKKA 2W0FA 2FGWH 5HI4D 3OLGA 1A7RL 3IB4A 3PFUA 4LQFH 1AQDA 4P57A 4AMWA 4P2AA 2BOLA 5AL0A 5I1IH 1QFHA 4L5FH 4XP6L 1NCNA 5HPOA 2WKGA 3QPQD 4MMXB 1NIAA 4MJID 4UQ3A 2K8QA 2GK2A 5C3IA 1QZNA 2AJVL 3BVVA 3LIZA 2X9WA 5JZ7D 1DN0A 1SDYA 2NW2A 1TTGA 1BJMA 3D87B 4KK9C 3KWTA 5I1DA 25C8H 5T3ZE 5E6IA 2QZQA 5ENWB 3V6BR 4EVNB 1ZSDA 3FJTA 4D7BA 3MDJA 2B1HL 2VLJB 4NO5A 2NZ1A 3U2JA 2FHFA 3QEGL 3KYNA 4ODSL 2JCCA 2NY7H 5I17A 5SX4H 5IK3A 1RLBA 1KPVA 3LQMA 3OKEA 3PJNA 3QXDA 3RIFF 1BVLA 3WEMA 4PRAB 4UOW0 1DJWA 3TP4A 1O9ZA 4HULB 2D8KA 4DQAA 1WTLA 4Q9QH 1N59B 4S1DC 5DJ2A 5JHLA 1JF1A 2FK9A 3F84A 4Z3GA 3OR7A 2XFXB 1MNNA 1K5NA 4L35A 5LWEA 3IS0X 2FX9L 5FHBH 3QCVH 4UANA 1OM3H 5BO1H 3OZLA 4V2BA 3TPKA 1ETA1 5AD0B 5TJWK 4IU3A 2EEBA 1AHMA 4FLQA 2YN5A 4FLHA 5LQBH 2DS4A 2EE9A 3FO0L 3K8KA 4WY7L 3A4EA 3MJ7B 2ZOWA 3QCUH 1SHXA 1ZTXE 1HKLH 4B7IA 1T5XA 3VRLE 5FOBB 5BW7C 4IBWA 1I8MB 4KZEH 2NOYA 4QTIH 1YMHA 3ARYA 3RX5A 1NBYB 1XGYL 2J6EA 4FA6A 4GXVL 1A8JH 2M26A 2OR8A 3B4NA 4HYXA 2DQCH 3FQUA 4S1RH 4BK5C 1ADWA 4I18B 4QRPD 3T8VA 1XH0A 2FSEB 4A6YH 2VSCA 2D7NA 4XPTL 2VDOL 1WWBX 5DYFA 4Y4KC 4OQTH 1UADC 1H8OA 2P7TA 5CHNB 4FNLH 1BX2A 1CDHA 4UDUB 2V5YA 4OJCA 4NLAA 1WFIA 1B4RA 3CBKB 4NLHA 1LMKA 3UTSB 1C9SA 4MLSA 5EF2A 3MGAA 3IVKB 2FJHA 1UB5B 1OKEA 1LP9A 4G42A 1G6RL 2IF7A 1MNUH 4YR6A 3PY9A 4FMVA 4QRSB 2A0LD 3GUTB 3FQNA 3RIAK 1RK7A 2P28B 3D8MA 3GSRA 1HEJC 1CGVA 1AJ7H 4JFYA 3KG5A 2ZTBA 4G1EA 2NY3B 4HFUL 3VWKC 1QNZH 2WNKA 4G3YH 4U3XA 2I69A 1EFXA 4DGUA 2JKWA 1HFUA 4G9FD 3L13A 1BXUA 1S7QB 1AHWB 2PO6D 2ZUVA 4RFNC 5SX5H 2K70A 1NL0H 4BFJA 2XG4A 3FUHA 3ZQ9A 1C8SA 5T3XD 2K6ZA 1SJMA 4DKFH 5I18L 3MLRH 3CCHB 1W72H 2HYMA 5SWZD 3P9LB 4Y0GA 4JZNB 4AYFA 1PSKL 3ALPA 1YSOA 3O3BB 4JCLA 2FBJH 3T5WA 5FUCE 4C83A 5JW4N 4P46C 3T71A 1FBIH 3V4PB 1ONQA 4HALA 3MI6A 2NY4B 1ET7A 3DIFA 3DGGB 4IRJA 3LH8A 4KQ0A 3O4OB 3N50A 4HWZA 4JR8A 4HX1B 4AGQA 1PKQE 3BQVA 5J0BA 5AW7B 3ETBF 1PZ2A 4PJBF 4JRLA 3TYFA 4XP6H 1SZNA 1IQWL 2EIZA 4Y2OB 3BISA 1OQXA 3DURA 4JQXC 5TE4L 2AJVH 4JDEB 4QYAA 1V3MA 3VW3L 3HFML 3OSVA 1TYRA 4J6IA 3IGKA 4JZJC 5DRNA 2Y2WA 2OZ4L 1V10A 2DJMA 4XXWC 3T4AB 4LSUL 4NHUA 1TLKA 2HP4A 4OQ1A 1CGUA 4YXHH 1YEIL 4R2GC 2B1HH 2DWSA 4DPAX 5T1LA 3QEGH 4ODSH 3UAJA 1DVFD 1WP6A 3V5KA 1BGXH 2LNLA 4HWBA 1J9QA 1KCBA 2OSWA 1WBXA 1ZV2A 3B9KC 4OZHE 4WJKB 1MHPL 3SYCA 4F33A 1N6QL 2WJLA 1JV2A 4J8RA 3V0JA 4QI1A 3VFRA 4QR7A 3EUDA 2LU7A 1PDKA 1XGRA 2CLRB 2FX9H 1NZRA 3IAPA 3LEYH 4XZUA 3QPXH 4K73A 4NWTH 3VA6A 2B0SH 1VZGA 2QVTA 3PAYA 3TZVC 4PJIF 3O0RL 3EHBC 4G1MB 3FO0H 1AZNA 3QNYA 3CFEA 2VITB 4WY7H 4F7EA 5AAPA 1V8HA 4ZX4A 1UXWB 3I9GL 2V7NB 4KITB 1AHKA 3RPIB 3K6SA 1Q5IA 2YBRB 5JHDD 2BSBA 3QQ3B 3T6QC 4ZSOA 1XGYH 4GXVH 3DV6B 4N6RA 2Q5BA 4OJFH 3BKML 4JRXA 3MLWL 3GYRA 3W57A 4GIPD 2JKLA 2Z92B 2CCVA 3BP7A 2YGPA 2ZKXA 3UGUA 1K4CB 4K3GA 2VDOH 3S34L 3CZGA 3PNRB 5DD6B 1FZOA 3DX7A 1TOXA 3B7SA 4IS6A 2J1ZA 4YSSA 2ARJA 1E0PA 3DUUB 2VZSA 3DTXA 4O5LL 1U8NB 5E2TL 4OI7A 4XI5C 4IOFC 4KI5D 4H5SB 5EU3A 3VXQA 5F2FA 5INDA 1YMMA 2QFRA 3T4YA 4ZW7A 1RAMA 5K9OA 2GT9B 1KBVA 3WNIA 4X5XB 3PWLB 1I4FA 3I75B 4HMDA 1RPQA 3G5YA 5CZVL 5ETUA 4U1KB 1J0ZA 5LBGA 3A23A 1P2CB 3HE6D 2J12B 2X4SA 1OTUC 4ZFFA 5FKPA 2EDHA 2ZJSL 4XNQA 2D0FA 3FQTA 2CA3A 3FFCD 4PD4K 4M9PA 2IDTA 2I07A 5T1MA 3ABGA 2YC1A 4MD0B 3WTSA 1LO4L 3OAXA 5DJ0B 1JTPA 4WEBL 1L5GA 2OR7A 4GO9A 3MNWA 3NJXA 5I18H 1NWOA 5T1JA 2F7IA 2IH3A 4FAAB 1MCSA 2YD9A 3AUVA 3SD5A 2VW7A 1T7XA 4YDMA 2KMWA 5JW5B 3AREC 1PSKH 5L0QC 5I30L 1OP3H 3RWEA 4JFVA 3AREA 2LLLA 1AE6L 2MCG1 2AJ3A 4K15A 5KVEL 3K71B 2QQLH 3BT2L 1F0LA 3P2DA 3WO4B 2DIBA 2JLPA 4WCYL 4BFFA 4WFEE 2NCMA 1ND0B 3FQYA 1XX9C 3DX2A 1JYNA 3W82A 4K8RC 3HARA 2QADB 1MHHA 2QSCH 4L3EB 1X9LA 4K71C 5BS0E 4PR5A 1LQBC 5HHME 2P5WA 3MGOB 2WUBL 2IQAB 3L9RB 5GGUA 3RTQA 1JZ4A 3WN5C 4JCWA 3CNKA 4G6AD 1MW1A 1JYXA 3LRMA 4WF7A 2HFEA 2XPGA 2IH8A 3IT8D 5TE4H 4K5PA 1UQSA 1YA5A 4YHNB 4BDVA 5I24A 3VW3H 2E7LC 4TLKA 3H6JA 5DWUL 4AGNA 1J12A 4N0UA 3TVMC 4DHLA 4DP4X 3W0WA 5I6OA 4LSUH 4TSCL 1PD1A 1YUHA 4GXUN 3ZKMD 2FSDA 1YEIH 1KJ2L 3MNVA 3KLHC 1IGTB 5KVDL 4JFEA 5CUSL 1B0GA 2H8PB 4XPHL 1RL1A 5EFIB 4UQBA 2WLHA 3VH8B 2DY2A 4Y5YC 2DL9A 4OIAA 2XBZA 1M7DB 2WXOA 4HHAB 1P7QA 4AYGA 5SV4A 1FG2A 1MHPH 3GMNB 2CD0A 1A5FL 2PR9A 2ATKB 1BBJB 3AG1B 4WHDA 4Z7IA 5FB8A 1E9QA 3SCMC 3WNPA 4YHML 1HCFX 2VUOA 4X1HA 4K8RL 1UCBL 2QDVA 3NZ8B 5BRZD 2HKAA 4HMCA 1DHKA 4BSVB 1NCAL 2CH8A 1MVYA 3O0RH 3VWJA 3IAGC 3IK2A 1G9ML 3DPDA 3BJ91 5DZPA 2D7MA 5IHHA 1URZA 4JDVA 5DLLA 5H2BA 4A2MA 1CDGA 2PUQT 3PNWB 1FLRL 2I26N 4W9GC 2KSBA 3RDJA 5IJCC 5EO0A 4HEMA 4HIEB 2K8MA 1A3ZA 2XPYA 5KSAD 4P3WA 3BKMH 3SPJA 3MLWH 1G7IA 5FWQA 3HZKB 3Q8AA 3K2UL 3QUYD 4AT6B 1T66C 4ZMQA 2KLSA 4PRIB 4N2OA 3S34H 3U4BH 2FNBA 3CK0L 1DZEA 3OJMB 4AIZA 1FLTX 3CFKB 2VMFA 3VFTA 3V7AE 2COVD 3F64A 4FQXC 4DKEL 4I7ZC 4O5LH 5I6MA 2QHLA 5E2TH 3N91A 4WI0B 2H26B 3WHE0 3VD9A 1P69B 2VC2L 3H9HA 2EADA 2YCWA 4KXCA 3L2NA 5TDNA 5CZVH 3HE7A 2ZXDA 4K23L 1VIWA 4UCFA 3GRWA 3P4MB 3IDJB 1G4MA 4OLUH 4QF1B 5CIPH 1IEHA 1DJGA 4TVPL 2ICCA 3Q8CA 2ZJSH 5IFAH 1T83C 3QA3B 2GSGA 4GSXA 5E5UB 5E8OA 5HHOB 4HUVA 4QRFA 3D85B 1LO4H 2YK1L 3KEDA 1AXIB 2R15A 2BHZA 4HDIA 4BEYA 2YRBA 2O6CA 2PXYC 3ZZ1A 1TZHB 5DEGA 4BCZA 3AZUA 2H2PC 5L4JA 5D1ZB 1KELL 1NCJA 1W0WB 1ZTMA 1NM4A 2G75A 2YQGA 4GQRA 5DUMH 1JPFB 5I30H 3O4LA 1OAYH 3WTXA 1WITA 1AE6H 3EYOB 4MD4B 4NJAL 1KLUA 4G5AA 1I7ZA 1UWXK 4KRNA 1S7SA 5KVEH 3RBGA 4HK0A 3BT2H 1NOFA 1NA8A 1KFGA 4WCYH 1A3LL 4G6ML 5F7UA 3SDAB 4EQ2A 3M8OL 1QP1A 3UG4A 1CFSA 1KJVB 5DJAB