5TGZA

Crystal structure of the human cannabinoid receptor cb1
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
439
structure length
439
Chain Sequence
GGRGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLAAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDKTYLMFWIGVVSVLLLFIVYAYMYILWKAHSHAVAKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSWEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAIPDQARMDIELAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Cannabinoid Receptor CB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Cannabinoid receptor 1,Flavodoxin,Cannabinoid receptor 1
total genus 167
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 5tgzA01
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5tgzA02
5EN0A 1FLVA 3X3CA 3S2YA 4M0CA 2QWXA 1Q5JA 5KKHA 4N82A 3AYMA 1AT9A 2V9CA 2HNBA 3RPEA 5JJJA 5AHYA 1OFVA 3W78A 3HAOA 3UTVA 5G54A 3EMLA 4N9QA 3V2WA 1FX1A 4XXJA 5G2DA 1L9HA 1IW9A 2NTWA 4KLYA 3PBLA 4G7RB 3LCMA 4MD2A 2QX6A 2ZKIA 3N39C 4Y7CA 4G7QB 3G5MA 4QOEA 2MTBA 4PTYA 5LBTA 5AWZA 3EDOA 3U7IA 3NHLA 4G72B 1YCGA 1QR2A 2OHHA 3OJXA 4R81A 1X0SA 3RZEA 1XJIA 5FUQA 2KSBA 2QX8A 1AKVA 5B6YA 4QOIA 2X2OA 1C3WA 1D4AA 2YCZA 1KBOA 4OV0A 3S8FB 4AMJA 1ZWKA 5LLDA 2FOXA 5ITEA 3ESXA 4N4WA 5BR5A 4HYXA 2Y01A 5H2JA 3HAQA 4QRYA 5AX1A 3ZEVA 4NC3A 4DIKA 2KSAA 1RLJA 3QJTB 5B3KA 1S54A 4YQEA 5H2OA 5H2LA 1S8LA 5G2CA 3NS0A 1BM1A 5DHGA 1X0I1 4IAQA 4TL3A 4IARA 3O2NA 2J4YA 1IXFA 2QMYA 2I21A 2M3GA 2R96A 3QJVB 2LNLA 4HWLA 5BR2A 1VMEA 2F1OA 2Z9BA 4BUOA 3REYA 1E12A 1JV6A 4G71B 1FUEA 2YCXA 4GBRA 4ZVMA 1AZLA 1S53A 1RCFA 1JGJA 3KAPA 1H66A 1ZX1A 2X2PA 3P0GA 3F90A 4X32A 3KAQA 3N3BC 4YALA 1SG0A 2L6XA 3ZHOA 3F6RA 1ZWLA 1E0PA 2V5UA 1AG9A 1DXQA 1T5BA 4UG2A 3NHKA 1O0AA 1P8IA 2FX2A 1F50A 3FJOA 2QPEB 3CODA 2Z98A 1UAZA 1F4PA 5B35A 3UXEA 2YDOA 3N3AC 2BPOA 2M6RA 4JR8A 2ZZLA 1IW6A 3FW1A 5G36A 2F93A 3QFRA 4L6RA 4FGJA 2ARKA 1D03A 3WQJA 1B1CA 3P0RA 4A4MA 4GP4B 1CZUA 4FAAB 2W5UA 4MD1A 1CZOA 5NLLA 3UXHA 5LJIA 3NHWA 4QOGA 4C14A 1CZNA 4GPOA 2RG1A 1PXSA 3NY8A 3HR4A 4CF6A 1GZMA 3B6JA 2FZ5A 1BU5A 1KG9A 4GP5B 3NYAA 4YAOA 2YCYA 1TLLA 3QJSB 2OYSA 1TN0A 4FBZA 4KNFA 3OJWA 5F51A 3OX1A 2Z9CA 1XYYA 3ZPRA 4ESEA 2VT4A 4C76A 2MT9A 5EAIA 1GG5A 4NULA 5H2PA 1CZKA 4MQTA 4GR9A 1C8RA 4J4QA 3K1YA 1V4BA 3NHUA 3UTXA 4AMIA 1LN6A 2ZFEA 2JAGA 2D5IA 2WJKA 1J9GA 1U19A 5NULA 2Y00A 3HARA 1OBVA 2FAXA 4LTDA 2I20A 3OE0A 4FGKA 1E5DA 3F2VA 2I35A 1P8HA 3D7NA 3EYWA 2BRDA 1XYVA 4BMPB 3PWHA 3C9LA 1AKRA 3OX3A 4XDGA 1C7FA 5G2AA 2XODA 3EH3B 5B34A 2M6SA 2Y02A 2GSWA 1JV7A 5BUCA 2QX4A 2Z9DA 4WAVA 2FZVA 1QM8A 3ES9A 3NHFA 3VHZA 4YAUA 2I1XA 3OAXA 2QMZA 1FTGA 3SVLA 1JA0A 4Y9RA 3AYNA 1YKGA 5DYSA 2KSYA 3UONA 4H6PA 4XTNA 5A45A 2WC1A 4CETA 4ICIA 3S3BB 2FDXA 1F88A 1RTTA 5DHHA 5B6WA 5A8EA 4LDLA 1QKOA 3ODUA 2XOEA 3O73A 4S24A 1X0K1 4X1HA 3BVDB 4NLLA 1YRHA 4GI5A 4XTLA 1R84A 3SN6R 4LTNA 4GQIA 4HYJA 2R4SA 1M0KA 1DZEA 3HASA 1L0MA 2B3DA 4XT1A 1J9ZA 4HEQA 4FA7B 4DILA 3MBVA 1D04A 1KMEA 3S3DB 2R97A 4ZVLA 4ZVNA 3T45A 1T0IA 5TGZA 3ZPQA 4IB4A 5C1MA 1SQSA 3PQRA 1EHKB 3EH4B 1BRXA 3UG9A 2BMVA 5F4BA 5AX0A 4BEYA 5B2NA 4HS4A 1AHNA 2KS9A 5H2HA 4X31A 3QBLA 1FBBA 1FLAA 1R2NA 3QBGA 1C7EA 3GFSA 2RH1A 1I1OA 1NNI1 2PEDA 4EJ4A 4QOFA 5JROA 1J8QA 2KQUA 1QBGA 4U7GA 4EIYA 3TZBA 4GRVA 1F4ZA 3S8GB 2Z55A 3OE6A 5ULLA 3W79A 3PXOA 1JA1A 3TE7A 1CZRA 1H68A 3ESYA 4BWBA 3VI0A 4L35A 1CZHA 2QPDB 4DAJA 1FVXA 1KGBA 5LMCA 3PDSA 4H2DA 5AHZA 1J9EA 2KLBA 1XIOA 4PU0A 2ZIYA 5B6ZA 4BVNA 3U7RA 5FJGA 2Z73A 3VVKA 1YCFA 1RLIA 3NY9A 2MWMA 2MOKA 2FVXA 3VGAA 4DJHA 4PTZA 1MGYA 3KJ6A 2YCWA 3L9WA 3NFRA 3C9MA 2N1MA 1QKPA 2QX9A 2FCRA 5B3LA 2Q9UA 3ESZA 4BEZA 3DQBA 4N4YB 5LBUA 3D4SA 3HA2A 3QFCA 3OX2A 2F95A 1FBKA 2HPVA 5ITCA 4FGLA 3QDCA 3TEMA 4PXFA 6NULA 3GFRA 2BN4A 4LTMA 3QJQB 1WSBA 2Y03A 5LVAA 2OHIA 3HANA 1S51A 4LDEA 4MQSA 3S3CB 5H2MA 2BF4A 1AKUA 5A44A 1GU8A 1AMOA 4F8YA 4DKLA 1AKTA 3R6WA 3B6IA 3V2YA 4FPDA 4YAFA 4Y9UA 1UCQA 4G7SB 3FNIA 1S52A 5ETZA 3QJRB 4LAFA 2Q62A 4C0WA 1S8JA 3HLYA 5G53A 1AKQA 5H2KA 1Q5IA 2HNAA 3K20A 4GP8B 1HZXA 2JAFA 1M0LA 5A4KA 2A5LA 3W7AA 4BMOB 3VG9A 4N65A 5FX2A 3QE2A 3OE9A 4MBSA 3FVWA 1BRDA 1DXOA 4QIDA 1DX9A 3NHYA 1OBOA 1XI2A 3KLBA 1FLDA 3L9XA 3LT5A 1AP9A 4QOJA 1QHJA 4JQ6A 4XTOA 5G28A 4WW3A 2NTUA 1TIKA 3OWXA 4FX2A 4OXXA 3QJUB 4LA4A 1CZLA 1CWQA 1YDGA 3GFQA 4K5YA 3DDLA 5B6XA 3GAMA 4U7FA 1GUEA 1QHEA 3RFMA 3QAKA 3CAPA 2QR2A 3OWHA 3QAPA 2R4RA 2X72A 4EA3A 3W77A 1XMEB 1BVYF 3B6KA 3AM6A 4JKVA 3ABWA 4D02A 5J7AA 5B0WA 3FX2A 4UHRA 4QODA 3NHRA 5EA2A 5F8UA 1KBQA 1M0MA 2Y04A 1JFPA 4QI1A 1AKWA 5H2IA 4YAWA 2OHJA 1KG8A 3QBIA 2YDVA 4N6HA 3QBKA 4XT3A 1X77A 4G70B 1TN5A 2BZSA 5JJNA 3JSXA 4J8PA 4QOHA 3F6SA 3NLLA 3HAPA 3NHPA 5B6VA 1H69A 2G87A 5JJEA 2AT9A 4Y9HA 3UTYA 1YOBA 3A7KA 3UTWA 3COCA 3VW7A 3OE8A 1VGOA 3NHSA 4PXKA 4ZVKA 3OVMA 1WSWA 1C8SA 3B6MA 4LDOA 1PXRA 5H2NA 1H2SA 2FLVA 2EI4A 2WJLA 3KEGA 3NHJA 4BV0A 2V5VA 5F12A 1PY6A 4C0XA 3EH5B 5LWEA 4XDHA 5LJLA 1QRDA 3UZAA 3X3BA 1P8UA 4GYCA 2HPYA 3NSBA 5AZDA 4DY4A 1BRRA 1XT6A 1YCHA 1VJMA 5FA6A 3UZCA 1FLNA 4U7HA 5EMNA 2AMJA
chains in the Genus database with same CATH superfamily
4D9NA 4G63A 4M0CA 5KBYA 1HO3A 3D2AA 3IAHA 1N2SA 2Q3CA 1NC3A 1QFMA 2YW9A 2ZDQA 5CJ2A 3TZQA 5HKBA 4RY8A 1PFWA 1L5WA 1DAPA 2F1HA 3RC8A 3AYMA 4C29A 3C3XA 2Z6QA 3NM5A 2J9FB 3ESBA 2V1UA 3QTLA 2PQ0A 4U8GA 2PO5A 4RMJA 2Z4TA 1PWHA 1XDDA 4N3NA 5C7YA 2GGSA 3ZE6A 2ZIVB 3GJ4A 4WZAE 5TMPA 3HGQA 4DOMA 3ULKA 5BSEA 2XDAA 3H9GA 4ZEXA 2IUUA 3WL6A 4W99A 4W5QA 3FROA 4NZPA 4HP8A 4LZJA 5DXJA 2HK9A 2JKZA 4CM4A 4EI8A 2OQ2A 3U3KA 3VH4A 2YHIB 3AM5A 4C87A 3KVVA 5FLXA 3CCFA 2VA9A 1YBAA 1W88A 3EVGA 2PUEA 1TYCA 1C1DA 4N48A 4MCJA 4TMVA 3WHLA 1SU6A 3BWDD 3O74A 3I61A 1Y5LA 2A0XA 4F91B 4G72B 1H23A 1ZSVA 2HJSA 4F97A 3W5DA 2UXBB 3TRFA 5ELXA 3ZQUA 3OFSA 3CR8A 4CWAA 4TVOA 3V3KA 3OF5A 3PU6A 1CD5A 5L3QA 3DEZA 3C70A 3MOIA 4DV6B 5JHGB 2SHKA 3ERCA 2QZJA 1EGVB 2QX8A 2JGMA 2QG6A 2CZGA 3VU3A 3U9TA 2DKNA 4YRJA 2OPHA 4C3ZA 3PEUA 1VSTA 1N1EA 1NI4B 2EG9A 3UO8B 1E2HA 5BOSB 1F3OA 4LYGA 4Q7LA 3NX4A 2SKDA 1JHXA 2VRCD 1AQLA 3EXEA 3LUPA 3T9FA 3DC7A 5SYAA 5GWXA 2Y01A 3G89A 4YS6A 4S1VA 3N53A 3HAQA 1V8FA 3UMYA 3PLNA 2ADOA 2IHYA 2QE7D 3AJDA 4FDUA 4ZVTA 1OBCA 2QN8A 1CNFA 4MR8B 4XCQA 3SX2A 1DG3A 3VVBA 2CBGA 5SYMA 4CM6A 4DIOA 1VE7A 3U7HB 1Y7IA 4NPCA 4L6AA 4KRXA 2PNFA 3NS0A 2WIGA 5K0EA 1U1CA 3MRXA 3SXUB 4UPVA 1CQJA 5D51S 1DKQA 4M1MA 1UZLA 2CCGA 3UN1A 5KNCA 1DO0A 1FDTA 2RHLA 3K9HA 1ACMA 4HN9A 4RQUA 4RVGA 3GXOA 4BQFA 1NKVA 1CR2A 5BW4A 3A9CA 1O54A 2BGRA 4ABYA 2MSNA 1J8FA 2X3UA 2ZPAA 4EO4A 3Q7QA 3OQJA 1Z2DA 3HJBA 3HKEA 3U3XA 3QJVB 3A28A 3OZXA 5ESWA 3RRXA 3ZGXA 2ZYUX 2CWDA 3FBGA 2BLLA 3L8EA 3KVRA 3VR3D 2RB4A 4PSKA 1FUUA 1LNQA 4IFBA 1ECCA 5CB8A 1SXJE 1MO6A 5E6RA 1RCUA 4P1ZA 5JIBA 1NPDA 1PEAA 3B1KA 4PGMA 4ZJPA 3DO5A 3BWMA 3D6UA 5AK5A 2G7MC 4OXIA 3EQ9A 4OH7A 5B64A 3KAQA 1MZVA 3NTUA 4YALA 5C5EA 1Q1AA 3N0WA 4RV4A 5AI5A 1GNTA 4B3DA 4D6PA 3V2IA 3IJ5A 4AUMA 1E0PA 1IWPB 2VQ6A 2BFBB 2XXJA 4J1NA 1US8B 1H2RS 2PYIA 4D56A 1RXWA 2O5EA 2NO0A 9ABPA 2BBOA 4GLFA 4QVIA 2EGGA 2M6RA 5COQA 5BP7A 4FFOA 5IDYA 5AHOA 3VYUB 3WMWA 4AULA 2O57A 2PUCA 1VIDA 4HDMA 1GG2A 2E18A 1DTWB 1WUJS 2NUAA 1I9CA 1UMDB 2FN8A 3A9SA 4TOIA 3WYGA 1FEZA 3HB7A 2RI1A 1CZUA 2PU7A 3F7NA 1QYCA 1UBJS 1S4QA 4ZDJA 8MHTA 1GGMA 4NCAA 3AR9A 5ICCA 1DWPA 3AR2A 3F9RA 3N8GA 1P33A 3AF6A 1FL9A 4Q6WA 3EZ2A 1E58A 3WGYA 4EB8A 2ZR7A 4HO1X 5HM8A 5KYYB 1SBIA 2PHZA 3GGJA 3EQ7A 4ZU6X 5JYEA 4CI9A 4ZQCB 3UJ8A 3MMXA 2R1TA 3LLCA 2JLRA 5TSDA 1L4KA 1RJGA 1QCDA 1Y8QA 1A7AA 3LYAA 2Q1YA 3X1XA 4B79A 5JS2A 5F98A 2VDLB 2Z5FA 3P2JA 3FUUA 3OOYA 3BHNA 3QENA 3W5CA 3GLGB 4WN9B 2OYSA 3AF1A 4HZIA 3HK2A 4EPTA 1TN0A 4YRPA 1NVMB 4Q3NA 3RRFA 2GBGA 5SYNA 3TE6A 1X13A 1ORDA 3IVXA 5KNBA 3P8ZA 1A9QA 1JHAA 4Q16A 4URUR 1FBTA 5K0LA 5BSTA 3AHHA 4NYMR 1RJWA 2PM8A 4XGNA 5IVPA 2O3UA 3NHMA 1HNWB 5CURA 3RRYA 1NT4A 2I6QA 1M6NA 2QSUA 3UJCA 2WYOA 3NBXX 2O9JA 4PPQA 1RXSA 1Z4IA 4P53A 1L6RA 2FR8C 1C8RA 2DQSA 3IAS6 4GKVA 5KVCA 4YJ2A 2Z6AA 3WK6A 4JI7B 3SSAA 4GQBA 1NG9A 5D84A 3P32A 4ZMBA 4ZRDA 4US2R 1P1IA 2IXGA 8GPBA 3X1ZA 1GSHA 5I8WA 3NT4A 4UHCA 1E2EA 1X8LA 5E4JA 2CFRA 3SZLA 2O2XA 3D3JA 2HMSA 1UJ2A 1N0UA 1S3SA 2GK4A 4JUBA 4MB6A 1GPDG 3IUPA 3OQVA 4Q4JB 2F9FA 1HQKA 1R1DA 1VFNA 3A2MA 2FDRA 3IAM6 2IWRA 4BMPB 2V97A 3PI6A 4OOEA 2BP7A 2VIIA 3BH0A 3BMXA 3VO1A 2WYHA 4MS4B 4V39A 5C1OA 1YMQA 5DPMA 3TVYA 1PX0A 1AO3A 2PA0A 4NDZA 4EG5A 3T41A 4QJBA 1GUAA 1P9NA 1JV7A 1OXBB 3DMPA 3JWIA 1KDYA 2LCQA 3EG5A 4G1EB 4HDNB 1FFCA 4WAVA 1G5QA 2DT8A 3A9RA 1T35A 2G4CA 3EA5A 3BMNA 1LFAA 4RA9B 4WZZA 4HK4A 3VHZA 3L1UA 4ID3A 3BGWA 4RJIA 4UCFA 3VH1A 3Q40A 3WC4A 5CITA 1R9GA 2IZZA 2XGSA 1KDZA 5HPYB 4GNRA 4Q5IA 4EYQA 2WUDA 3NNNA 1MJNA 4XTNA 2W4MA 3ONVA 3PZRA 4JLDA 4LOKA 4YA6A 3N76A 2OP0A 4JVOA 3MWJA 4QXMA 1T13A 4TWAA 1G6Q1 3H11A 1BROA 3IVAA 5CVDA 5T4BA 5HFNA 1UBUS 5DHHA 4E12A 4Y6QA 1MXHA 1VYVA 3AY0A 1YR2A 3D4BA 4J4TA 2JJYA 2QGNA 2WEKA 4EJSA 2WWTA 3UV7A 1OY1A 1G16A 4PIVA 4PV7A 2ODNA 2QNBA 5EUBA 3BVDB 4R0MA 4CQMB 3A1WA 1LVGA 4RK6A 2UVPA 2JAWA 4C7OA 3DWFA 4JIGA 1P75A 2XXAA 4PWZA 5A7FA 4G0XA 3LRXA 5AVJA 2WSLA 3V8PA 4NU0A 4OMDA 4Q24A 1SULA 3DBLA 1U0JA 3DONA 3IEIA 3B2NA 3IUQA 2C4WA 4GGPA 5A7HA 5L3SB 3A70A 4BWFB 3OO0A 4WXYB 4MTLA 1QFXA 4Z4FA 1CLUA 1K7CA 1UBTS 1I33A 4CG0A 1IMOA 1XZEA 2W7TA 4GBED 2C4UA 2QLTA 1M0TA 4KQFA 1PYDA 1QHSA 1OT3A 3CV3A 3PFNA 1TQ2A 2JKYA 2W6MA 2QG9A 3G8CA 1S6YA 3L77A 4GPD1 3EHDA 3I9LA 3MELA 4I1YA 4RPGA 3M1LA 4XYGA 3H42B 4H6XA 4D3FA 4LYEA 5JNSA 1I51A 3KSMA 4EYKA 2PMEA 4IDNA 2VDMB 2UYYA 4UNIA 5F4BA 2FY8A 3QEBZ 3ZWKA 4F4HA 1M3SA 3X1DA 1NV8A 2Y77A 3KOZA 2CEKA 1DAEA 2HJHA 4E2FA 5LM3A 1Z82A 1RADA 2VXOA 1T2FA 2CBXA 3ITEA 1MLDA 1INLA 2ZQZA 3HBAA 4EJ4A 2WJVA 2OSBA 4EAQA 1PE0A 3O8DA 4PLFA 2CHGA 3CLRC 2ZI7A 3WIUA 1OLXA 1J8QA 1XJ0A 1XWFA 1NJ1A 2VDQB 2ONZA 4O2AB 4PO1A 1KEKA 3L40A 1RWBA 2PZMA 4KMRA 4GRVA 4RUKA 4TLMB 2JL1A 1C3OB 3ZIAD 2GUGA 2D13A 2COUA 2XGGA 3G7SA 1U94A 4HH1A 2F7SA 3LQ1A 4M0LA 3W79A 3ZEIA 1UDCA 2NT3A 2GERA 2OECA 1QK5A 2VLIA 4G0NA 3SIPA 3FYUB 4MJLA 3SDSA 4BO1A 3DM9B 2ZAIA 4PSDA 5KAPA 3L1KA 3VZPA 3RYIA 2XDQA 3TPZA 4YMVA 3LDFA 2O8DB 4DGSA 3EVDA 3M1IA 1L7EA 3KOUA 5H68A 1KQOA 3BREA 2QVXX 4H2DA 3WWEA 2VRNA 4CI0B 5K9ZA 3OE7A 5F33A 5AXAA 3L3BA 1G1MA 1EAYA 2PBZA 3EAQA 4M0DA 1E9SA 2XR1A 2ODQA 4XJXA 1SKUA 2C8VA 2C3MA 2QTTA 4MX8A 4YASA 5EEGA 3UY4A 4C2AA 4XJSA 2AC4A 1W8DA 1YIDA 1TVMA 3NASA 4TMKA 4DLPA 2YHBA 4ZT2A 3ORRA 1ZD5A 4NK4A 2DR0A 2ONKA 4G8CA 1EVJA 4J16C 2PAFA 5BSFA 2CL7X 1W5EA 1WXDA 2F00A 3CRRA 1N6HA 2PUFA 1DMSA 4OGFA 4UTXA 4WACA 2OFPA 3DR3A 1C9KA 2R1VA 1N1DA 1QRRA 1ZD1A 3QFCA 3AHFA 3X3HA 2IUEA 4CT4B 2QNIA 3ACBA 5FIUA 2OXIA 3A2NA 3C5VA 5I51A 4R3WA 1EWVA 4JJGA 1MABA 3REQA 3CLUC 3STTA 3PFBA 4GXQA 1JLHA 2GFHA 2Y03A 4ND3A 4RFVA 1QCCA 1Z2PX 5JDCC 3FG9A 1QH8A 4P7BA 1H2HA 3W7BA 1MOSA 5ALZA 4WLNA 3BWVA 1S2GA 4NE9A 4Y6RA 1DUVG 4R98A 3IKTA 4AWAA 3T9BA 4MK4A 2H57A 2NPOA 2WJZB 4OQMA 1EFPA 4QFDA 1X74A 3HSYA 1CUSA 3OLCX 5CX1B 4BQRA 4CTJA 2RD2A 1GPJA 4OB6A 2LE0A 2XQJA 2HMAA 4FSXA 4H9GA 1NNLA 2C78A 1LSOA 5CB4F 1E69A 2P9GA 1H1DA 1Z33A 3G1TA 3GI1A 3TLKA 4D6YA 3RVPA 1Z22A 4OI1A 1OB2A 4MMXB 2AWOA 2VQEB 3S70A 1XPRA 1DAIA 4XI9A 4WLFA 2ZB7A 3PKIA 4AUNA 3VQTA 4RYLA 2Z3ZA 2M98A 3U4CA 1K97A 4XDYA 4OAOA 3LTNC 3NHBA 4GU5A 4YNBA 3ANTA 3P2KA 4Q1AA 2C9YA 4Y0AA 4PN3A 1P19A 2FHSA 2NYAA 2RC6A 1DEXA 4DSZA 4KFCA 1AKEA 2ZRQA 4MW5A 2FSHA 4XYMA 4DG8A 4ZOAA 2Y0DA 3NB0A 1ULTA 1NE2A 3CE6A 2I80A 1S2OA 2Q4EA 1KFCB 4ZYLA 1QHJA 1R4AA 3T99A 1JR2A 3FAKA 3SDZA 2DPYA 1E79A 4QARA 3V4OA 4LG1A 4NFSA 1JR3D 1RI5A 2JA2A 4JI6B 4U5XA 4E1VA 3BD6A 1NURA 3L7MA 5DCWA 6GPBA 5DIZA 3JAKB 2CYAA 4MI6A 4M1QA 5SV2A 2I7DA 3HFSA 1VBNA 2WHXA 4RIIA 3UH0A 1HUQA 1SCJA 4LVNA 2GCOA 1JHPA 3O8NA 3M2TA 3QXSA 1E8DA 1A7KA 4GGOA 4IDAA 2R4RA 1M5UA 1JNXX 1QIEA 2ZRMA 4Q4AB 3RFVA 4HWGA 2FPUA 2PZGA 3ABWA 1CUXA 1P2DA 1L1QA 3VVLA 4YAGA 1PGQA 4GX1A 1U5BA 4YMWA 2GYYA 2Z2YA 5K51A 4NYIQ 2XPCA 1U4SA 1XZLA 1GNSA 1KC1A 4NNPA 3WL3A 2HREA 3B3QA 4QGGA 1C5KA 5JCJD 5L40A 1M0MA 1UPFA 4LY9A 2R7KA 3ORHA 3KDSE 4NRDA 4YRBA 3IPRA 4M36A 4YAWA 3U39A 1SC1A 5GOZA 2RJ3A 3DYVA 3QBIA 1SCKA 4IV0A 2EP5A 3WLHA 4B80A 2IHZA 5AW5A 2IZ0A 1KZ4A 1VP9A 3HC7A 2H4JA 3LKVA 5HRUA 4I1UA 2OGZA 2HHAA 1IN4A 1G2OA 1XB2A 1G7SA 3A1FA 3GRYA 2CXUA 3ZZ0A 4OVKA 5A9RA 3OX4A 4LRWA 4QQRA 2CE7A 1S2NA 3DF9A 4B47A 2V7VA 1Z47A 2I1QA 3R0ZA 4MVJF 5FI0B 4U6QA 5CFLA 3FXAA 1Q0RA 4BATA 2YCBA 5IARA 3CLTC 3OE8A 4OAPA 2E1PA 5E6SB 4CE6A 3LC1O 4AX4A 3JQQA 3PSHA 3RJ9A 2REOA 2WNSA 4ZVKA 4D3DA 3OM1A 1NKTA 3Q9LA 5FO1A 5E7JA 5SICE 1ZM3A 3IT1A 3B6MA 5LZ5A 1KYZA 1H2SA 3F67A 3KVOA 2EHDA 4HL6A 4IOKA 1QDUA 1QVVA 3IMEA 1Z2NX 3CLKA 3TW8A 1JEJA 1EMDA 3E1SA 1FRZA 1LLFA 2JJ2A 4Y3UA 1UFVA 2ZSHA 3QGMA 5LJLA 3K6JA 3H1GA 3PUZA 3ME5A 2IKSA 3R3ZA 1Q2XA 4WD3A 2PZ8A 2EJUA 1I1NA 4F7WA 2B5VA 2AOTA 2ZJAA 1TAGA 3ZU2A 2AG5A 4C6SA 3UJNA 2JANA 3CUTA 4I55A 4MQFA 2AMVA 1YZNA 4ZEOA 1BMDA 4J9VA 4LJKA 4NABA 4P4NA 2XYPA 4UHJA 1NUPA 1PG5A 4URXR 1WB4A 1T4GA 3O91A 2XOXA 1KJ9A 2HJWA 4URWR 3HCCA 5EIEA 3O9VA 4YJ3A 3WTCA 3EGVA 4QDTA 5EMLA 1JHDA 4C4ZA 1GAQA 4NI5A 2ZYDA 4I4IA 5BSVA 3DL0A 4IXTA 3DV9A 5KSWB 2HV9A 3BRWA 4EFMA 3NAGA 1X87A 1XTQA 3O94A 4XFJA 2P6NA 4MH0R 3SM9A 4D9EA 3L4KA 5EQFA 1L5GB 2J3DA 2OTCA 3T1OA 5MDHA 2R79A 3UOAB 3DDZX 3VH2A 3DA8A 3S2GA 2Y71A 4LJ5A 4FMBB 1NV9A 1HBJA 2GZSA 4KLYA 3VPFA 3QA3E 3QY0A 3JD1A 4RD1A 4BNDA 1B6GA 3G68A 4M8NE 4W9NC 2LV8A 4CYMA 4ES6A 1QDLB 1UQRA 1E5TA 4QWWA 1KI8A 1J2UA 4QOEA 2MTBA 3BQ9A 4DBLE 1Q0UA 2GO1A 3CJRA 4DLUA 4IFEA 1U8EA 1T5DX 5KTRA 1U3GA 3HFGA 3K32A 2HT6A 2VF7A 1Z16A 2ZR8A 2A9VA 2LRHA 3USCS 1QO9A 4JJEA 1Z0ZA 3GGPA 1RNLA 1VSVA 4H0CA 4K6OA 2NM0A 4IG9A 1CQIB 3HP7A 4MEJA 5LMUB 2XE7A 4XVQA 1FMFA 3ONDA 5JMWA 1UKCA 3NYQA 4BV2A 1DC3A 1E4EB 1I7LA 2VCHA 3S55A 4UQLA 2H1OA 5C8VA 3LQ2A 3I6BA 4Y2JA 1E1KA 3CRQA 4HQ6A 5C32A 1HORA 1THGA 5D1HA 1R9JA 4OLBA 2ZFUA 1TA9A 4EZIA 3IDOA 1BHSA 3PJFA 4LZZA 3V3TA 3ZWBA 2IYLD 4K6MA 5IBQA 3MYYA 3CX6A 3QBDA 2KSAA 1OASA 2CLMB 3LSYA 3Q41A 4LJ4A 3K1ZA 1EVIA 4OM7A 5FPSA 5H80A 2MCFA 3ZWWA 2XYQA 3GMSA 1YFLA 4IUCS 4P35A 5B1IA 1QMGA 4E15A 5HE8A 1NVXQ 1TM1E 4QOSA 1F6WA 1DAFA 1NRXA 3QVGB 4NJMA 1CR4A 1YMVA 4YRZA 4F71A 5FJJA 1GL6A 4RPLA 2B1RA 4ARZB 2QSZA 3HO8A 1RYYA 3C1OA 2XADA 2FGKA 2A9OA 1LK5A 4QEZA 4YY3B 3O3NB 3I2IA 2PLWA 4LWQA 4C03A 3HB9A 2FRDA 5EKXA 1WB5A 3OIGA 4XEHA 5J2UB 3UWDA 2YC4C 3DEFA 2EG5A 4FFPA 4R0NA 3EGCA 3AERB 4G0YA 4JB0A 1D2AA 5EKUA 4L5BA 4X0EA 3PPIA 3AK4A 3B5EA 4DR6B 4WA7A 4M9RA 3F90A 4EF5A 3RS0A 4LE1A 4BAUA 2IL1A 3F7TA 1YZKA 5JC1A 1BH2A 5BN5B 2VSOA 5TQ2B 2CC2A 4C6TB 3AKCA 4HQLA 4MVJM 5KKCA 3ZXUB 1B0PA 2GKOA 1TMKA 1ZWLA 3FKSD 1RP7A 2E48A 2ZBUA 4KN5A 5CVCA 4JKOA 1KSGA 3DBRB 2PSHA 3HJRA 5FEMA 1O0AA 3L8DA 2R4QA 1MJGM 1OFUA 3A7DA 2KSQA 2QDXA 3SZUA 3ADKA 3FFTA 3GZNA 3D6TB 5LP6B 4HAUA 3RSZA 1F0NA 3ROKA 1KO4A 5E7MA 4JOSA 1BE8A 3HI6A 1W52X 3JV7A 3KTDA 4RTQA 1B1CA 1VI2A 1PDVA 2PVCA 5EGSA 3SFVA 4HMOA 4AICA 3Q7IA 1GLVA 5JY6A 4C3VA 3H2ZA 4MGYR 2XTAA 4JI5B 4P7JA 4XASA 2PKQP 3I9V1 5LYJF 4BAZA 1EXNA 1WA5A 4EQ6A 3FZQA 2RGEA 1QZUA 4PYLA 3KJEA 4C14A 5T8KA 1T1RA 4B3XA 3BX1A 1D8TA 3L01A 2QN3A 3B36A 4TYPA 4XSGA 4G97A 1V8OA 5BMVB 2QPLA 3CMMA 2KPOA 2AN9A 2HWKA 3FRHA 3LT4A 1JIXA 3QX8A 4OU4A 3O84A 1R50A 1U2GC 2ZTMA 4WJKB 5BV2P 3KJQA 3WJ2A 1MT0A 1QPBA 3G82C 4JUFA 3RFTA 1F38A 2JAPA 3BCSA 3JZIA 1G21A 4EG6A 4ESOA 4GDMA 2IYNA 3IMKA 3KVNA 4GRDA 4EUFA 4F9TA 4B71A 5B55A 4DM3A 4FBZA 4ETWA 3MMZA 4DIBA 5HX7A 4XIIA 3MUNA 4O02B 5F51A 2J9ZB 3OX1A 4E5VA 3TZHA 1MU0A 3K2EA 1PJSA 3AEYA 1MAHA 4E4TA 4RF2A 1MG0A 2GETA 2VT4A 1Q14A 3GDOA 4QUIA 1A82A 1LDBA 2X22A 4OHUA 3UAZA 2CF6A 5H2PA 1REQA 4EGCB 4QREA 2H4FA 2E1RA 2WQ6A 4YRRA 3GMDA 1OVGA 4YUYA 1N8KA 3E7WA 3LAWA 3TIXB 3WSVA 3NCHA 4C30A 1N8SA 4PLPA 3I05A 1W87A 3GEMA 1CWUA 2NUPB 1II0A 5NULA 3N7AA 1FB5A 4LYDA 4GKBA 1RZRA 1DJPA 1YHYA 3OLQA 3P0HA 3WLEA 1TK2A 2F59A 2A92A 2ZE8A 5JFGA 1DAOA 2AA3A 5DBFA 3AHIA 4I4LA 4LZOA 2CLDX 1EK5A 3H5RA 3IPLA 3MTAA 1NJ2A 5A9SA 4DLLA 2I35A 1FZQA 3HUEA 1I8TA 4V0OA 3ROFA 4BFYA 3ZH2A 3V1TC 2J5KA 4Q03A 3PWHA 3RIXA 2BFAA 5CGQB 1GNRA 3CNQS 3U6BA 3MINB 3HPQA 4GUAA 4PBRA 3TLYA 5K8TA 1RWQA 4K86A 2FR8A 2V7PA 4TKVB 4A91A 4Q1CA 1VPTA 4RJLA 3TCKA 5BUCA 3EWAA 3I5AA 2Q28A 4BBPA 3ZJYA 1LDYA 3KJGA 3ZWXA 1OFIA 3WRYA 1X1TA 2B4YA 4HFMA 1QM8A 3L5KA 3NBFA 4MR9B 5A5GA 1RHMA 3GUHA 3VYVA 4XIGS 1NOJA 4HWTA 3A6GA 5GP1A 2MYPA 3GLRA 3U4HA 4R2HA 2W2QA 4ZQBA 5AHWA 5HQTA 1YKGA 3KOXA 3TOZA 2PRJA 3U48A 3L7NA 3W9SA 3CN7A 4H6VA 3THYB 3ZV5A 1SQ5A 4HLUC 1COWA 3EGDB 4FIZA 3O83A 1JLMA 3IO3A 1KDVA 3UGJA 5EZSA 1HOTA 4BTVA 2GXUA 3IVRA 1TLFA 4EL0A 1OC2A 3M6UA 2FN3A 2IW3A 4N03A 5FYQA 1I4LD 1NN1A 4BLPA 2QA5A 2CZCA 3O8LA 1X6VA 1QO7A 3BSYA 1J22A 2ZIEA 1GKIA 2BFPA 3GVPA 4IW3B 2HK7A 5DX0A 1EFRA 1FC0A 2LUOA 4MR7B 3C6BA 4L78A 3ZY2A 2XIQA 2C4KA 2DFNA 2YY6A 1F9AA 3AUXA 1HDZA 1USUA 4GX5A 1QWSA 4HEA6 5KWJA 4HBGA 2B92A 1RJDA 1L0MA 4ZMSA 4U6NA 1Q92A 3NUGA 4YLEA 5D2CA 5DHPA 3SBXA 4QGBA 4JI3B 1PR2A 3TD2A 1ZIPA 1YUBA 2JGDA 1FE8A 5D87A 1ZN7A 1N7HA 2VEDA 4K3VA 4YI5A 4X95A 3W2GA 4CMCA 3FYDA 1FQOA 2O2ZA 4IOJA 2PJDA 4AKHA 4U7JA 3AONB 3SYRA 1BHJA 4AP5A 1TK9A 1U0BB 1HF3A 1OU4A 3A9UA 3KB2A 3R0VA 1SXJB 1VXRA 4IZOA 5H16A 5IBPA 3LOQA 4DY6A 2NTJA 3KPYA 4MRNA 1KYWA 1SMKA 5AKGA 4KN9S 4RF4A 2HDWA 1P3Y1 2X2FA 1XDSA 5C8YF 4HB2A 3DE2X 1U90A 5KJEA 1EBFA 4L8YA 3ER9A 5HUHA 1QTNA 1IZ8A 2AI3A 1PFUA 3QLUC 4ITRC 4CM8B 5JROA 1L4LA 2HZBA 4D25A 1BYUA 1LTHR 1QBGA 2H1WA 2XQFA 1MRSA 3KPWA 3OTWA 4U7GA 5ITZB 5JJBA 2PZBA 3PYLA 1F4ZA 4B6GA 5K0BA 3OE6A 1WF3A 2JD2A 2C3UA 2QTRA 3AY3A 3CLUD 1XPOA 1MORA 2ZAGA 3TE7A 4E5SA 2O0KA 3A1CA 2QUHA 4LMRA 4BNIA 1VKRA 2EYUA 1Q0PA 4KXUA 4UVDA 4MV9A 2PPLA 1CZHA 4F6RA 3Q2IA 3KKEA 1RWPA 5KVQA 1S7CA 4E70A 4L0QA 4F3KA 1OXMA 2XB4A 4M7WA 1RJFA 3E2IA 4HVAA 3AVUA 3PB3A 4XKJA 2B20A 2QR5A 5IBRA 3BJZA 2EJWA 2ES4A 1WZUA 3IH5A 3PXUA 5LCXA 3UYLA 4ZGGA 3C6YA 1JFVA 1TUEA 1VGRA 3TQSA 3KZMA 4ZFNA 4CL2A 5JXWA 5TARA 2J3JA 4AZ3B 4N0DA 4Y98A 3TTVA 4MO2A 3EC1A 1Z5NA 1BXRB 3RSHA 4AT1A 4I4CA 3PNSA 4Y9SA 2ASVA 4ON9A 4FYKA 2Z6VA 3DOIA 2H9IA 1JFRA 1GT6A 2VUHB 5CIQA 5AHRA 1QCYA 1QYDA 1UCFA 3K9FC 4IDGA 3EAGA 4YRIA 2FSPA 1KFJB 2ABWA 3HCDA 1P1CA 2R2AA 4K81B 1Z4NA 4XUCA 4IIHA 5FV4A 3M5WA 3L92A 4FDTA 3W05A 4ME6A 3IDQA 5DGIA 1NVEA 1Q0QA 2C97A 1SHKA 3F47A 3TEMA 4OCZA 1W59A 2YDYA 3GLVA 3MT7A 4NBVA 1EU1A 3S4YA 2HMYB 5LU9A 5F1PA 3CX3A 2CNWA 4WBNB 2GK3A 2H2FA 4II7A 1A5AB 3FVVA 3UK6A 1EDOA 3ZS8A 1UUFA 5DN6D 4EARA 1VZ2A 3QOYA 4W1RA 4EI9A 4UW9A 2BF4A 3JCZA 1JILA 2EBUA 1O58A 2VHCA 1OFTA 1NX6A 4Q9HA 2ADMA 1NA5A 2G8NA 3D4NA 3R6WA 3K2BA 5EP1A 3GUCA 3RVLA 5F64A 3AVPA 4I8XA 3DPSA 3KQYA 2HU2A 1K9VF 2I33A 2PXHA 5TMEA 3ZBUA 1N2HA 3CJTA 4I5GA 4EG7A 3QVJA 4ADSG 1J5XA 2J59A 4YRGA 4AKIA 4M9QA 1N2JA 1EGHA 3E35A 5EE9A 3S2FA 3H6GA 4LAFA 5JT1A 4FFVA 4R84A 3SC2A 1VA5A 5BR7A 4HGPA 1Q0LA 1D4ZA 3ROGA 4URHA 1HTBA 1OC4A 3I1JA 1PR9A 4PQRA 4UHKA 3VTFA 4GP8B 2I4OA 4L3VA 4RNCA 1FMLA 3GLHA 1KEWA 4BNTA 3IXLA 3MWYW 3O90A 2NP6A 1EVZA 5EIAA 1T4MA 1E9CA 1XXHB 1Z06A 3HA7A 4ONEA 5TRTA 3ZTYA 1PUXA 2C82A 4YCLA 4R7TA 3P9YA 4QIDA 2AG8A 1NOKA 1TCBA 1UOOA 1V8PA 1Z7BA 1SUSA 2P79A 1Z5VA 2ZYVX 3FUVA 1IY9A 1IMJA 2NNLD 3H99A 2IXTA 4HYQA 4PYQA 4WHMA 5JPCA 2HCJB 2OILA 1V9SA 2F9MA 3D2CA 2JFUA 2YN4A 1YAJA 4GS5A 3ZZMA 4F06A 2EGUA 4B3MB 2PN1A 4CM3A 1OT5A 4RD6A 4FX2A 5A3QA 3C1TA 3R7LA 4H17A 5BXQC 3C5WP 4EBFA 1FA9A 1IPHA 1UJ6A 2HBYA 1KVTA 3NXSA 2CNDA 2HLDD 3L6EA 1RFGE 4F1WA 2ZUFA 2V9ZA 3DDLA 3M4NA 1B93A 1MC1A 2GVNA 2I7XA 3RSOA 3OCUA 3B1ZA 2QR2A 3HY6A 3MQ2A 4M1YA 2CNKA 3FCYA 1ORTA 1R37A 5E2IA 5JMPA 1YR8A 3LUAA 2ZQYA 1MPTA 1Q3TA 4QYIB 4KQXA 4Z9AA 3UJ7A 3IAXA 1USGA 3JQAB 3AQIA 3CYFA 4UNSA 4BEJA 1FJXA 4TV8A 4BPBA 1DQSA 1NJFA 2VG8A 4N8EA 4DCOA 1YQ9A 3LZ6A 4IVQA 3I39X 3HUTA 4LRXA 2CWWA 2WAOA 1KO5A 3QHPA 3LXXA 2QW0X 2F64A 2XTMA 1N1MA 3EIHA 4TT3D 5D8DA 4Q4CA 3CX7A 1XQXA 5AICA 1QRUA 1EFLA 4UPEA 5C8ZA 3UNXA 4U7WA 4FFNA 4KLRA 4MA4A 4ZZ3A 1G5HA 4QU5A 2AL7A 3K1AA 5ICGA 3K0AB 4J0JA 3LP6A 4LN1A 2GDJA 3RTDA 2JGEA 2Q6LA 2PLAA 4B6EA 4DDKA 1NE7A 4ZK6A 3ZS9A 1TN5A 1HG1A 1J5EB 2QV0A 1FF9A 4DVGA 4B82A 3BXHA 2FVYA 1P81A 1N75A 1U3CA 1XCOA 4KWIA 3EODA 5FP0A 5I9MA 4LC0A 4LFAB 4OY3A 3R3XA 1KMMA 3TXXA 4CQMD 1GTG1 1J00A 5BWMA 1ZXLA 2Q9AA 3F46A 3UPUA 3GPCA 1NLFA 4JJ4A 3NC4A 4P4LA 2D62A 5REQA 3OCVA 1MA0A 1OA1A 5GM2A 3P0EA 1W6UA 2EX4A 2G71A 3FCAA 1YNOA 3QVLA 4K9RA 3SYLA 2ZM6B 3INRA 3ASVA 3JQBA 5HBRA 4V3BA 1D7OA 3N6XA 1T0BA 3SR0A 1EUQA 1RC8A 3HNRA 1KDPA 1XDGA 1IN7A 2EI4A 3RIYA 1BW9B 4BPRA 3MS2A 1C4WA 4EHJA 4YCCA 3K09C 3EH5B 5JCZA 3RVJA 2H18A 4KIFA 3O9MA 4B6PA 5I7RA 5AZDA 4Q9DA 4JS0A 5FH9A 4D79A 4EP1A 1I2CA 3OF3A 4Q9NA 4KE7A 1Z28A 3D2BA 2ON6A 4YJHB 4CLHA 2EFGA 4JQCA 4QUGA 1WDLA 4AY3A 3JW8A 2E9SA 5LNK6 1TZ2A 3X3CA 2RKOA 1D2NA 2P11A 2HLDA 5DEIA 2XDWA 4LRUA 3KOYA 1T5HX 3UQZA 5IXSA 3MTDA 1A9TA 1XQ1A 5DNEA 1E20A 2BGLA 4L4RA 3TXYA 5D1NA 1BE6A 4R3NA 5C8YB 1P0PA 2QZ9A 1UXIA 2FK7A 4X00A 4G4IA 4QHSA 3O4JA 3RPEA 4BKPA 4GVPA 4JDPA 3D54D 3ZE0B 1P1FA 1A27A 4RS3A 5D85A 4MKHA 1I2DA 3DBHA 2PMCA 4B9AA 1TTTA 1PX2A 1VLMA 1IW9A 1JXQA 1S8NA 1T8PA 3F6YA 4S1NA 3OZBA 1JKJA 3HVHA 4GX2A 2IT1A 4WFQA 3DBIA 5L7YA 4ZAFA 3G5MA 1RXEA 3GGGA 2YZ7A 1ESMA 3KFXA 1I2ZA 1DAKA 5ILQA 1XRRA 4A16A 1XROA 1ZHHA 3N28A 1HTWA 3CH5A 1DWOA 3NQ41 1UT6A 1LKZA 1EEHA 3R9XB 1D1TA 1U8XX 3KTAA 2CLLB 1C0EA 3EULA 4MVJE 2Q2OA 5THXA 3D8UA 4R51A 4ZI7F 3NI2A 3SG0A 4IIVA 3F6PA 3ZHQA 4LXXA 1F0YA 2OMEA 3AC0A 1BQ3A 1R0LA 1VE5A 3F8WA 5ENDA 5FWXA 1P1RA 3VR4D 3MG9A 1J56A 3L4EA 4Y2RA 1E2LA 5LLDA 4X6UA 4B32A 2ZWOA 2I4TA 4AJNA 3EPHA 5AKJA 1LLDA 1OKKA 3FCXA 1U7HA 3GA7A 4IKPA 3W34A 5EHZA 1XKLA 1H9BA 4IHJB 3O21A 1F17A 2YC2C 4GFDA 2E2WA 3QJTB 3I32A 2ZSKA 1O9GA 5EZYA 2XJ9A 1QKIA 3AF2A 5EZYB 2R47A 4ZCQA 2PA3A 3NEAA 2QN7A 2JAHA 3E9MA 3Q2OA 3Q4GA 3T7SA 3GFOA 2GESA 3JY6A 1SVSA 4IY1A 4XWOA 1HR0B 2EW1A 3DUFA 1JXMA 5KYXA 1KYYA 3Q10A 4YV2A 4OHKA 4QAQA 3LSTA 4B9EA 4CM7A 2W70A 5DSXA 3SC4A 5LQJA 4WXPA 2F1OA 5G4KA 1LJUA 1RIFA 1MNQA 1TQHA 2PV0A 2QRHA 4GZ6A 1E12A 5DWVA 4ZTZB 4AI6A 5FBWB 3ZC3A 3RHTA 2VATA 2A58A 4JUAA 2YCXA 2XUZA 2JI9A 3SFTA 4P8RA 4HB3A 2X2EA 1PQWA 1NN5A 3RREA 1T2EA 5ALVA 1LB1B 1V8ZA 1EH5A 3DF7A 3UUFA 4ZN6A 4EIWA 1SG6A 1XNRB 3E9NA 1JHOA 2CUKA 1H66A 4RVDA 3ZR4B 4AS3A 2R5FA 2B1QA 4FQ8A 3RU2A 4F11A 2CXSA 4D98A 2K5UA 2NTVA 2XKJE 4DFDA 4RVFA 3PUJA 2ZUVA 3ACDA 1L8AA 1JKJB 1O9HA 1NSTA 3ZI0A 1KOLA 4DTCA 2V54A 1YIAA 3DAGA 3NHAA 3E15A 3IBGA 1CUZA 4BTLA 4GLBA 1OH8A 1JLKA 2C5EA 1TIPA 3HDQA 2CY0A 3KPJA 4TZ6A 2A7QA 3RU9A 3AKYA 1DKOA 4RC9A 1T6YA 3VSCA 3OLVA 3CLHA 2OLEA 1DCKA 3GJZA 4A4MA 4IZ6A 3HWSA 4Y1EA 5C8YA 1S2IA 3PNOA 4JBWA 4MKXA 3A2KA 1R0WA 1CZOA 2NSYA 4R5HA 5NLLA 5ED0A 1AM4D 1XWWA 2IEZA 2F67A 2CKMA 2D0OB 2YZKA 3QPDA 1J1IA 2AI2A 3A6ZA 4E1BA 1K4MA 3HYRA 4ABTA 1PJCA 2ODWA 3DAHA 3FNQA 4KAAA 4YJHA 1W1IA 4E31A 2LPMA 4Z49A 3R24A 4AQ7A 5JARA 1KJZA 3IV7A 1ZUNA 1CP2A 2JFYA 2FZ5A 4RD2A 2A30A 1M1NB 4RZ2A 3CONA 4GR5A 3T7CA 4ZVVA 2I6UA 5B58T 1D6NA 3K8ZA 3P9QA 2PKYX 1D1SA 4BEVA 3ZWVA 4C6RA 2GAIA 1VB3A 1BW9A 4MW9A 1ISJA 1XD2B 2M32A 3COVA 3I34X 3IALA 5BORA 1GGVA 5A5EA 3NMUF 2ZJFA 1HI9A 2BEKA 1C9DB 2DJ5A 5JD3A 1KAMA 2C61A 4TL8A 4EB6B 4HVLA 1YF3A 4NOLA 2HBRA 1U2TA 3QSYA 4HJRA 4EUNA 1CB7A 5REQB 3V4VB 4CIAA 1CZKA 1W34A 3DQPA 1H6AA 3LX8A 2DBZA 5DYIA 1J07A 3AEUB 2JLCA 1RJEA 1JHVA 1V4NA 3NM4A 2V6FA 4JA0A 1T5TA 2YJNA 1OHHA 2BL4A 3WLKX 3ZK7A 1KY2A 1V3VA 4MA5A 4K8OA 4TXHA 4A03A 1V43A 5A03A 5KB3A 2CLOB 2QN9A 4I7EA 4NK5A 2BUCA 4WFJA 1BVRA 3FCCA 4D46A 1KDOA 1CRZA 1UPTA 3FVQA 5D5HA 2QXYA 1ZIXA 3C7CB 1A8PA 1F8FA 2I99A 2QAIA 3UHPA 5JNTA 3RIGA 1M0SA 1NVWQ 4RTRA 1J97A 1SCIA 2UYOA 1FNCA 1MP0A 3GBPA 1WU8A 2ZSFA 1LBSA 1SVNA 1V7ZA 3KZNA 3NDPA 2XZOA 2VF2A 2M6SA 3E22B 5J5AA 3TUJC 1FSPA 3NH9A 4TV8B 5A05A 3V33A 4M0MA 3DZ8A 2UUCB 3VNQA 1WD7A 4QYIA 4H1WA 1NJGA 2LIPA 4W6ZA 3EEFA 2C3OA 5CCDA 4AUEA 4CG3A 1E96A 4WJLA 3KJFA 3TINA 3UATA 3BA6A 4IRXA 4NU5A 4HJXA 2QMZA 4EJ6A 4Z51A 1ZVVA 2NU8A 1ZD8A 1T3ZA 5HTKA 4UD2A 2F3UA 1FYFA 3N6VA 5DYSA 4RD3A 3K4HA 3RU3A 2OO5C 4XR4A 3UKDA 4FDLA 1Y8CA 4WXMA 2YBDA 3UM9A 3UT5B 1UT5A 2OCLA 1ZK0A 3R6GA 1II8A 1RI2A 4OHZA 1OR8A 1GD1O 4KQWA 4AIIA 2WPNA 5JZ9A 1UAAA 2HV8A 5DB4A 3FWHA 4BNWA 2CGEA 1NTRA 1X3LA 1EBUA 2L19A 4MDHA 4FNAA 4CKCA 3VUEA 2XKKA 4BZZA 4D9JA 1SBQA 2OG1A 2PGOA 4D8VA 4HYYA 2I7VA 3H1EA 4BMYA 4HYJA 1KMIY 1XXHA 4P58A 3LHKA 1JXAA 1QC5B 3AHJA 2YIJA 4MCHA 4ALJA 4JLSA 4WOBA 3SPXA 4K6KA 4G26A 4YYEA 1DX4A 2YXEA 3AUKA 4CGZA 3ZXYA 4TVKA 1J2JA 3B3GA 3FHJA 4N3CA 1TLTA 4DLXA 4YECA 4WKPA 4ER6A 3KAKA 5AM0A 2R7AA 3SC2B 4DILA 2FWJA 1WG8A 1U8YA 2ZJ1A 3A2LA 3HKBA 4C01A 3WY9A 3T1VA 3C5HA 3FWKA 1G59A 1E3TA 2EXXA 4KEAA 3U61B 2Y27A 3GGDA 2OZKA 2DH5A 3MCUA 2WDZA 4J2HA 1A04A 4DUYB 2BW0A 1K5DA 4Q05A 2QL5A 1KK2A 1R8QA 1PZGA 4MWTA 1GPYA 3U6KA 4E5MA 3VO2A 2VYVA 1J23A 3BK2A 3LFHA 3B7PA 3HH8A 4EKNB 5IKEA 2R8OA 2QN6A 4M2LA 4TS1A 4CEHB 1AHNA 4M1EA 4L57A 2J4DA 1XDUA 2VNHA 3VRHA 3CSUA 1QWOA 4I3HA 4QYMA 1XX6A 3ZOKA 1R2NA 1YFKA 2DT5A 2FU5C 1EM8A 4WASA 5AM2A 3HCWA 3SYMA 2PG3A 4JJ6A 4B7CA 3ED1A 4LOJA 4BLOA 3TQTA 1Q6ZA 1W49A 3DL2A 3I09A 2O2EA 4UEQA 4YUWA 1QDEA 2A5GA 1O77A 3DV2A 3Q0IA 2M6LA 1HDOA 1SQ6A 1EQUA 1XTVA 1A2KC 2BHTA 2XQKA 3V7FA 4JOBA 4KB5A 3QUTA 4TLDA 2V59A 1K66A 2B0JA 3AR7A 4PYMA 4QBHA 1T1EA 5IMSA 4E08A 1EP1B 5L51A 5HJEA 1HETA 1VSBA 5KJ6A 3LCRA 2GA8A 1JFFA 5JSQA 4H31A 4NNOA 3DZDA 1TO6A 4Y1RA 5TMDA 1JS1X 2X8WA 4G8JA 5KTMA 1XRPA 2YZGA 2BZ1A 1SCUA 3KYBA 4KXMA 4MS1A 4EJMA 4M99A 5HK9A 4MQBA 4HAYA 3VO9A 4B34A 5AVTA 3FETA 3D7KA 3T61A 3KK0A 5IABA 5K45A 3IYLW 4BQIA 3K2QA 1E0SA 3L7YA 3R7SA 3RUEA 3L7AA 3NIWA 1O95A 3NBKA 2UXCB 4MVCA 4AMUA 4JJFA 2HXYA 3W8RA 1EUCB 1U4NA 4DADA 2VSFA 4QJ5A 5AKEA 3VTAA 2CLKB 1U9CA 3AILA 4YRQA 4EHDA 1G8SA 5JDCA 4GI3A 5FFNA 1ABEA 5ALYA 1WCYA 2Q3HA 1P72A 2NAFA 4KWCA 2ZYRA 5B3AA 3GEBA 3RO7A 4JI0B 2EBFX 3FCUB 2FG5A 3DTVA 3U4QB 1O6BA 3Q8KA 1H1LA 1E2UA 3EUWA 3LW7A 3F8SA 1Q50A 4CFYA 1WKCA 2UZ4A 2ISSD 4GECA 2VHYA 4O3MA 3GRUA 2GAAA 2W48A 4PAMA 4UU7A 4HDKB 5AVZA 2HJ9A 2W6OA 4B74A 4ZI7A 5FUVA 4NU8X 1JKXA 2G5TA 2ZUCA 1H2ZA 4G7SB 2VTEA 3U44A 1A95A 4BNNA 4X1IA 3TB6A 2HSGA 1F14A 4IH9A 1XTKA 3EXHB 1SZJG 1VMDA 2C95A 3E4CA 3JU3A 4GZLA 4UVHA 5IDVA 2J5QA 2XNCA 2R86A 4B4KA 4EVRA 2HTFA 3PC7A 1ZNXA 1VPDA 3DOOA 3V6LA 1UJMA 2A5LA 4KGZA 4O4LB 1L4HA 1NAHA 2C98A 3CVJA 1Q2UA 3OM8A 4OKIA 2B34A 2FQXA 3LG2A 1IXKA 1R64A 3OLZA 2P4SA 3JVVA 2I2WA 3P2IA 4HAVA 4UUNA 3WGOA 4JT9A 4N6NA 2IJGX 3EA4A 2DFPA 1Y8ZA 4CFZA 3N8DA 3NHYA 1BXGB 1Q22A 2RC5A 1CDEA 1XI2A 4L5YA 4EY7A 2XUAA 1EEXB 221PA 4A0SA 3SLGA 4BQEA 5K8JB 2A0FA 1JAZA 3C6MA 4PIMA 2G70A 3EXIA 3UAWA 4LIPD 4XCVA 1L7MA 3DLTA 1UFQA 4QTUB 2G5PA 2P3OA 3QU9A 1C3EA 1K5PA 2JGIA 3X1WA 3VR3A 1FK8A 1GPAA 1E3EA 1F48A 4K5YA 1Z7WA 1EFUA 2ZVDA 5LB2A 4AK9A 4WERA 4JBGA 1Z63A 4IIYA 3AW9A 4FYPA 1UBLS 1N5OX 2IA5A 4NESA 1QHEA 3GZTB 1Q74A 5DM0A 1IJEA 5K20A 3OU6A 4C78A 2ZSAA 2H1IA 1FRQA 4WLOA 1XMEB 1BVYF 3OHSX 4LHEA 4RHTA 5DI3A 3VPAA 3IPCA 2B94A 4REMA 2AE2A 4YP1A 1N78A 1EWYA 2VJBA 1LI5A 5JEDA 3KR0A 3OP1A 2GZRA 4JLUA 1TKBA 2MHCA 4YRCA 5F8UA 1MDBA 4LVUA 4D45A 1VJRA 1DC6A 1T2VA 3WWYA 1PZFA 5AH0A 1NI3A 3ZHRA 4CM1A 4D26A 4I9FA 2VR1A 2HOQA 1SHJA 4HD8A 3VC1A 2FZLA 2CFSA 5I4BA 1VJ1A 5E1OA 1CPYA 3M1YA 3FSJX 4BTEA 5GZ1A 1AH2A 1VM6A 2X19A 3WDKA 3K0BA 1SD2A 2ID4A 1QH9A 1XAHA 2WYUA 3MUOA 1I14A 2Y1EA 3GHHA 3VR1A 4OH1A 4CKBB 4Q4DA 4ZI3A 1H69A 1JR3E 2Z8ZA 1PJ8A 3G5AA 2PWAA 3WRXC 2KWIA 5TPZA 1K89A 2V0NA 4IKOA 1L9XA 3DGFC 3OZEA 4GZ3A 3RADC 4ITUA 3HLTA 3Q0EA 4E13A 2EGHA 4OHXA 4BLSA 2XSZD 4TTTS 3Q0TA 3RHSA 4B0OA 4DWJA 4E4YA 4PLZA 1XVVA 2LKDA 1IUPA 4KFRA 4MKIA 1LLQA 3KE9A 3N0TA 3NPMA 1I5EA 4RSHA 5E1DA 4DRXA 2ZTVA 2BZGA 1WDWB 4HLQB 4F12A 2V5VA 3OJOA 3PHGA 4NBNA 4XDHA 4X84A 4W63A 2G9ZA 3KQMA 5LOVA 1G21B 3O31A 3INTA 2UYGA 2V7GA 1ULAA 2B98A 1T6XA 4ISBA 4M1KA 5ESDA 3T3PB 3FPKA 2CHUA 1TX4B 1FLNA 5LLSA 4CL8A 1OD6A 1QYRA 4X60A 5GY7A 3JAWB 1CV2A 1P80A 2ZRHA 1NI5A 4TWZA 4BVFA 1YVUA 1Q91A 4JYMA 4EQ6B 2C9CA 1LPOA 4RPHA 3QMWA 4B6RA 2FLWA 1SHLA 1SKYE 3JQPA 4LYAA 4R1UA 3ZWDA 2BZ0A 5CRIA 3W8EA 4ODIA 3X1MA 3O7MA 2O8CA 2IGTA 1TVKA 4YCJA 4RTJA 2EZ8A 5AUNB 4ZTUB 4AF8A 1OFVA 5C3UA 4FB5A 4LQCA 3UTVA 3O2JA 3GZNB 4N9QA 2HEIA 1B3BA 1BGVA 1JI0A 3MC1A 1X9GA 4TXNA 5AOVA 3RVBA 5CW2A 5KOYA 4OBBA 4BVKA 2CSUA 1NW9B 5CP8A 4GR4A 2NWQA 2ZI3A 4PF1A 5J47A 3GA0A 3GLIA 2QX6A 2VPWA 1KVQA 3PD0A 4YAJA 2G82A 5TQ2A 4C6TA 4CLDA 4R1QA 4IO0A 1G66A 5KQMA 2O23A 3ZQ6A 1ENOA 3QE4A 1SU7A 4CMKA 5E38A 4KXXA 5CDYA 4Q93A 2FPWA 4GEKA 2XBMA 2PX2A 2D06A 2FXVA 1W76A 4EECA 1E77A 1JBKA 5KJFA 3FWYA 2C04A 1KQFA 2XUPA 4CMHA 1XJIA 4D9FA 9LDTA 4JGIA 3G85A 4BV3A 4X24A 4U8HA 4X8MA 5LA6A 1Y3HA 5AI4A 1Y5MA 2BOVA 3UIEA 3WGZA 1XZHA 1YFJA 4HH0A 2DY1A 3AXSA 2W2TA 2I8CA 2X6TA 4QQFA 4I4TF 4DJFC 3GD5A 1Y4ZA 3M3PA 5EUCA 4P38A 1TKRA 5HZKA 4IRMA 2NU7A 4DIFA 4X92A 4DXDA 3TF5A 5KOHB 3TBFA 3ILSA 4DUZB 2HWUA 2KYRA 2JFQA 2R6FA 1Y3DE 2BMJA 3QVGA 4QTYA 3IUMA 3K70D 5BO5A 3WQRA 5HKKA 2DUMA 1U9IA 4KODA 1IBLB 2EFEB 3UENA 3LH5A 4AB1A 3DZKA 3BIWA 3SCZA 2Y76A 3WLOA 5AW1A 2H1FA 4IL5A 1F12A 2DBRA 3AFNA 3TLBA 5K05A 4OQPA 1G20A 3G5TA 5KWIA 3LBNA 1CERA 1PD1A 2BM8A 2Q5HA 2AKYA 4BLWA 5KPJA 4RFLA 4TN5A 2DERA 1LDGA 1EP9A 5H02A 2H8KA 4CMEA 4DVJA 2G83A 4UMFA 3OIDA 4ZAYA 2FEWB 2QMYA 2DFLA 3EA0A 2IYUA 4H3VA 1YS1X 3CG0A 4LF9B 2VPPA 2I03A 1JV6A 3DCIA 1EBBA 3IP1A 3VC7A 4BKUA 4JYAB 2O8BB 5ALNA 1CQIA 2J7PD 3BEDA 2L17A 1AZLA 3EASA 3TLCA 3R5SA 1E1CB 1JL3A 3D0OA 2ZROA 3MWGA 4PCLA 3RRZA 2W90A 3T0FA 4X32A 1ZYUA 3U1BA 5EFZA 2C7OA 3QBTA 3F4KA 4JFRA 4MIEA 4XIJA 3GCXA 5EJMA 3IEVA 3NIFB 2QAGA 3OCWA 1WNFA 4UM8B 3RLFA 1PZNA 3PENA 4NBWA 4PG7A 4ZDWA 1DLJA 3ZDBA 4BNDB 1VE3A 1AG9A 1RP1A 5JEEA 3JQFA 1YZTA 4RMIA 1OBHA 3PDHA 4MKGA 4U5QA 5DGTA 1TO2E 1B3RA 1LPMA 1NRIA 1SR8A 1EFAA 3PJRA 3UPTA 1XCLA 4WNCA 1P60A 2JIRA 4IYJA 3VYTB 3GD7A 1GITA 2GWRA 3TW0A 3CZ4A 1H9AA 2O8VA 2PXCA 3SD7A 4FFSA 1Z4PX 4NARA 2QT9A 2IPOA 5J4KA 1WU7A 2H1VA 3GWZA 1JYSA 2B1GA 4Q7KA 3RS7A 3DW3X 4YJ3B 1A5TA 2PX0A 2CZQA 4L74A 2HF7A 4NG5A 4B45A 3A7EA 4IH4A 1SAYA 2BGIA 2OXCA 3GNQA 3P2YA 3OUTA 2PFGA 4I55B 3FPJA 2WHQA 5ITVA 3AUSA 3A1UA 5DK4A 3TRDA 3B6JA 3PGJA 1X1SA 5LC1A 4AX8A 4N76A 2BT4A 1JSLA 1PQPA 3I73A 4FE3A 4INJA 4KQIA 1G60A 3DZGA 5FTMA 1QK4A 4IIFA 4QEKA 2CV2A 2ZTLA 3EISA 4DLYA 1CYEA 5JZOA 4AZTA 2X8BA 3TW8B 1HNZB 1J2RA 4L8GA 4Q39A 3LHIA 1DFHA 1N6PA 1KJQA 3NXKA 4EW2A 1QYWA 2R6DA 3KEMA 1NPYA 1MJFA 1JDBC 3UHFA 3HXTA 3WAKA 2DUUA 1ZH2A 2A1IA 3ADBA 1RRVA 1WUIS 3O4GA 1AJEA 3KKNA 1GAXA 1CUCA 2G4VA 2HDNB 4YRKA 1T15A 3QNUA 3FIUA 1E92A 5LKAA 3UTXA 3FE2A 2O2DA 4J1TA 4L4XA 3SZOA 1OH7A 3PNMA 2HRCA 1L4EA 2FFAA 1P5RA 4QVGA 1UL1X 1BDIA 3EOBI 1Z0IA 5L6MB 5IM4A 5DLYA 2O3JA 1VMAA 2PL1A 1EQ2A 3IPYA 4B4VA 1YTUA 3QTTA 4D8WA 2PGAA 2WJIA 4MMYB 5K2OA 1YRBA 3GXBA 2Z1MA 4XR9A 3V8MA 3AHGA 1Q17A 2CVPA 1D2MA 3M5DA 1R0CA 2O7RA 3L7OA 3BFXA 3D5QA 4IOLA 1OWOA 4LBWA 3VR5H 4BECA 3JPYA 2Z04A 1KA9H 4FGKA 4XB2A 2IVFA 2FF7A 2D1SA 2WTXA 4OHPA 3HYLA 3IS3A 2BRDA 2I34A 2VP4A 3LUHA 4HAIA 4V38A 3TKLA 2O8BA 3QVMA 5IS2A 4LXQA 1AKRA 3C41J 3A1DA 2YUTA 4GYKA 2PD6A 2IYOA 4DJEC 1CEYA 3K0HA 1LD3A 4COOA 3HDYA 1HWYA 1KKUA 2LBPA 1GG8A 2QUKA 4IWXA 1M8KA 3ZHZA 5IZCC 2FK8A 4JL6A 4FYWA 4DCNA 3EVAA 2Z57A 4Q4AA 3ICVA 1XRSB 1XZ8A 4PANA 4CMAA 4LJRA 1EP3B 3HCRA 3L1IA 5JXGA 4UUMA 3OAXA 3AF0A 1T8WA 1IBMB 3FTEA 2O5CA 1IY1A 4AKSA 3TW6A 3H1PA 4X7BA 2RHBA 1M34A 3AYNA 3PHJA 4YRTA 4CR8A 3N7UA 3DB1A 5IMBA 3AP2A 2D5LA 2PGIA 3ZQ4A 1LF0A 2FDXA 2ZJ3A 5DE3A 4A8HA 2QPAA 4IMIB 2NU7B 4L8FA 2EDAA 2YUIA 3I42A 4LSZA 4RD0A 4C3UA 3RF6A 3D5EA 2Z6UA 1Y7LA 2GXQA 2XOEA 1LW7A 2IOFA 5TT1A 4PZ0A 1U3FA 1YMUA 4FR5A 4MGHA 1BQEA 4UUPA 4J3NA 1E4OA 1ZESA 4PZLA 1BFUA 3DT9A 3P20A 4KDCA 5LA6B 1ZJ4A 2XMQA 4B83A 4BZPA 3DLHA 1TYEB 1FFWA 2V7XA 4AG6A 2FA9A 3GN2A 4J7UA 3HTXA 1Q1GA 2WU1A 2ZBPA 4YP9A 3CIOA 2EFCB 3ELWA 1TEVA 2EYQA 1OGIA 4QECA 4AWXA 3E48A 3OKFA 1RWXA 4J3JA 2WPDD 5KSOA 2B3DA 2FW6A 3BMOA 1SH7A 2QAGB 4YCDA 4XT1A 2NUTA 1YDWA 3URMA 2JLZA 3UUEA 3FPHA 1QLJA 4WX2B 4I19A 5ALGA 3K8YA 3ZNOA 3U3OA 1W96A 1FFXB 1E1CA 2Q7XA 3GLSA 4RADA 5DLDA 1VZ3A 4F3RA 2P2SA 4U2EA 4GSYA 4YT2A 1MJGA 5CDFE 1U31A 2GN1A 2X3FA 2WF5A 4Q1EA 5K0GA 3GFTA 4UVEA 5CX1A 2ZUSA 4CDMA 2ZXUA 2IUTA 4DCVA 2XTNA 3PPYA 1AGNA 3G2KA 4W7IA 2CLEB 1BRXA 2Y3IA 3O93A 4MVJA 3RVQA 4BCBA 5IRCD 5D6OA 3KQLA 4IBOA 3NOOA 1TUBB 5EI5A 1FPQA 1XTPA 3UBMA 5EGNA 2ZJZA 2AEEA 2X42A 1DS6A 1L7AA 3PHHA 5E9JA 5KDDA 1GSIA 1DAMA 2VRWA 3ZWPA 1OI2A 3JAWA 4FX5A 2FN4A 2C5HA 2LTAA 3BH7A 3LC7O 3F3YA 2ADFA 1GGKA 4M88A 4EELA 4DPMA 5CFRA 1DOZA 2VBFA 3R2JA 2YRXA 4K8RB 1VLHA 3G3EA 3RRJA 4OQFA 4RTLA 3EAFA 4RKRA 4B33A 1QANA 3CHYA 1EJ0A 2HX1A 3B52X 3GF4A 2B69A 4GX0A 3QUBA 5KOHA 4OA8A 1JA1A 5KVSA 1CUYA 2CHVA 5EE0A 1H68A 2W00A 3OPXA 2E4ZA 4H6WA 3M6AA 3H7IA 4RZHA 4KWTA 1NR5A 1ZZEA 1QP0A 4G5OA 5THQA 2H29A 5KSPA 3ZKAA 4EOGA 2DQKA 5B12A 2YV4A 2ZR0A 5HJ7A 1W4ZA 5AMXA 1E6WA 2WTMA 3A6HA 5K4GA 4OQDA 2GKGA 4IM7A 1F1BA 1UC8A 3WLRA 3HFJA 1AU9A 2OB2A 4OFZA 2IYRA 4FSHA 3PQDA 1IHDA 4RL4A 4DUGD 1NBAA 1W581 3RYIB 2WIFA 5BYJA 3U49A 4YMIA 3WGTA 4BOYA 2QU8A 4DIDA 2JLVA 4FW8A 1JDBB 1W5TA 2QMEA 3FYUA 4L50A 1P5FA 2G4LA 5K6AC 3NIBA 3VGAA 1OROA 1PLLA 2IPNA 3JRNA 4OYLA 1UKEA 5CA0A 1CYDA 3MAGA 2DTEA 5D3QA 5FOUA 3ZNPA 4CL3A 4ENQA 5GPBA 2WYIA 2I7CA 3GLIB 4DCMA 1UC4B 1SK9A 4XGQA 2C99A 2MSCB 2VH5R 3T35A 721PA 2GVDC 1K6IA 3LXMA 1E8MA 2GYUA 3WNVA 3DTYA 2QTCA 4UBMA 3I01A 4BAGA 3QI2A 3E1KA 4H3HB 5A4MS 2P27A 4N5IX 2OLJA 1TVKB 1FSGA 1PCXA 1P45A 3QJQB 1UMKA 4II3A 4TL9A 3U4MA 5IP5A 3OC6A 4QPDA 1DHRA 2GD0A 2PGXA 2H2HA 2IHUA 2NN3C 1JQKA 3A4YA 1WDMA 3MS4A 4RJKA 4CVNA 3IVGA 5A4AA 3CNOA 3UUWA 4RQBA 5JSHA 1CIJA 3H3FA 3OM0A 1IU9A 1R7RA 4DJ5X 3CXUA 3MTGA 4CM9A 3V2YA 2BCGY 2GF9A 4BGEA 1YTLA 4RANA 4LXYA 4AN0A 1TYAE 1RC0A 1ECFA 1IATA 2P75A 3JPWA 4MWOA 5IULC 3DAFA 3FNIA 3PDIB 2HDHA 3C3MA 4FYYA 4WLEA 1Z56C 4BFCA 5ECDA 1VL2A 3L0DA 1Y6FA 2QD2A 2PSFA 3AFIA 3DBLB 5LOVB 5DNYB 2Y4NA 2HSEA 4QGFA 4QBGB 5KEIA 4N5DA 1YR7A 1QGYA 1X0VA 2R5NA 3V4LA 4BMOB 3BH6A 4PHTA 4QELA 1E66A 4DRXB 3O47A 2JJ1D 1NYLA 3PNBA 4EY5A 1X1QA 4X66B 2UVPB 1TF5A 3DKRA 1PHPA 2WM2A 3AUJB 1MT3A 1ECLA 3GFVA 3JZDA 2IPXA 4XSHA 4HV4A 5JFTA 3ZLBA 5K4HA 2YCLA 3OKCA 4GLJA 1PW5A 2OC4A 2HCFA 5HS4A 1U0RA 5KNBH 3LT5A 4HRXA 2QLMA 1T29A 4LQDA 2FQYA 3GEGA 4B48A 4CKBA 1RWKA 5A6VA 4HGOA 2H1HA 5K8LA 4MI3A 4FC6A 2C4NA 4X6LA 1RD4A 2JW5A 3H16A 3SHOA 3EXHA 2PRYA 3V1MA 2IYSA 2DTXA 2DRIA 1JAYA 1I1QB 1ULUA 1U9ZA 1SBZA 1AXRA 4GAEA 1Z6XA 4JVNA 3N5CA 1F7UA 4ZAVA 2PO7A 2CUNA 4UNPA 3X2FA 4TZ0A 3GGOA 3KDPA 2P3QA 3D0RA 4HDKA 4RA9A 3F74A 1Z6AA 4J0KA 1ZJ6A 4YQYA 2CDAA 4KQCA 1FYXA 2GJSA 5BXYA 3TDNA 1ZGGA 2O7NA 3QLUA 4WCDA 4P93A 5H9WA 4US0R 1H1LB 3WGIA 2OZPA 1GGEA 2WAMA 2F3PA 4GC9A 4B4DA 5IU6A 3ZZUA 4MS4A 1U0OC 5JAIA 1AKWA 2J09A 3IV9A 1F8XA 4MULA 3LA8A 4W5NA 2ZGVA 1X14A 3JS5A 3GLGE 3H9EO 5T4EA 2CHEA 3VPXA 1E1QD 2X4GA 1DWQA 4NQZA 3TBHA 1GEEA 2X15A 2EFJA 3DWIA 4PZ9A 2P77A 4IDFA 2X4LA 3HU1A 5DMXA 3WADA 5M29A 2BSXA 5EQTA 1Z9BA 4Z4CA 2HIAA 4UEJA 1L8LA 3LKBA 5CNJA 4CU2A 2WB2A 2GTHA 2H0RA 3DLCA 4QOHA 3S8MA 3DNFA 4E2WA 3C98A 3HN7A 1ZMXA 3EXIB 1BKSB 5B6VA 3B3JA 2F1RA 4CBVA 2PT7A 3EIOA 3QVXA 3RV4A 1TAHA 3QYPA 3UTWA 4MS1B 1NFFA 1BXGA 4QO8A 2EWWA 4YJDA 1KI9A 2FYTA 3RASA 5DGCA 3SHFA 1RDFA 3VJKA 4JXZA 2ZR9A 1JE0A 1M7BA 2OGUA 2F55A 3DT8A 5TEVA 1JFFB 2WT9A 1EDDA 1OYYA 5F2NA 3E7PA 5I48A 2NSDA 1I10A 5IYZF 1H2AS 2Z2KA 2XGJA 3AJEA 1E1MA 1DKUA 4HC4A 2HJGA 2C4MA 1SCAA 2VCYA 3RT9A 5CVJA 4DR3B 1W7AA 3FYSA 3L7KA 1W35A 3IEKA 2QTVB 3Q3HA 2FPOA 5DO9A 2ZIUB 1MTZA 3NUZA 5KX5F 3A1NA 1JHMA 1Y5IA 1MEEA 1P7VA 2R1TB 3EZ6A 3JR7A 3B12A 3U44B 3Q5EA 4L8VA 3K0KA 4ZI7B 1QOQB 3NU1A 5KYYA 2JIPA 2CFTA 1ZP6A 1A2OA 1EM8B 4RMGA 5F73A 4MCAA 2BKXA 1H22A 3ZGLA 1NQ5A 2NXJA 3JWHA 3WGHA 2NO7A 5IAAA 4ZAXA 2DPMA 4R2LA 3UMRA 1GTL1 2BBSA 4MPDA 3FOWA 4PYJA 4F92B 4XWTA 3DTVB 3U4QA 2AB0A 1DBWA 1K08A 3KLOA 3G49A 4Z86A 4HLNA 1QZTA 4J2OA 5G1OA 5JJJA 2CLCX 2NUAB 1ZGCA 2OE2A 2ZP1A 1ZXBA 1GPBA 4ESHA 3PC8A 1AGRA 3CB4A 5JZMA 4A36A 5EZQA 4CQNA 4ZGBA 2ATXA 1KU0A 3A14A 3WK4A 1JKIA 2CMGA 2H31A 4HXGA 5JRZA 3MCVA 4B3SB 3EY4A 1TCAA 4KYUA 1MDFA 1XD8A 4DWVA 1U3TA 1Z5GA 3ADPA 2R60A 3SMQA 4HEA1 3HU5A 5A2GA 4LJAA 1P1JA 2HHLA 1UEJA 2WVGA 3LM8A 1JJ7A 2V3VA 5AWZA 4ZEVA 1EPUA 1GWNA 3U0VA 3D0KA 2ZBGA 1LC3A 3CT6A 5K3FB 4LRSB 5DBIA 4BO5A 1VYUA 4MYRA 4ZOLA 1WZNA 2JAQA 1IQ0A 5KDLA 5E6RB 1QYIA 1UKVY 1IVNA 4Z53A 4D0SA 4U02A 4CKEA 1ZC3A 3PGLA 3OP4A 4QHTA 1Z5UA 3VC2A 4IJKA 1P3JA 3HKEB 4WOCA 1OZFA 4Y6PA 1NW6A 4J2TA 2A9KA 4HDCA 3TQHA 4Q9KA 3LQYA 3P9SA 1RKQA 2AIRA 1CETA 2QGZA 1P61B 2AYYA 4LYJA 5DNUA 4KO3S 4NZOA 1II8B 2NSHA 3K3PA 4NC3A 1RAFA 2ACWA 2Q6VA 2GYVA 3UT5A 3K8OE 2WOJA 3T5DA 4OA5A 4CF4A 1HDRA 1ZH6A 2C8JA 2QZ4A 2AUMA 3AU9A 2J5RA 2D0PB 2IDKA 3VR6D 2F3RA 1AIPA 5KMGA 1PFVA 2D1QA 3PR3A 3EN0A 5G2CA 3QEOA 2GCNA 2NU8B 4XWWA 4G56A 4ZV4A 4E2YA 4IAQA 2OO3A 4KMSA 1IYZA 4DCTA 1G5RA 3MCWA 2I1VB 3MRSA 4U3JB 4B0PA 5LXTB 1WY5A 5E0KB 4Z6KA 5H3HA 5LZ9A 1L7XA 3KPVA 3LGXA 2CV1A 3DOFA 3RVKA 4NCNA 4JOQA 3AY6A 1JMVA 4NZYA 2YFYA 2I21A 4CEHA 1BYIA 2ICAA 1H5UA 4K9SA 4BUOA 3UC9A 3IA2A 1YRWA 2XVYA 5ALPA 4PIPA 3NKLA 5B5SA 4HNSA 3U3ZA 1E6EA 3KSDO 4WWHA 1O0SA 1TVCA 2OVFA 3WYFA 2WG1A 2Q1TA 4RZIA 4R69A 4B3TB 4JYPA 1EUYA 1SQFA 3H5VA 3VH3A 4ZO4A 4J49A 3W3AH 1POXA 2ONYA 5K8UA 2BGTA 2O07A 2VK2A 2P9BA 2WTEA 3ETHA 1SELA 4GKJB 2YHIA 4B46A 4CV2A 1ISPA 1CQXA 1OYVA 2PS0A 2RGDA 3H2SA 3HV0A 4FDVA 4HZUB 1QC5A 4ECEA 1F50A 3CODA 4ZYZA 4YONB 1NJ5A 2VAPA 1C8BA 5KREA 2QORA 4EB6A 4IX1A 2P9YA 2H0AA 4CKCB 3IUYA 2G88A 3HVKA 1RE0A 1ZS9A 2CK3D 1VCMA 3PKJA 1P9LA 4G2TA 1H8HA 5EESA 1RRPA 3K1TA 4PVCA 4WDRA 2W5UA 1W1UA 1MAVA 1QRSA 1ETHA 2DXIA 3VU0A 1M66A 2GEFA 3N2NA 1GIAA 4KRFA 2VP3A 2YFHA 3NY8A 1I4EB 1M1NA 1TOAA 1TZCA 5HUJA 2EQ5A 2X76A 4B09A 1ZUNB 2WF6A 3PQ3A 2GD2A 5BV1A 3T4PA 4IJWA 2PK3A 1Y1QA 5DW3A 4YH1A 4F2PA 4YC7A 4C5BA 1MZPA 3KSRA 4CIBA 4DPKA 4QXOA 4XGKA 4CEIB 1CULC 2ZRGA 3L49A 3N58A 5BRJA 1NN0A 1PR0A 3I28A 1N7JA 2X5JO 2P5YA 4XJVA 3F71A 1TRHA 3E22A 4KNFA 2BMAA 2V7UA 1MXFA 2NOAA 1PN3A 3SBOA 3W5BA 2BGNA 1S1MA 2MSEB 3RR2A 1S2DA 5IVIA 3F6CA 2CMKA 3H84A 3S68A 3JYNA 4FFBB 2BSQA 5FOSA 1JKMA 4YBRA 1EWTA 5CB0A 2QDKA 5F7OA 4MXDA 1GADO 5IAEA 2CEAA 4CKWB 2JFNA 2WF9A 4LJLA 4KR6A 4R6WA 3EWSA 4TRRA 2VNKA 5EJ4A 5HOEA 5FAXA 2P7IA 5FNVF 3R3SA 4MQTA 3GMTA 4KJZA 3PHLA 4J4QA 1G8HA 1DDIA 4PHFA 3THOA 3S2UA 5DCYA 1Z37A 1FDWA 3H6KA 3JWGA 1VYHA 2VSXA 3KJXA 2QQFA 3HEAA 1EFDN 2CXPA 1U1FA 3HARA 3QKWA 4TN1A 3TGPA 1OZAA 4N54A 5F3DA 3TQRA 2A1TS 1SXQA 3CLTD 1H3FA 4NE7A 1J4AA 3BDIA 1K8ZB 1UOPA 3BWBA 1PFGA 2V6IA 4OP3A 4EYGA 4F45A 4OO3A 2XKBA 4FGSA 3VHXB 5IEBA 2QM0A 3SICE 2GXAA 4FOLA 1XKTA 2O0MA 4YRSA 2A67A 2WILA 3D6NB 2FMIA 4F38A 3OETA 3T1TA 3K5PA 3LCVB 3QWIA 4HGRA 1C1YA 4H4EA 1XD2A 4JD5A 2WWYA 3EH3B 4IV5A 4DARA 1IONA 5J2TB 4AIRA 3TDMA 3ICQB 2QP3A 3W9YA 1PUIA 2OMKA 1CF9A 2IPAB 2R2GA 1JPJA 2D2VA 3ETJA 1SOUA 3IAUA 4IHQA 1EWKA 5IUKC 2ATVA 3A8TA 1SD5A 2HA2A 3AI3A 3D3NA 4M8LA 5FHRA 4DSOA 3TSOA 1S02A 1GVHA 2V6MA 3FHCB 3RC3A 1JZTA 2DUWA 3E18A 5F2KA 4A2WA 2FG7C 1DINA 3SVLA 3ZLJA 3DMYA 5JVDB 1PEKE 1K0FA 4WADA 3HDGA 3T7DA 5A45A 1M0WA 2EJBA 3KQVA 4X71A 1AQNA 2E4YA 4M89A 1PNTA 1X8XA 1A4UA 1CDZA 4EPRA 2B61A 4IHJA 3KJHA 2W6PA 2XWSA 1HLPA 3HL0A 2I22A 3CRZA 3AIIA 4XTCS 1N3LA 3KCNA 3PV0A 5DBGA 2AS0A 3Q11A 2C7VA 4J0HA 2PWPA 4DA6A 1U8UA 5EINA 1B6TA 4S24A 1ZM7A 5JISA 3IE1A 3NDJA 1G6KA 2QYHA 2RGWA 3OAAA 3OTIA 4ZRNA 3C3CA 3NVMB 1QMPA 1GN8A 4HGQA 2IBMA 4F2HA 4PAOA 3KTAB 3R9XA 5HZHA 3ZHBA 2BFOA 3WL4A 1L5NA 5IYZB 3B5IA 1HZJA 2DQ4A 1RXVA 1QV7A 4YHHB 3A6FA 1ZMOA 2XA2A 4ZD6A 4QC2A 1KRWA 3L1VA 1E7RA 4K26A 5DTMA 1AUQA 1PFKA 4QTTB 1AA6A 2PS1A 1EWQA 4IDDA 2XCTB 3DL4A 3M49A 4S3MA 4YEDA 4BB0A 4CUZA 4OFBA 5IYZA 1VKHA 2BISA 4BMDA 3UHJA 4MQ5A 2YFKA 4HDRB 2P30A 4POAA 1SIUA 1SQSA 1PTJA 3BT7A 1EHYA 3DBHB 3W5VA 3HACA 1SB8A 4WK2B 3T7TA 2YNMC 2UUPA 4GMKA 4B7ZA 4GC5A 3P96A 1JJFA 3PDJA 1MJHA 2Q07A 3DPIA 3SR3A 4WFIA 4E11A 1W29A 1PJ3A 4IMJB 2EBHX 3HRHA 2QQEA 3FLMA 5LB4A 4GZMA 1V71A 4EY3A 3FCEA 2IUFA 1R9NA 3VKUA 3OE4A 1YZGA 1E6LA 1UP4A 3DUFB 2WDPA 5KYXB 2WQ7A 2B0CA 3LC2O 3QBGA 4R16A 3S0JA 2L18A 1AD2A 1NNI1 1QHYA 3SQWA 1YL5A 1V3QE 5JVDA 1V41E 3T5GA 5KQGA 1BKDR 5DRYA 2JBWA 3Q3CA 3T1YB 3CF0A 9MHTA 5BQ3A 4NL4H 3KWJA 1RAEA 3SOPA 4EX7A 4RKWA 4K9PA 2Z55A 3RKUA 4R6XA 5HCUA 5JPIA 1E7SA 1WP9A 1NUSA 1RBYA 2R4UA 4KNVA 1E89A 3E23A 2JGJA 4ARUA 1PNRA 1VHQA 4KI7A 3KQOA 1ZD3A 3AR4A 2UUBB 4L35A 2YWJA 5CTJA 2G6BA 3UB3A 2GD1O 5FV7A 1KOGA 1ATIA 1HLFA 2LCIA 2FFQA 2HTEA 2OQRA 3QVKA 3RNOA 1NQAO 4NENB 2EKPA 4LY6A 2BHSA 3IBFA 1X7ZB 2O3TA 5A06A 3VHXA 3WOHA 3GAFA 3U7RA 2ZPUA 2V4MA 3FNRA 4FWBA 1EI9A 1GTMA 2B83A 3LHDA 1JMKC 3GT4A 5IPFA 1IVSA 3DULA 4KJXA 7MDHA 4EY8A 3D81A 3EWIA 3ZY6A 2FVXA 3JYLA 4M9XA 5LQSA 2Q41A 1HL3A 2JRCA 3H86A 5IN5A 3LPLA 1U3UA 2H52A 2NYUA 2W43A 4S0ZA 3V1NA 1W36C 4B8YA 4HSGA 1R6AA 4UXHA 1C1HA 1YRYE 2QX9A 2R85A 5EPOA 5D86A 3ENWA 2HF2A 2W2NA 3HBNA 1MOZA 4HBZA 2IYVA 3CEPB 5IH3A 3K0AA 2AQ8A 2VDNB 5LBUA 3K1AB 1PGOA 2FPXA 2HJRA 1B2RA 1DAGA 2CXOA 1L7VC 1P8AA 3IE0A 3WQHA 1X8KA 4KH0A 1ZPDA 2HSWA 2JLSA 3D59A 3NM6B 4CKWA 5KNDH 5AESA 1A1VA 1XDZA 3ZIUA 3LNTA 3OTHA 6NULA 2DGDA 2VK4A <