5TGZA

Crystal structure of the human cannabinoid receptor cb1
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
439
structure length
439
Chain Sequence
b'GGRGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLAAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDKTYLMFWIGVVSVLLLFIVYAYMYILWKAHSHAVAKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSWEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAIPDQARMDIELAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cannabinoid receptor 1,Flavodoxin,Cannabinoid receptor 1
publication title Crystal Structure of the Human Cannabinoid Receptor CB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 167
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 5tgzA01
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5tgzA02
1H66A 2Q62A 3JSXA 2MT9A 4BVNA 2RG1A 4UHRA 1JA1A 5G28A 4K5YA 3COCA 1SG0A 2BMVA 4GYCA 2R96A 2YCYA 4M0CA 1R2NA 3UONA 3PXOA 1FBBA 1FBKA 2Y00A 2EI4A 1Q5JA 1T0IA 1KG9A 1KBQA 4H2DA 2LNLA 1KMEA 4YAOA 4FGLA 3NY9A 2L6XA 5BR2A 4XTOA 2I20A 4YAUA 1KBOA 4ZVNA 3NFRA 3HAOA 3PBLA 3GFSA 3L9WA 2G87A 1X0I1 3QDCA 4L6RA 4DKLA 2FOXA 4MQSA 2Z73A 1WSBA 5ULLA 4ESEA 1AT9A 5H2HA 4LTDA 2HNAA 2YDVA 1GUEA 5G36A 3ABWA 4LDEA 5FUQA 2OHHA 4X32A 3K20A 2B3DA 1FX1A 1YOBA 2HNBA 5FJGA 1IW9A 3ODUA 4CETA 3OVMA 5J7AA 1EHKB 3N3BC 5F4BA 1JV7A 3MBVA 1CZKA 4G70B 5LVAA 3VI0A 2R4SA 2ZKIA 5AX1A 2FAXA 2QMZA 3UTWA 4FGKA 5BR5A 5LBUA 2N1MA 1S8JA 1C3WA 5DHGA 4NC3A 3P0RA 3FNIA 2Z9DA 1BRRA 5A45A 2W5UA 4G71B 3OWHA 3TEMA 4BV0A 2M6RA 1MGYA 1UCQA 4H6PA 4X31A 4XTLA 1AP9A 2BF4A 1I1OA 2QR2A 4JR8A 3F6RA 1L9HA 5H2KA 3UTVA 3VVKA 3HA2A 2JAGA 1P8UA 2Q9UA 1FUEA 2NTUA 3FVWA 4EA3A 4G72B 3PDSA 2I21A 1E5DA 2M6SA 3NHJA 5G54A 2YCXA 1S53A 3ZPQA 4PTZA 1M0KA 4N4WA 3VW7A 1XMEB 5G53A 3NS0A 1OBVA 1XI2A 1XYYA 3ESXA 2GSWA 3EH4B 3OE6A 4QOFA 3B6KA 3QBKA 3RPEA 4GP5B 3S8GB 3LCMA 4MD2A 3AYMA 1U19A 4BUOA 6NULA 3G5MA 4LTNA 3C9MA 4C0XA 4BWBA 3W77A 5A8EA 2KSAA 1S54A 1J9EA 4OXXA 1X77A 3FX2A 4N65A 4N6HA 1JGJA 2HPVA 3TZBA 5H2OA 1TN5A 2QWXA 3HAPA 3C9LA 4FPDA 3UXEA 2BZSA 5LJLA 5B6YA 4FAAB 3PQRA 1L0MA 2J4YA 3F6SA 3F90A 1RLJA 3QFCA 1X0SA 1YCHA 4GI5A 4LDLA 3PWHA 4XT1A 2MWMA 1C7EA 4UG2A 1FVXA 2VT4A 4OV0A 4YAFA 3QAPA 3W78A 1DXOA 3OX1A 3QFRA 1B1CA 1J9ZA 1TN0A 2F95A 3CODA 4QRYA 2V5VA 3B6IA 4CF6A 3NHWA 4QIDA 3AYNA 3OE8A 4EJ4A 4XDHA 1J8QA 1GU8A 3HASA 4U7GA 1AMOA 1QHJA 2AT9A 1XYVA 5JJNA 4HS4A 1TLLA 4A4MA 4HYXA 1C8RA 1AKTA 3U7IA 5ITEA 4EIYA 1QBGA 4G7RB 1X0K1 3B6MA 5ITCA 1FLDA 3S3DB 4J8PA 1ZX1A 5F8UA 2FZ5A 4AMIA 4QODA 1BRXA 4NLLA 2OYSA 1BM1A 4DIKA 4KNFA 2M3GA 4QOIA 1BVYF 4N4YB 4MQTA 3S8FB 4QI1A 4R81A 2A5LA 1AKRA 4GR9A 5EAIA 5G2AA 4DAJA 2I1XA 3NHSA 5AHZA 1CZRA 4FBZA 3QBLA 3O2NA 1PXSA 3EDOA 4YQEA 3NHPA 3QAKA 4HYJA 4PXKA 3S3BB 1V4BA 5A4KA 5B6XA 5FX2A 3RZEA 4QOEA 4U7FA 3VG9A 3BVDB 1AKUA 1TIKA 2R4RA 1IXFA 3DQBA 3UTYA 3ZPRA 1PXRA 5JJEA 1ZWLA 2Y01A 3REYA 4QOHA 1QM8A 4J4QA 5TGZA 4ZVKA 4GP8B 4HWLA 5AX0A 5H2IA 1XT6A 3QJVB 4GPOA 3UTXA 1RCFA 1C8SA 1DZEA 3K1YA 3EH5B 3QJUB 4C0WA 4JKVA 3NHKA 1D04A 4QOJA 3OJWA 2ZIYA 4GQIA 4LDOA 3OX3A 5DYSA 1VMEA 3QBIA 2YDOA 2Y04A 5FA6A 3X3BA 5B2NA 1QKOA 3NYAA 1DXQA 3RFMA 3QBGA 1VJMA 1HZXA 3ES9A 4N82A 1S52A 2QX9A 2MTBA 4ICIA 4L35A 2ZFEA 4F8YA 5H2JA 1SQSA 2FDXA 5B6ZA 1YRHA 3L9XA 5EMNA 4C76A 5B6VA 3GFQA 5LWEA 2QPEB 4KLYA 3P0GA 4ZVLA 2V9CA 4PU0A 4Y9RA 3KLBA 1RLIA 1C7FA 5AZDA 5H2MA 5C1MA 3OWXA 2X72A 3ZHOA 4DY4A 3B6JA 1OBOA 4FA7B 2WC1A 3ESZA 1RTTA 1FLAA 1M0LA 1F4ZA 2JAFA 2NTWA 1AKWA 1P8HA 2PEDA 3N39C 5NLLA 4LA4A 4IB4A 2BPOA 3KAPA 3NHRA 3ESYA 1JV6A 2X2OA 5F51A 2F93A 4G7SB 1AG9A 1FLVA 1VGOA 3NSBA 1ZWKA 4BMPB 3UZAA 3FJOA 1F88A 1PY6A 3HANA 3TE7A 4MD1A 2QX6A 3OX2A 3UG9A 2KS9A 3QJSB 3A7KA 5B34A 5G2CA 1FTGA 3DDLA 1AKVA 1NNI1 4S24A 1H68A 3D4SA 5LBTA 4LTMA 3N3AC 1S8LA 5AWZA 1R84A 2R97A 4D02A 3LT5A 4PXFA 2X2PA 3NLLA 5H2NA 4MBSA 1BRDA 1XIOA 3KJ6A 5G2DA 3KEGA 1E0PA 3GFRA 3EMLA 1QRDA 1QKPA 3NHYA 3EH3B 5LLDA 1YDGA 2KQUA 1CZOA 2BRDA 3U7RA 1H69A 4Y9HA 4GBRA 4XTNA 2XODA 1M0MA 2Y03A 1YCFA 4NULA 2Z9CA 5B0WA 1P8IA 2QMYA 3FW1A 5LMCA 1KG8A 4WAVA 1AKQA 1IW6A 5EN0A 1JA0A 5JROA 2WJKA 1GG5A 2Z98A 4Y7CA 3T45A 3KAQA 3V2WA 2Y02A 4ZVMA 4WW3A 2ARKA 3SN6R 1AZLA 3OE9A 1BU5A 1DX9A 4DILA 1CZNA 4LAFA 2FVXA 3HARA 2FX2A 3ZEVA 4N9QA 1O0AA 4GP4B 4AMJA 5H2LA 2KLBA 2YCWA 4C14A 2ZZLA 2MOKA 1GZMA 1AHNA 3VHZA 1CWQA 4XT3A 5A44A 3S3CB 2OHIA 3W79A 1FLNA 1OFVA 1UAZA 2FCRA 5AHYA 5EA2A 1JFPA 3O73A 5B6WA 4IAQA 2YCZA 3VGAA 4GRVA 3SVLA 3AM6A 3X3CA 2QX4A 2OHJA 2FLVA 3F2VA 3HLYA 4PTYA 3W7AA 1S51A 3WQJA 2QX8A 3UZCA 2KSBA 5JJJA 1WSWA 3QE2A 3UXHA 2HPYA 5KKHA 4X1HA 3HAQA 4DJHA 4FGJA 2F1OA 1J9GA 1YCGA 2XOEA 4Y9UA 1KGBA 3R6WA 5BUCA 1QR2A 4YAWA 3OE0A 4G7QB 5F12A 2BN4A 1CZHA 2AMJA 2Z9BA 5ETZA 1XJIA 3OJXA 3GAMA 4TL3A 1T5BA 2Z55A 3D7NA 2WJLA 1CZLA 5LJIA 3NHFA 4FX2A 1Q5IA 3QJQB 1H2SA 5NULA 1D4AA 3V2YA 3QJRB 2FZVA 1D03A 3QJTB 5B3LA 2KSYA 1YKGA 3EYWA 3NY8A 3CAPA 4U7HA 3OAXA 3HR4A 4BEYA 2I35A 5B35A 5DHHA 2QPDB 5B3KA 1F50A 1CZUA 3S2YA 1LN6A 2RH1A 4XXJA 4HEQA 4QOGA 4BEZA 2D5IA 4IARA 4BMOB 4JQ6A 3NHLA 2V5UA 3NHUA 4YALA 1F4PA 5H2PA 1E12A 1QHEA 4XDGA
chains in the Genus database with same CATH superfamily
2B78A 3SZRA 2J0EA 3AP2A 5KOJB 4BVNA 1E96A 1HRKA 4MLPA 1P8AA 3T3OA 2VHCA 4GYCA 4Q4HA 2VJDA 1EGHA 4OSPA 4P7KA 2Z0MA 3TQIA 5LL6P 1LF5A 5DTRA 4URXR 1ZESA 3PQDA 2EI4A 1V35A 3CNOA 4D9EA 1GZ5A 3AM3A 1YVDA 4OQMA 4PLWA 4K7JA 2JRLA 5J58A 4MH0R 5D1NA 4G8DA 4ZEXA 4QYWA 4WLNA 3ZV6A 3UA3A 4EUFA 5I7VA 3NALA 2IXGA 2V59A 4ARAA 3HB0A 3NY9A 4ZYVA 4G65A 4PLZA 3NIFB 1VHJA 3A9TA 4CR7A 3GBPA 4IEIA 3SY8A 2VDJA 3TSYA 2YN4A 1HH4A 4HMPA 4CQNA 1QFYA 3K9FC 2AXQA 3HZRA 1WF6A 3LFTA 3E23A 1FFBA 3HAOA 2XVZA 4IQ4A 4RVSA 2PO5A 1KO5A 4EGCB 3U16A 4L6RA 3O8DA 4JLJA 4LVUA 1C4WA 4JC8A 2HSGA 2OPBA 3OT1A 5DLEA 1K5GA 1VIYA 2FRDA 5FF9A 4W63A 1F2UB 2GLXA 4D4IA 1UM9A 3KYJB 3TXAA 4G5QA 3EXFA 1NF9A 1P2BA 3OKPA 1GKKA 1QK5A 4YP7A 3F4KA 2WUGA 5ESXA 3I30X 1JNXX 5IYZB 3L6UA 1V45E 3TLCA 4MKHA 1O6BA 4LNHA 2O0HA 4HDQB 5JSHA 3HP4A 3H2IA 2W37A 2WJ6A 4RVNA 4YRRA 5CGQB 5FR2A 1TMOA 5UKDA 1R0XA 1FDWA 1TJ4A 2WAYA 4GMXA 1EHKB 2ZITA 4P3PA 3MBVA 1GOTA 1KAQA 2CKDA 2WTAA 3JPYA 2Q6OA 1NV9A 1E3EA 1K86A 4IR7A 2BR5A 1QGOA 4FQ7A 5JC1A 1TMYA 3BGVA 3TNLA 1TZKA 5HK9A 4GPTA 3AGPA 4BQFA 2EHJA 5KREA 3RUPA 5L6MB 4ITRC 3GHYA 4MEBA 1G5RA 5JCPA 3ECSA 4DMKA 2FF5A 2HH9A 1RYNA 4ER3A 2DFPA 4WEQA 3GJ8A 1JALA 4C3OB 3U4HA 1FP6A 1MV5A 3HYSA 1KI7A 1G64A 1RQRA 5C1IA 3SSMA 2GCPA 2QU8A 3A9UA 1RPTA 1YHZA 5E6UA 1RMTA 4PAWA 1Z7GA 2XXJA 1KO7A 4FPXA 5BQFA 1YJAA 3D4NA 1V8OA 3QV2A 4XTLA 1GPKA 2J4FA 3GJ0A 2PWZA 4HDRA 4MI3A 4CCAA 5C8DA 2QR2A 3AG5A 2OAQ1 2RGBA 2NV6A 4AD8A 1GGEA 1G18A 1YR8A 5TMPA 5TXGA 1PE0A 4OHZA 1MVLA 4E3ZA 5FTWA 4EUHA 3OM8A 1ODTC 1KFKB 3AONB 1CUIA 2JKYA 3T1OA 3U3MA 1N5KA 1TX4B 5G54A 1X70A 3EBOA 2Z08A 3JYHA 1GUZA 3KSDO 1Y1KE 2GK7A 2WUDA 3TZHA 4O0MA 1LNZA 3U13A 3QNWA 3RAEC 3E1GA 1IATA 2QTVA 2XQGA 3VW7A 4GOMD 5G53A 1T4CA 2CMFA 1XYYA 5DI9A 1N5RA 1Y9ZA 3UVEA 4UQLA 3GXBA 4Q9LA 4I81A 1Z12A 3Q7EA 3ZTTA 3DPIA 4QOFA 4JI8B 1WHTA 2ZJ4A 3IBFA 3MOIA 3MSCA 3JYPA 2E4ZA 2F9MA 2FU5C 4V0MA 4KX5A 1WTAA 5A4IS 4PPFA 1VCMA 1ZI8A 3SQNA 4IO0A 3R3XA 3BD9A 3FNEA 3ZWAA 4IP0A 4BQPA 2P7HA 1W36C 4UPVA 2IBMA 1G21B 3TUZC 2P79A 2ZJYA 1SK8A 3N7UA 1F6DA 4CLHA 2ZIZA 1C8VB 1E58A 3CZCA 3QUBA 4JKOA 4MVCA 2A5YB 4W9NA 1ORRA 1ORWA 1N2EA 1Z4MA 2GWHA 5JSKA 4L5JA 2WB2A 5BN3A 4DHWA 3ZDAA 1GTG1 3V4FA 3HAPA 2C2KA 3C9LA 2C9BA 2HK9A 1VE1A 4ILEA 2GJSA 3F9CA 2HWXA 3PXAA 4FPDA 5BWLA 1QDUA 5KWEA 3FVQA 4BFVA 4CKXA 2BSAA 4WZBB 4FDAA 1PUIA 4FAAB 3WOVA 1T0PA 4ECAA 4F2HA 2J4YA 1DO8A 4IJ5A 2PUGA 1H0KA 5JJKA 2DTEA 3GVXA 5EXEA 2JB9A 4B4DA 5AVYA 3I4FA 4OV6B 2GERA 2YWFA 3CQ9A 3ORFA 3U37A 5IZCC 1JPVA 4YB8A 4B09A 5A3QA 4B4WA 3KYDB 3ZS9A 1NBMA 2GPNA 2QTZA 1KQNA 1FSGA 5DHUA 3W7BA 1SXJA 1E3MA 4Z99A 2BFAA 1ISIA 1MPXA 2M1XA 4EUSA 3MWFA 4LC0A 4LVNA 4OYYA 2NU7B 1RZVA 2VPTA 1E8MA 3VC2A 3ZHSA 3QNUA 1Z6YA 3L01A 4RF3A 5AK3A 1QHGA 2D13A 3AEUB 3SSAA 3ZNPA 3O8OB 4DQKA 3COSA 1QJ4A 5I9NA 1DFIA 3I23A 3L7IA 1O6GA 1NQAO 4PX9A 1TRKA 3AUTA 4BPBA 1U6JA 4Y1EA 5F2NA 1CT9A 1GV1A 3LYHA 4PE5B 2HMAA 4QXRA 5E7IA 3FBTA 3PC6A 4UVDA 5FWYB 3WYDA 2LKCA 3H2BA 1VLLA 4F06A 4FMCB 3RHSA 1USUA 1KJ8A 1GQRA 3H9EO 3WADA 3NP9A 4JIMA 3VPHA 3EDQA 1AKTA 1DL5A 2REQB 2VUSA 4E3WA 2PV7A 5LD2B 2UV8A 1ES9A 2X8JB 1Y6JA 1NPTO 2CLSA 2PWYA 4G7RB 2A33A 3LX4A 3UK7A 3TTUA 1QCDA 4IX1A 4ABTA 1XPOA 2D7DA 1FNNA 3VHQA 1GZ3A 3BSSA 4ZDIA 5HRCA 3B5JA 1A7JA 4OG2A 1LI5A 4WCFA 4KN5A 3TOXA 3VR4H 1TAQA 1SZDA 2OCAA 2FETA 4PS1A 4Z86A 3QVOA 3L8FA 4FFWA 3HB5X 1IZ7A 2BI8A 2PMCA 1QF9A 1A5AB 4CF4A 5IX8A 1WMSA 3O95A 3QKUA 4TTJA 4QO8A 1TJYA 4A92A 3TQCA 4MGEA 2VQDA 3UMCA 1ONOA 3QU4A 1B1AA 4K9SA 2OPHA 1GCUA 3C14C 4AO8A 1CSEE 4M89A 3IQXA 3WOHA 4ZYLA 2A9JA 4B6EA 4R71A 2JEZA 2AV6A 3JWHA 4KUEA 3ZZTA 4G0MA 4Z54A 1GT91 4US1R 1XWWA 1CUAA 1WPRA 2IVZA 3UH0A 4TKVA 5KSPA 2Z4SA 1Q5PA 3C3MA 4QYSA 4TV8B 3SEZA 1PXSA 5IVKA 1JN0A 1IVSA 4Z1OA 2FW9A 4IX9A 2E7ZA 5ECGC 4CGYA 4NU6A 3B1VA 4EHNA 5F7OA 2E1RA 1CEXA 5KTTA 2FH5B 5FDFA 1SUSA 1JT2A 1BMTA 1A1SA 3GH1A 3F4LA 3QVJA 3MJSA 3MWJA 1IHPA 4R2IA 3DL4A 1SXIA 5AJUA 1US8A 2V4UA 4RPGA 4YEDA 2NO7A 2RHCA 3H83A 1PGOA 1RRPA 1DLIA 3EDCA 4IIHA 2ZIWB 2ANBA 4PLVA 3U56A 4ZVKA 4DHEA 1PZXA 2QRLA 4DQXA 1J0DA 4HWLA 1U90A 3PJEA 2ZSEA 1FU7A 2X22A 2XWQA 4KAXA 3WGNA 3ZU3A 4ZOQI 1AXEA 1MEJA 1AUOA 2A0WA 1MA0A 4N5HX 1UP4A 2AC7A 2G63A 2XJ9A 1PNRA 3MMSA 3E9EA 4MYTA 2NG1A 2B61A 2W48A 1HI9A 4TXNA 3QPVA 3LDAA 5E38A 1WCV1 3H1FA 4AX4A 4BEBA 4XJTA 4ZOLA 4X1KB 1ODFA 1S2LA 1G5QA 1A8UA 1RWKA 2XDQB 3A3KA 3F7TA 1ZSYA 3BCRA 4UHBA 5EWMA 1P5RA 1IM2A 1D6JA 1U9IC 3DLTA 1T35A 1RBYA 1KA9H 4UTVA 1YHYA 4FFPA 4HNAA 3Q3VA 4X8MA 4WX2B 1RW4A 4HTFA 3LPLA 5CXSA 3GFQA 4PLCA 1E89A 2QUBA 2DVMA 1F48A 1OY1A 2KX7A 4KLYA 1UBKS 2IS6A 1OPXA 3UMSA 5CPBA 3EGDA 3V3KA 3GZNA 2F3RA 2XMQA 4UHKA 4FFRA 4UAJA 3HVIA 1I6LA 1V1JA 4D99A 1Z6XA 4Z7NB 2C2GA 3ZD6A 3LQ4A 1T2CA 4IRMA 3OWXA 4DY4A 4RVOA 2VDLB 3B6JA 3CURA 2O3SA 4NEQA 4ND1A 1NBOA 2OGTA 4E1AA 3EGCA 3JD3A 1PQPA 3ZY5A 3D3NA 2GZ2A 5LB2A 1S2GA 1D07A 3N39C 3D6TB 1ZOLA 5ALFA 5U4XA 2C97A 2B4QA 3ZE9A 2DPLA 1OVGA 5CFOA 5CEFA 1RHJA 1RJ9B 4IDCA 2W0MA 4M9CA 4NHEA 3UT5B 5DBOA 1QO9A 5BW4A 3FWYA 1E3TA 5I48A 2IHJA 2QVZX 3WRXC 1HDCA 4X63A 2WIFA 1WUIS 1W34A 5LOVF 1XLWA 2HDWA 2IP2A 1Q83A 3DMTA 1JXMA 3DW3X 3IQIX 4M9ZA 1JH9A 4CMCA 4EHJA 1IBCA 2ONCA 2CXQA 2PUVA 2VF7A 1VB3A 3EIXA 4WDRA 3W05A 4CXMA 2FUEA 2JBAA 1E3WA 4WKGA 1PD1A 4A2QA 3WGUA 4B5LA 3QHAA 1E9AA 3SM3A 2XMGA 5G2CA 1CXZA 3GFBA 1VLZA 1SUDA 3VJLA 4CN9A 4RS3A 1A88A 1JA9A 2P5YA 3AILA 5LBTA 4LTMA 1ORVA 3K0CC 1WB5A 3RYTC 4EG6A 3M82A 1RJDA 3E8XA 4QFCA 3URMA 3WV5A 5JFGA 4MZDA 3O93A 5K8VA 2IEBA 2VPQA 3JQDA 3AQ4A 1T6NA 3GEBA 4MMZB 3S6JA 5BV0A 2QPLA 3LDGA 2PT6A 2VHUA 5KNCD 3VV2A 2HYIC 5IM5A 4D92A 1U7OA 4F12A 1YA8A 3H3FA 5DBIA 2UUAB 2OCLA 4IIJA 5LQJA 3KALA 4X93A 5DB4A 1UDCA 4CMHA 4D4JA 1KYQA 1YDGA 5JH7B 2XWBF 3LBHA 1RZRD 1JHDA 1R6DA 2BY4A 3EK2A 4JNKA 1NSTA 5EJFA 1XKTA 5DSTA 4RLFA 2Q7DA 1SUWA 4UFNA 1M0MA 3WHPA 2FWJA 2PAAA 4NULA 5G02A 1FVFA 2C8LA 4HDNB 3VVBA 2ZM5A 2B8WA 3C7TA 1QGZA 3KSAC 5CH5A 2PG3A 3SQWA 4L50A 5AYVA 3LXXA 3ROFA 2YBDA 5TNXA 3WLHA 4AW9A 3VR6A 4NARA 3W2IA 1BKYA 4KE8A 3VMFA 4U5XA 5AVUA 5JRZA 4HLDA 3LI2A 3DEFA 3HI6A 5EHIA 4NL4H 5EZ5A 4EF5A 1WPGA 3S5JA 1E59A 4MWOA 5JBQA 1HLGA 3KE8A 3K1TA 3OE9A 1T0BA 1X7ZA 4XSVA 4ZOAA 4K28A 3SIWA 1DE0A 1LB1B 3KFLA 3TB6A 3D3WB 1B8VA 3O2QB 3C85A 3UAWA 1E8DA 4NI5A 1AMUA 1DV2A 4N9QA 3FZQA 3SE7A 5HDBB 5IS2A 5EXXA 1XZNA 1XTKA 2JHFA 3WHKA 4CQLA 5A04A 5AMXA 1EFKA 2ZZLA 4HNQA 1WZUA 4RD3A 1HT0A 1C9KA 4TPKA 5JARA 1WSAA 4C4PA 5CCBA 5AVXA 4BGIA 3T7EA 4R2WA 2CLFB 4UBLA 4Z9YA 1JFRA 3GGSA 1ISFA 3IS3A 4M99A 1CUSA 1XVTA 5AHYA 2P27A 1UXKA 2C3OA 3HJTA 2GJ8A 4E6EA 2OSVA 2C59A 3AI7A 3NMUF 4GRVA 1HLPA 4PLGA 2VWQA 1E0SA 2MYNA 1AC5A 2IU4A 2HD4A 4XTCS 4BNWA 3DVSX 4LY0A 3HLYA 2O8CB 5EYPA 4LNUB 2YWXA 4RCYA 4N9WA 3OY7A 4MA0A 4NV0A 1WPXA 2OAP1 3J81k 1Z7BA 2HPYA 2PZJA 3HAQA 4QBIA 4DLBA 2XXAA 1DC6A 3D6NB 2AJBA 4JVOA 4NE2A 1E6LA 5IN5A 5HKBA 1FZTA 2YCLA 2GYUA 1PIWA 1VM6A 2C3PA 3FR7A 1U2SA 2H1HA 5AOAA 1IQPA 4D4HA 1QR2A 4DLXA 5A4AA 2G80A 3L6EA 1BH6A 4DS7E 4BNXA 3OE0A 4FOTA 2QA5A 4KLRA 1RHMA 4PGGA 1O97D 2XIJA 3OWOA 5FI0B 3VGPA 1BFDA 4BEWA 3THRA 4X71A 4CQMD 2E5LB 4WUTA 5IDWA 4B45A 1D2CA 4ME6A 4GOLD 2K7FA 5IWCA 1CJCA 5D84A 2Y05A 1B15A 3BREA 4YQZA 1P0IA 5FLXA 3EIHA 4BGEA 3FLMA 4R31A 4XARA 3T12A 4F9TA 2XB2A 1CUVA 2ZRQA 3AUFA 3N8KA 4FEEA 2NYRA 2BMDA 4PGFA 1A27A 1CB0A 3LUCA 4XDYA 1HDGO 5IJAA 4UAVA 1ZVKA 4TLDA 3HR4A 4RK0A 4YHHB 2A67A 2I3ZA 4IUYA 3P2YA 3WJ2A 3EWAA 5L8VA 1LDEA 3WBFA 1YS6A 2QG6A 3I9V6 4O1MA 4ZC1A 1NZDA 1W1WA 1MX3A 4ZCTA 2Q21A 4B82A 1VPTA 2NVWA 4XB6B 2OLJA 5JO9A 3GWGA 4H1HA 4BEZA 3OZIA 4Q4LA 5BVHA 1ZC4A 5DNVA 2DM6A 3G13A 2VNHA 1UBOS 1R5OA 4N40A 1K0FA 3G2IA 4PG4A 3KQQA 4YALA 5IJ9A 3L5OA 2VDPB 3UB3A 5FXMA 1T15A 4QDXA 1P91A 1D1QA 5H2PA 1NI4A 1S7GA 3NWJA 5EQFA 4ER6A 4IRXA 5CDGA 5L4LA 3GK3A 1OV4A 4U3JA 3GUZA 4XDGA 2CV1A 1B8OA 2G9NA 1K63A 4H15A 5EJ5A 221PA 3AJAA 5IJWA 1NOKA 1KIMA 2KJQA 3EXEB 4Y6SA 3A05A 5SYMA 3ABIA 5LZ5A 5JJCA 3VKFA 3P45A 5B1SA 2ZIVB 3EUWA 4KJZA 1ZH8A 2C9MA 4NBUA 2A35A 2ISSD 1TB4A 1IRXA 1XAHA 2VK4A 4FYPA 2WAMA 2REXB 3IUBA 3HCEA 3L6RA 4NH4A 1ZGAA 1RWPA 2GA8A 4QOSA 4RTKA 3DLAA 4I2VA 1OYVA 4PGAA 5T41A 2L6XA 1D8AA 3EN0A 1OFTA 4JBHA 4QPNA 4UUBA 4WESB 2X3YA 5CVCA 1RCTE 4BVHA 5FPKA 4K9LA 1OI7A 3V1KA 4J16A 3IUJA 4XCXA 3UUEA 3ZHVA 1RMYA 1H2YA 3FNBA 1W7AA 5C35A 2IHTA 5CH3A 3KLMX 4F2DA 4JROA 3W4IA 4IWNA 3U7HB 2YBEA 3TWOA 2EARA 1J06A 3R0VA 4HSGA 2HADA 4IQ0A 5DGDA 3TX6A 2HNAA 4OP3A 2V58A 2YWBA 3REOA 2NUBA 4ZVOA 2ZAOA 2QTNA 4MP8A 1HFEL 2B3DA 4FFBA 1RLMA 1Z0UA 4BCBA 2OXFA 5T8KA 4JSRA 1YOVB 4CETA 2ST1A 4U6QA 3QIVA 1JQDA 3FFXA 1K27A 1T0UA 1URPA 1VHQA 2UVPA 3JALA 2Z4TA 4U9IS 4WXRA 4F86A 3PPWA 3A6ZA 3W5BA 4LISA 1XC7A 1P3DA 4CLRA 4D6XA 4B79A 4U0KA 3HKEB 1N6IA 2F6RA 4NCXA 4MQ5A 1HZJA 1FFSA 3NNNA 1RIIA 3QP9A 4EAQA 2QMZA 2EBHX 2X1VA 4J4TA 2GXSA 1BXGB 1V4NA 3DOOA 2JPDA 3FUVA 4IG4A 3R3JA 1EB8A 4UEWA 4V2IA 1U1IA 4L4SA 4HFRA 3BXOA 3HM9A 1V48A 1LCIA 4OHCA 4WOPA 1EDZA 3T0IA 2B98A 3VO2A 1JQ5A 4D9IA 2PUBA 4XPZA 2C95A 3B38A 3LFHA 2IIVA 2X9VA 3FWZA 2Z3WA 3EAGA 3D3JA 4GUDA 2M98A 4HYEA 4HWSA 4S12A 5HILA 1PF7E 4JLDA 1GEGA 3ZH9B 1AP9A 4OB6A 4KHZA 2VCHA 3VNVA 1SVIA 1CJKC 4HGPA 2MSCB 1OLSA 3UJ8A 5T5QA 3IAM6 1QR6A 3LY9A 2B5VA 3HA5A 1TIBA 2J41A 2E21A 1M6YA 2ZBRA 4UVEA 1B4DA 3BF7A 1J8MF 3P9QA 4UTZA 5SY9A 4CQJA 3LUPA 3W6PA 1P9RA 3WLNA 2ZWAA 3ZPQA 3N6VA 5EMLA 8MHTA 2QRQA 1WS6A 2RCYA 2BMWA 1QGAA 1RXCA 1AUPA 1JLMA 1KZYC 4N7MA 3AESB 1C3OB 4R8SA 3DAHA 1Y3HA 1JHYA 2PBZA 3EQ2A 3MHPA 3Q7RA 3AXTA 4YT5A 5FPHA 4DJTA 3SOPA 4DT1A 2I6QA 3QBKA 1E2MA 1USVA 1K97A 2DPHA 2MSWA 2B83A 1QGED 4TSFA 5G1NA 2B2CA 2BCGY 1JKMA 1DBPA 2I6GA 4BWBA 2IUTA 2JI7A 2QDXA 3GLKA 3EY4A 2I62A 1S54A 2AT1A 3HN6A 1ZLXA 3OE1A 3SZ3A 3IEIA 1V47A 3WGIA 5HFNA 2P2SA 4O2RA 4HJXA 3VYSB 2R6HA 1PO7A 1R0SA 2ZUWA 2NTJA 4GZ6A 4JAVC 4JQZA 4TWAA 3EMDA 2QAIA 3RFTA 2I1WA 1U3FA 3RS4A 3QGMA 3QXJA 4RIEA 3VRHA 2MDTA 3HKCB 1MZPA 2BTQB 3KT8A 4IICA 4DR1B 3ER9A 1KYXA 1SFRA 2WBLC 5MGNA 1PJTA 1T5TA 3WLAA 3N0RA 1H2XA 5LOVB 1M8KA 2Q5CA 4BWYA 4GI5A 3JQQA 2AG6A 5AXDA 1J0XO 3GVPA 3AERB 1PD0A 3IQEA 5IAKA 1V8DA 2XMCA 4ZMSA 5JTTA 4JK3A 4J2TA 1DJLA 3KEFA 4R40A 1XMIA 3K0FA 2Q7OE 1OXTA 5DF1A 1QG2A 4K9OA 1XXHE 1Y7LA 2ILTA 3QAPA 2P2YA 3D54D 3PJDA 5TVGA 2CNKA 2NPFA 5CFRA 1C8BA 4G1EB 1SVMA 3JWPA 4ZI7F 4RACA 4BO8A 2F3UA 1K9VF 3LGAA 1XAIA 1GUDA 1ZSVA 3VKHA 2V5VA 3B6IA 1R66A 4PF1A 2X5NA 2Q2OA 4NQRA 5FYDA 3N2NA 1P7ZA 5E6RA 1FB5A 1E18A 5IXSA 3GLFE 1ZYUA 4JOBA 1FJGB 1X9HA 1LRJA 1SPBS 2GN9A 1X7WA 4TLAA 2A5GA 4OUDA 5E1DA 5J23A 4XEUA 3GLGE 5EE0A 5T4HA 1SBYA 5EIOA 4RK5A 3TKYA 4EFDA 1PFGA 3NYIA 4J0CA 1GP2A 3K5IA 1SURA 5ER6A 1TYZA 3R9XB 2PXXA 3R8FA 5JATA 4M0UA 1PJZA 1JQJC 3R6LA 1T2DA 2CXRA 1USKA 2RGAA 4U02A 3SICE 4ESOA 2F3SA 5ALTA 4L85A 3KD3A 1DAFA 2FW0A 3GGJA 5K3FA 3F6PA 5JAIA 5HYVA 1XMXA 3A4VA 1L5HA 4QUHA 3FBWA 1XLVA 4DIBA 1EFLA 4Q12A 4C06A 4F3TA 1XU9A 5F64A 2ZATA 1OGIA 5DXFA 2E49A 3FTDA 5C8YF 3UPDA 3EHEA 4NR0A 3HRKA 5HPYB 1BROA 5E1OA 3R8XA 3CRMA 3R2JA 2P62A 3GX1A 4QOIA 4MQTA 2J5QA 1A8HA 2LCQA 2VUIB 4ES6A 3MT8A 4LYAA 3M6AA 1AQ6A 1AH2A 2J59A 3WO0A 4DCUA 2PBLA 1IWBB 3G89A 4LY3A 3RUCA 1ZI9A 3WAKA 3I34X 1XVVA 1N0WA 3OZXA 3PHBE 2ZSAA 1AQIA 4LNAA 1RI5A 1T6YA 4YJ3F 1FDSA 3L8YA 4QIHA 4BTLA 1VXRA 1ZCAA 3KSMA 5HTOA 3ZBTA 3O2NA 2GWRA 5AW6A 5HQ3B 1DMSA 2QF7A 2YRXA 4NCNA 3VHLB 3UV7A 3QAKA 2XQJA 3MPUA 3UW1A 2DTXA 5IDQA 2X4IA 4ZVVA 1OX4A 1PR0A 1ZK0A 3HSYA 3F7NA 4I7EA 4KQEA 5JD3A 4EFKA 5HXAA 3LDUA 4R1NA 3RZEA 1D1SA 2ODBA 4HVCA 3UK1A 4A36A 5FBQB 4BKPA 1TIKA 1P7YA 1EM6A 1VSQA 3OLXA 3EVTA 3NAMA 4UOEA 1KK0A 1IULA 2QAGC 3AVQA 5FPQA 2QW0X 4R1LA 1MB0A 5CIYA 4WQMA 4B3IA 1VPWA 1NXXA 3EVDA 2YYYA 4MS1A 2QN2A 4X0EA 3FTCA 4OREX 4PPGA 1CTQA 1VL5A 2FRVA 3MJEA 4NAVA 3H1EA 2E89A 1DZEA 2OOSA 2XNDD 3NM4A 4F4UA 3K4HA 3I32A 3BSYA 3FUWA 3WSWA 4HCJA 1OIXA 4V0SA 1NVKA 3ENQA 2XE8A 3L6CA 3QWAA 1EJ2A 1WHTB 1MT3A 2ENWA 1DTWA 3D5EA 4BWVA 3MTEA 2OVFA 2ANCA 2WKRA 1D04A 3GPLA 3SPXA 3ZQ4A 4Q4JB 3STXA 2FFJA 1SVNA 3AF2A 3KQKA 3WLOA 2BF7A 2VDRB 2H2GA 1XUOA 3E2MA 1QIIA 1ZQ9A 3DVAA 4P34A 3SF0A 4CPDA 4KLZA 1EFVA 4PBRA 5LQUA 1B23P 2PEZA 3E9CA 1Z4OA 2Z1NA 4C6SA 5EP3A 1KHTA 1M1YA 3K2EA 5SZHB 1AK9A 4ZD6A 4ER0A 1TQ2A 5BN3B 4LCBA 821PA 2CXPA 1NY6A 2VC2B 4LPKA 3KQWA 3RTGA 1M72A 3DV9A 4F3CA 1NBHA 3DE6X 2R9VA 4N8EA 4ZOEA 4KRXA 3KR2A 1TAHA 2VZ8A 5DM4A 1PFUA 2OB2A 1OI3A 2YWEA 1VCHA 4ESHA 2HMUA 4GQAA 4DG9A 4KMRA 3T0GA 3HB7A 1JEDA 1UBEA 4RETA 3WKDA 1MAVA 3N9IA 3AVUA 2ERYA 4K03A 2V7VA 5CYFA 3OZRA 4Y9RA 4YIHA 1G19A 2I66A 2IJGX 2VHJA 4UNNA 4E5PA 3CVVA 3RIXA 2FCAA 1BDHA 4FE7A 4KQCA 1Y5LA 1DQSA 3L8MA 1BDIA 8GPBA 3L7MA 6ABPA 3QFHA 2G7ZA 1JAYA 3CLHA 4BFUA 2FUG1 1UAYA 4QLAA 5BSVA 3IE1A 2C5GA 3H1TA 3X2EA 1NVGA 5I4CA 2O1SA 2WG2A 4IILA 3WLRA 3SC2A 2PEDA 4AP9A 4DC1A 4RBNA 2PZFA 4E5UA 1P1HA 3OOYA 5C80A 2UKDA 1TAGA 1DXHA 2W2TA 3D2AA 2C2YA 3GCGA 4MR9B 3E61A 3F47A 3IKLA 5CFMA 5IK2D 3PD1A 1PK7A 3OCYA 3RJ9A 4Q3LA 1OLXA 4UD2A 2RGEA 1G8YA 3A6EA 3QU2A 3O2SB 1NHGA 3ICPA 3WK4A 3R7WA 1JDUA 3CLRC 5EFOA 4RYLA 1G98A 1L3CA 2HM7A 5JXIA 5KYNA 3H1AA 3RRZA 4Q0MA 5DM0A 3KOZA 2H2DA 1M67A 1R5NA 1H3EA 1LJ8A 3DDLA 1C9YA 4Q16A 4PYKA 2BFDB 4TL9A 3BK1A 5AT1A 1R6BX 4GGOA 5BNFA 3MRVA 1MO4A 1BQ3A 3SMVA 2VHWA 2FR8C 2WU0A 1I0ZA 2ZYAA 4GLBA 5AW4A 2R97A 3UUFA 4ZCMA 2HJHA 4PXFA 2P40A 3RKRA 3OI7A 5TC4A 1A71A 1N92A 2OORC 5FEMA 4DYDA 3BIWA 1FRZA 3JW8A 4KQIA 3HGMA 5JDCA 2Z6QA 3LBAA 2H1LA 3PEYA 4S0ZA 5E7QA 1IRIA 1DEXA 2C4MA 4XPIA 3K1JA 3HCDA 4YRCA 3BG5A 1PFYA 5D7NA 3EH3B 2WLSA 3BN3A 2WJ4A 3DBVO 4EA6A 4EKGA 1VDMA 1Z28A 2HV9A 1CERA 4XIGS 3UHFA 5K20A 4TKVB 1EDOA 3BMQB 3MGGA 1C7ZA 4DSUA 2GPAA 4Y9HA 1NU8A 4ZVPA 4MQEB 3COWA 4HFMA 4LPSA 2BFPA 2IPNA 4AJ2A 1D5CA 1P8IA 1LLFA 1RYZA 2Z3ZA 1X8LA 3OX4A 3HO8A 1XDWA 4J4BA 1JV2B 1CFJA 2PUEA 2D5CA 3HA3A 4D8XA 3KEMA 2FPSA 2R7AA 1GNLA 3EIQA 3HSKA 3JQGA 3I2GA 1JTFA 3IE2A 4WZAA 3T45A 1GNRA 2C5HA 2G08A 3LU1A 3AVYA 1FMLA 4KMMA 1US8B 2YQZA 3N0WA 4U2DA 3S55A 4YV0A 4K86A 5LBIA 2C4HA 1N5DA 2WKQA 4OXYA 2IWRA 2UZIR 3WG9A 5KNBH 1JFFA 5LLTA 3I2JA 2C03A 3D59A 4U39A 1BCRB 3ROZA 3U48A 1JR3E 3QBVA 4QWMA 3H4TA 4ENTA 1QCZA 5L6LB 3M6LA 1VJCA 2QRKA 3QBJA 3EQ7A 4Q05A 3QYPA 3NUGA 2C98A 1GZMA 1X1CA 3IDFA 3VOAA 2GEVA 4OMDA 4XA8A 1ZR4A 5DM2A 4AJ9A 4QGBA 1CQIA 3KQNA 3EVEA 1NJ6A 1WQ3A 3QMVA 4GLFA 1SD1A 3C6ZA 3WNQA 4TMZA 1UK6A 3DOEA 4N5IX 5KU1A 2HBZA 4IZOA 1A4UA 3ROPA 5A4JA 3X3CA 2WMNB 2FP3A 3HUDA 4YMWA 1IPHA 3X1JA 5AW5A 4L72A 3OLYA 4ZOBA 5IC4A 2DZDA 1OWMA 3FETA 5FT9A 1KP9A 5LB4A 4NZNA 1ZUHA 3CWZA 1VC2A 4OQDA 3ANSA 2A59A 4Y8VA 4MUMA 5DU2A 1KDPA 2QI9C 2ENUA 3O2JA 1J9GA 1WDTA 3EZ9A 1N9KA 2VP9A 2WPNA 3EGDB 1OGJA 3GZNB 3H19A 5IBPA 4FHDA 5BUCA 4RXTA 2BEUB 3RNLA 2H2AA 3VR3D 2ZG6A 5CT4A 4IWXA 4B46A 5ITWA 3EPJA 4CCWA 4G7QB 2DE0X 1V2HE 2QR5A 5DTIA 3VU9B 1D2EA 1BWRA 4YS6A 3GAMA 3HVJA 3PDCA 5DVZA 2R47A 4BKMA 1FPMA 5CNKA 1KY5A 3ZCVA 5LMZA 4QYIA 1VTKA 2DWPA 3CA8A 3C97A 4Q18A 3TL2A 2OZPA 1GAWA 2O54A 3W6OA 3QJRB 2I7VA 2FSUA 3B1ZA 3B2QA 2D0OB 1VRCA 3KWJA 4OJTA 1K4KA 4JELA 4TWZA 5G3ZA 4F5ZA 3O1JC 2VHXA 3IULA 3EDRA 4WN9B 4GWKA 4KX3A 2WHPA 2YNMC 4I14A 1W5SA 5EJGA 3GFFA 5AR1A 4BNTA 3DP7A 3AJEA 4MQLA 5H5JA 4ZXPA 5B3KA 3EY9A 1RE1A 2FGKA 2VXOA 3E58A 4UBKA 1LBEA 2IEYA 3BKXA 1AN9A 1V9SA 2Q3DA 3DDZX 4LOKA 5FUMA 3T1YB 1II0A 4FYJA 4HEQA 3OP4A 2YS6A 1MOZA 3I64A 4MV1A 4F71A 5KZMB 2P6PA 2UDPA 3KFXA 3PP8A 2EQBA 3RYHA 4ZI7B 3CE6A 1XVUA 3U62A 1SVUA 2V5UA 1VJDA 3C45A 4FNMA 5MFPA 5BV2P 3V6LA 1G5IA 2C00A 1IDN1 2X5JO 3GMTA 2ZTMA 4RVCA 1AE1A 1UK9A 2D1YA 4MQ6A 4MWTA 4C3VA 1SUEA 3ROTA 1RQGA 4B85A 5B30A 4HEHA 3B53X 2OGZA 4RKRA 5CXXA 3CLVA 5E4YA 2VF4X 2W6IA 4CR8A 3KFVA 3COCA 4HDMB 4OU4A 3RSFA 3X44A 4CDNA 1LY1A 2PY6A 2ZI9A 4BWFB 3GMSA 5I4KA 5CW2A 4D3ZA 2QN8A 3ND6A 1SVLA 3C5WP 3O4JA 4KMSA 4B6RA 5CG1A 4ERXA 5HE9A 1BYIA 4IIJB 4OQ4A 3Q8KA 2C9DA 1KG9A 1FTYA 3N28A 1ZD9A 2OT3B 1OXVA 3BL8A 3CUEF 5FTLA 1S8AA 4W6QA 5ILGA 1AUXA 4BO5A 3L8GA 2VK8A 3BYZA 4KR9A 2PD3A 3I1JA 4A3SA 3PENA 4AJKA 2GAJA 4YQFA 1J25A 1Z0KA 5C8YB 4NC9A 3I8XA 2PEYA 2I4TA 2R8OA 4V39A 1SMKA 3KHTA 3DLHA 5KTMA 1N75A 1YZVA 5CJJA 4EY7A 4PN3A 1X0I1 1W76A 3OOWA 1UXIA 2J5XA 1ENOA 4AYWA 2Z73A 2B8JA 3E81A 3TM5A 4B1FA 4MEAA 2X0KA 1Q0LA 3QG1A 4IOKA 4NEHB 4C5CA 1XD9A 1IM5A 1WDKA 2OG2A 4EZIA 3U6BA 4YJ3B 3VR5D 4G2TA 3PUHA 4US0R 3RQIA 1N4DA 1YBMA 2ZUCA 3IVCA 1IQRA 5HIKA 3L46A 1HX7A 1R27A 1Y6GA 4B6QA 1U9ZA 4IV5A 3WGOA 2JD1A 3NOOA 2DUWA 1E2DA 1NPDA 4MRNA 2ADFA 2EZUA 4HGOA 3D7MA 3UJCA 5KOHA 4H60A 3R7LA 4BVGA 1DTSA 3CF6R 1CD5A 1FYVA 2J33A 2CYCA 1V7QA 3DFZA 2YC2C 4ND3A 4YAIA 3HBAA 5EP2A 5JFTA 4JJZA 2JFBA 2Y92A 4UDOA 4ARZB 1TA4A 2KB0A 5JVDF 1TT7A 1C2TA 3U5TA 3WQBA 2FAXA 4LRTB 3THWA 4KLAA 3ZV5A 5D85A 3BH0A 4HRXA 4NQZA 4EHKA 4KDEA 4B4KA 1A9ZA 4AXBA 1DJPA 2POCA 3TI9A 3VR6D 1NG9A 3OUZA 3KB8A 4EF4A 2XZDA 4H1UA 5DW0A 3NQ41 3PHGA 1ZIOA 3TGLA 4WHMA 4AJOA 4MHTA 1R8JA 1F8XA 4KPUA 1BGVA 4WBSA 3GLUA 4J03A 2XXAB 4WXYB 1KMHA 1QORA 4OGLA 1N6KA 3HU3A 3HFJA 3IAS6 4URYR 4BMVA 5IT0A 2NUPB 2YW9A 4RQTA 2B9EA 3AR4A 3M6UA 3MB5A 2NXWA 3REQA 4YCNA 1YMUA 2IE8A 3RTAA 3BSWA 4IVPA 3QPCA 4D9BA 1P62B 2Q9UA 1TUBB 1WUJS 5BWBA 1CUXA 2H48A 4URWR 2PJRA 4M0DA 1Q2UA 4K88A 3EOZA 2EIHA 4HDKA 2W2OA 5E9AA 2I21A 4N5MA 3DF9A 4MWEA 1I4OA 4KO2S 3BIXA 4Z8XA 2BHRA 2FXVA 5I7UA 2QX7A 1NMSA 2CCJA 3BK2A 3FROA 1U63A 4NU8X 3FTFA 1GAQA 1GV0A 1RYDA 2HWKA 2WU3A 4GRDA 4CKZA 4FWTA 1E7MA 2OZKA 3I5UA 1I6WA 2IZ6A 4N0PA 1DT3A 3E3MA 4GUAA 2YDXA 4IGFA 1NFQA 2C96A 4DRZA 1W30A 4O4LF 2NPIA 1L4MA 2F55A 3G5MA 2J0VA 3MT0A 3NB0A 2PH1A 4C0XA 2WV7A 3P0EA 5FO1A 1NYQA 5DRTA 1F8YA 1K88A 4MGIR 4JXXA 1BHO1 1X77A 1WXXA 4OBBA 1TE2A 3TW6A 2D2EA 5IH7A 3IAFA 4WWHA 1A1VA 5JCJA 2GLTA 2VPWA 4QJBA 5IJ9B 1S96A 2QMUA 4YJKA 2VDKB 4WKNA 3H9JA 4J29A 3SF8A 2WU8A 2YXPX 3PC8A 2O52A 3QVGB 5HUHA 1OLUA 3G0IA 3GVHA 4IJUA 4YPVA 5H9WA 4BQOA 5LJLA 3LY5A 2ODEA 1Y9EA 3HKBA 4Q15A 2WWYA 3MHTA 2CJWB 4YBRA 1GQQA 4LY9A 3KBOA 2A88A 4EHAA 4BO2A 4TQ9A 2OXEA 5J2TA 5CVDA 2B4RO 4P4LA 3SJUA 1YCHA 2UZ3A 3SQMA 2JC3A 1AQLA 3LHDA 1XTBA 2MWMA 3FGNA 5EPOA 3E27A 4UG2A 3FM9A 4QYTA 5J40A 1YMQA 3GAZA 3L84A 5IF3A 3IQDB 2X5KO 1UCFA 4L75A 2J4DA 3WTBA 2EW8A 1ZXBA 3DH0A 3CF0A 5TX7A 1WO8A 2B30A 3BHIA 3FPCA 1MC5A 4LOJA 4WGFA 4ZI2A 5K8TA 2OBNA 2HRZA 4R8KA 3SR0A 3OZSA 1Z6QA 5IFKA 3EZ7A 1TTPB 4J7CA 4AMUA 3QX9A 4OLFA 1BG6A 4U00A 4G1UC 4AJJA 4BFXA 1CEEA 1NTRA 2VS1A 1GU8A 1E2LA 1CULC 4E94A 1KHHA 2AT9A 3QSGA 4N3CA 4OGKA 5K8JB 5AK4A 3DVRX 4WINA 3ZZ0A 1XTSA 4HWKA 2AW3A 4N76A 1Y6ZA 3JQRA 3VUEA 1CR4A 1ZM4A 3QUTA 3PQCA 4YFYA 2IYYA 2WWFA 5CITA 1K8YB 2ZE5A 1NNEA 3SJBA 5C5CA 1JHOA 4YJ2F 4FFBB 5KYVA 5AI8A 2BUAA 5KNDD 5KAPA 5ITCA 1FLDA 2QTFA 3S3DB 2KWIA 5C7LO 3RS0A 3EPKA 2CLEB 5H7XA 3VYRB 2G88A 4JB2A 1T9ZA 4RMNA 5HIJA 4Q7EA 1GZ6A 3WY9A 1T8SA 3KX2A 4MWSA 3ICOA 3N7AA 3H3JA 1XA3A 4YUAA 1D1PA 2PKWA 4YRPA 2HLDD 2O2ZA 1F6WA 2O3UA 2BH2A 1XZPA 2CEKA 2C7PA 4GSLA 1GZUA 1QH1A 3O8LA 5FLKA 1TPYA 3EEBA 2WQ7A 3MF4A 1A7KA 2PL1A 2OGWA 3E4CA 5LZ7A 1GCAA 2FK8A 3CVWA 2SNIE 4YRQA 1KJNA 4DDTA 3PS9A 5C8XA 1ISRA 2DRIA 3PA6A 3HJAA 3NTLA 5AXBA 5I5EA 5IZCA 4C7BA 1Q6ZA 2I1XA 1IEWA 1YZQA 1U3DA 3NHSA 4D46A 1VIAA 4DBZA 2PKXA 3E8MA 2YDYA 4MXDA 1O87A 3PIDA 3C98A 3UTCA 2JLUA 1E9RA 4M0FA 5B6PA 2ZBGA 3HJFA 3PWZA 3KKNA 4UJ5A 5I9SA 2X19A 2AFIE 2JJQA 1G55A 3IOEA 4Z0NA 1OLSB 4J4HA 5FADA 4UFPA 1Y5RA 3LMKA 3SVZA 5FFNA 5IXJA 1IXZA 2RGCA 3ANYB 1U8UA 1PXRA 1Q11A 2PZGA 3PXCX 4JFRA 4EPYA 3M5CA 4Y2XA 4IQ8A 4C0AC 3TRKA 1BE1A 3IDSA 1NW7A 1D1TA 3PWSA 5TGZA 4M7PA 4MW1A 5IVIA 1T9GR 5AX0A 4W5HA 1YF3A 3QJVB 2A9PA 2JJ1D 1TC2A 3OF3A 2YVAA 3SGLA 3JD1A 4KO1S 1U3WA 2EF0A 4AY5A 4IYJA 5BURA 4FYHA 4WD3A 1C0IA 1RYFA 5A5GA 3M89A 5DHQA 3G0HA 2IZZA 1U1FA 2YV3A 3CN7A 4M7OA 3TI7A 2LBPA 4JJ6A 4Y2PA 1WVMA 1DX6A 5IABA 1HTWA 1Z4QA 8ATCA 3CISA 3FDJA 1NYLA 3IHLA 1A96A 4HQ0A 3PXGA 3ZHXA 1KKUA 1R3UA 4EGJA 2C54A 1S52A 1DWPA 1GU0A 4IGEA 5EHGA 3QW4B 2TMGA 5H68A 4HGZA 3Q72A 3TIGA 3UO8B 3HBFA 3SHOA 4FOOA 5ARBA 4QPPA 2WYOA 1ZP6A 3CPSA 1MABA 1OF1A 1UOEA 3L9XA 2ECFA 4G0QA 4J0KA 2GN0A 3K0EA 4BO4A 2GYYA 4YUXA 1SIUA 2H8KA 1W0JA 3H2GA 4ENPA 4S0XA 4EZBA 3AR8A 5YASA 1CDZA 3M2PA 2JGFA 1C3LA 2JAWA 1K75A 2GFHA 2JIOA 2NYUA 4G9GA 2IW1A 4HDOB 4JT4A 4MO9A 1GTSA 3DYVA 3IHWA 4NFSA 5A2QA 3K0FB 3C15C 1HT1E 4KSBA 4GBMA 3KKMA 2G0NA 4CIXA 2I4OA 3TTYA 5TIIA 2I91A 3MSXA 1HDIA 4WI1A 2RIPA 5DBFA 3GJ3A 2F1IA 1Q1EA 1VHDA 3AC0A 3E5HA 3E22B 3V2IA 4XR4A 5GMOA 2W98A 1BHJA 1U8TA 2ZCUA 1AZTA 2VTEA 1BC5A 1ADJA 1SHUX 5E6RB 1KI4A 5EKUA 3DZBA 3BULA 1CUGA 4TV9F 2LKDA 1RKXA 1C30A 2P68A 2TMKA 2WF7A 3FKSD 4MPJA 4LJLA 4QVKA 1X7WB 4R6XA 4RV9A 1MN6A 3ESYA 4QPDA 5DULA 5DYWA 2FMKA 3VHXA 2F93A 5B7NA 2ZBPA 3DCIA 2JANA 4E88A 3OECA 4F2WA 4UEOA 5CLHA 4F97A 3NBFA 4DARA 4ARIA 3KC2A 4PC1A 3JV7A 5IBRA 4AF8A 5G41A 5DT9A 4EDFA 1TA9A 5KYWA 3HANA 2PUCA 2QX6A 2QN1A 3L40A 2R8ZA 1SNYA 4DG8A 4O3MA 4EMUA 2ORIA 3MUOA 2Y9MB 4GFDA 4HEJA 5K3FB 2Q0SA 1N9ZA 3GA0A 1QHHB 1N32B 4DDVA 4MK4A 1U9IA 5HF5A 2R84A 1L5HB 3C3KA 3GEEA 1ZINA 4HG2A 4B75A 1NP7A 4M1WA 4B6FA 5H3LA 4FEYA 3D8SA 4AT1A 4CLXA 3VR4A 2XBMA 2FG7C 2CGEA 1IG3A 3NLLA 3DHEA 2H9IA 2CZGA 2Y68A 1P9OA 1THMA 3WA6A 4MDEA 3ZWOA 1PFWA 1ZIXA 1EXNA 5I7FA 1LX6A 3CZPA 5ALNA 5SYNA 2OBBA 1ESMA 2EBFX 3KZMA 5CYOA 1KYTA 2XVYA 4HQOA 4QX6A 2XUPA 3SQXA 4TWJA 3BXFA 3SLGA 2VHQA 5KTKA 2WICA 2PS0A 1CZOA 3HNPA 4JU8A 2BEWA 2IU3A 2O2JA 4K2HA 1F60A 3CCBA 2ATVA 3HU2A 4GBRA 1QVAA 1QYXA 2V0NA 2O4UX 3C7CB 2VT2A 5CM9C 3CVJA 2NZVG 2DGDA 1JKJB 3KOMA 2AR9A 1SD2A 3FPAA 5CJPA 1JDBC 3FW1A 4KK3A 1UEIA 5LMCA 1OFGA 1XEXA 3HG7A 3OIYA 4YK7A 1EHIA 3QUAA 4HO1X 3ZZNA 1DUSA 3N8IA 2ZYRA 4JXKA 521PA 3AKZA 2YHSA 1BKDR 4JOSA 4Y7CA 4CMIA 4YCJA 3V2WA 1CLEA 3U6KA 1RIFA 4WW3A 3CLSD 3EIOA 2RG7A 3NDJA 1E0AA 1KY4A 3ZJUA 3WRXA 1YZGA 3GG2A 1GUYA 2MJLA 3V8PA 4H18A 3M7IA 4X6YA 3PZBA 4QQRA 5E7MA 1N0UA 4OFZA 4Z5XA 1WBJB 2AQIA 4ZEVA 1Z5NA 1NBEA 1VSTA 3EXHC 1U2GC 1X92A 2BGKA 3JQFA 4L8VA 1TL7C 3DV2A 1YFZA 4Q4CA 3S1SA 2ECKA 4IOMA 4PO3X 5J59A 4XLTA 3TLZA 3TVYA 1Z07A 4XT3A 3LUAA 4FMBB 3WWPA 3BRSA 4PQFA 4Y2VA 1L7XA 4C6TB 1CS0A 3KXPA 1FDIA 4D57A 3AI2A 3UMFA 3DVAB 2EJBA 2RH9B 2HK8A 5FULA 4BYMA 2IZ1A 2YJ4A 3GEDA 3LCVB 1MGOA 2X58A 1X7YA 4IDHA 5DISB 1T2VA 3EZYA 4DVGA 5I45A 3EC1A 4MYRA 5FUVA 4BIMA 1IOZA 4FS8A 5HF6A 1S51A 3WQJA 2P6UA 4CIWA 5IG2A 1KH2A 1UKAA 2ASVA 1HMPA 1R0ZA 2ILVA 3ZXYA 1U2PA 3TMKA 1R1DA 5EN4A 2FZEA 1AU9A 4QQFA 1GA1A 1WNTA 3R09A 2Q4TA 4RLHA 2OQ2A 4N54A 1NVAA 2VEDA 1I6MA 1PT5A 4O4LB 4RTJA 5I8ZA 4D3XA 1OAOC 1QDEA 4L7VA 1MV8A 4A0RA 2JAUA 4HFJA 5J5VA 3WL7A 2D2VA 2FP4A 5JXWA 5F12A 1Z5PA 3VDXA 2IKSA 4YUWA 2R8BA 3IPYA 5KYGA 4M9QA 3Q12A 1H3NA 3RDPA 4TL3A 4GPBA 1XCLA 1TIPA 4YCDA 3P5BA 3T94A 2W83A 3BFJA 2X1HA 3W06A 4US2R 2VF2A 1G66A 5AUNB 4X8OA 4PZCA 5TPZA 3E7PA 1YKGA 3OF5A 4HN2A 3GDFA 1ZK4A 1EQAA 4UM8B 3WIVA 4U7HA 3T6KA 1PJ2A 2BFMA 3B3AA 4DMLA 1A3CA 4ZALA 1VKOA 4ZAVA 3TUIC 4TZKA 1JE1A 4JYPA 2Q1WA 3AKCA 3FOFC 3QFTA 2PAFA 5FTNA 3EA5A 3D64A 1OLXB 2FFBA 2CT8A 2BIFA 1ZGJA 3R7WB 2G3YA 3LP6A 4DPLA 4PO1A 2FEOA 5K4AA 4I9NA 2XT9A 2C9OA 3MIIA 5CYGA 5AVZA 4IARA 3MTJA 1CF4A 3AB7A 1UJ4A 2H2IA 4JQ6A 1PNOA 1G3UA 1Q16A 1Y1TA 3BWVA 3NHUA 4X20B 1AUVA 5PNTA 2P9HA 2O2DA 1TOAA 3GCZA 3A7DA 2AOVA 4KC0A 3QLVC 1SGWA 5EUCA 2G25A 2ZI6A 4YAGA 4EWLA 3TQTA 1U5BA 2Q62A 5DHRA 2C31A 5I3CA 5K0ZA 1RC1A 2F8MA 1HFKA 1IEXA 1XRRA 1K08A 2AOTA 5KTRA 3RKSA 4TZ6A 3IBYA 2QIPA 1FDVA 2BMVA 2D8MA 1N8NA 2J32A 4O4HF 1O5TA 1X38A 1W46A 3V8QA 4CKWA 2IDJA 3IAUA 3IIMA 3JVVA 3RODA 3SDBA 4NCAA 3BFXA 4QDOA 4YJ2B 3V4OA 1R4ZA 3MYYA 2QRMA 4MW5A 4BDSA 3U1TA 1P61B 1EXDA 2GH1A 4RPLA 2ZRHA 3FR8A 1YS2X 4G1CA 4II3A 4QVIA 1R5JA 4QRIA 4QT0A 1QS0B 5I9TA 3R7NA 3AVTA 2QK4A 5BR2A 2CNDA 5CJ2A 3SE0A 3OBBA 3HH8A 3TQHA 5ICSA 2I20A 5TEWA 3TUJC 4AG5A 5A6SA 4BPRA 4MHSA 4RF4A 1M8GA 4OXKA 1G1MA 1ZD3A 1LD3A 1H2ZA 1H0HA 2ACWA 2XDYA 4MV6A 3EF3A 3UJHA 1YAJA 1ISPA 4F93B 4GF5A 2JJ2D 1UPTA 2P7IA 3T7AA 3WRYC 1Z29A 3OCVA 2LP4Y 2XKJE 3AF6A 2O8EA 2A5FA 4RPCA 1MHTA 2O9JA 5D00A 2OQIA 5GVRA 1W47A 3TNJA 3W2GA 3GLHE 3M34A 5K4HA 1P1KA 1RHKA 4JI0B 3OFVA 2C20A 1G8FA 2I2BA 1EP2B 4OP1A 1Z4LA 1OD6A 4O5OA 4MPPA 5EWLA 3WK7A 1R18A 1SWWA 3KOWA 2Q5OA 4Y2UA 1R10A 1SCUA 1RT9A 2C4WA 3DKIA 3Q87B 3QMMA 1AJEA 4GVLA 4P54A 5CA0A 5JYDA 4ALIA 4FYIA 1GPLA 1K6XA 4B33A 3EIUA 3TTXA 3IA2A 3SEFA 1U2DA 3HKDB 5DXJA 2F1KA 2V6FA 5JLJA 3FPGA 3BH7A 3OQIA 2OG1A 4JITA 1FFAA 3NEYA 3DE5X 4O2BF 4B7ZA 2I6UA 2B8NA 2GF9A 2VQ6A 3AVWA 4YJFA 3PTLA 3DBRA 4IFIA 3OM0A 4LWZA 2XA9A 1PK9A 1B6TA 3WWOA 4Q47A 4RMHA 4OHWA 4FXPA 5LBUA 1M7BA 5C8VA 1S8JA 1OILA 2ZJOA 4NC3A 2XJ4A 4GR4A 1ZZEA 4HVTA 1LPOA 3WIEA 2LVBA 2RKBA 3H17A 5CD1A 1PEAA 4QNRA 1J2UA 5AIAA 2FWBA 5B57C 2MIIA 2OLKA 2RGDA 1DRKA 4XH9B 3KUXA 3J80A 3LTNC 3ZY4A 1E32A 1YI0A 1SXPA 3PJFA 3K09A 1QH0A 4MNTA 5J63A 4Q7LA 3A58B 4MGHA 4MVWA 5GM2A 1IVYA 4U6SA 2ETVA 4QU8A 1R0KA 1XZIA 3ZY3A 3BB4A 1L5MA 3L06A 4NVRA 7YASA 1XXHA 5HZHA 1JQEA 4KQXA 3H87A 3HHPA 4N0MA 3UM9A 1WXWA 4EMSA 4WFIA 4QYIB 2C8KA 1CF2O 5JASA 2J5KA 4M4SA 4CMKA 4N4WA 2QRJA 2HCFA 4R7ZA 3C70A 4I1YA 1UR5A 1GNPA 4B6PA 2XW6A 3GLFA 1HE5A 3VM6A 5HG0A 2WHPB 4FR5A 3VI4B 2HJGA 1GVNB 1LNSA 2WYIA 4I5IA 3W6UA 4AJNA 2J08A 2EGHA 4J91A 2GF0A 6NULA 1KFCB 1SVOA 1LI7A 1S9HA 3G17A 3C8HA 2OQVA 4I2NA 1IUPA 1GEEA 4YC7A 4REQA 2WWHA 2BP7B 4ZREA 4N6HA 2CMHA 1ZMOA 2GEFA 1BJTA 4F6CA 5KCMA 1TN5A 1CY8A 1TUEA 2X0IA 3HVUA 3L93A 3DR5A 4HN4B 5G40A 1U94A 3KB6A 5IDVA 1KK2A 1EIWA 4L22A 3DKRA 1KP3A 2QLMA 2HLPA 2Q27A 2JDID 5FBRB 3NYWA 3MGAA 4AJ1A 4MYDA 2NACA 2QVXX 1GQYA 3L7JA 4E30A 2VYVD 4D3DA 1REQA 4Z4IA 1QHNA 4EHBA 1HTBA 4DUYB 4U7DA 5BNTA 4XT1A 4U2FA 4IV8A 5AW9A 5EMMA 3NDPA 2VT4A 3CX8A 1E7QA 1T36A 2ZT6A 3KZCA 4JIGA 1IN7A 3JVUA 2ORWA 5ICFA 5JPDA 1S01A 1XNRB 2ZZNA 1ZGZA 4H16A 4DLTA 2GAAA 3E5RA 1OCEA 3QX7A 4CUZA 4B4VA 4EI9A 3CX3A 4Q19A 1B0AA 5CURA 3ZXUB 5DGIA 3WFIA 2CVPA 4ZHQA 1EVYA 3JQ6A 3VNRA 1ZAKA 4XX0A 3E4DA 3OTHA 5AJZA 5EJAA 1ANKA 3TIIA 2NSJA 5IDYA 4QIDA 1V5GA 2GZ3A 3N59A 4L9SA 3I9V1 4YASA 5KYXA 2BGWA 4KQ2A 5DIZA 1J8QA 4TKLA 4Z49A 1RPAA 1XEFA 2GZHA 3DMFA 3VU3A 4IHKA 5HZMA 3FHTA 1NXPA 4NX2A 2Q5LA 1S1CA 4P81A 5D2CA 2CFOA 2IEIA 4GT1A 2HZBA 1DLJA 4YGYA 1YL7A 2CVFA 2L82A 3EVAA 4HQKA 2WSYB 3ZIDA 4E13A 3U7IA 2VQFB 1QFJA 1T0JB 1V37A 3HFGA 1I9CA 1OH5A 2EJUA 3VJMA 4O4JA 2ECOA 1NF3A 1VLQA 1XROA 5C32A 1GHTA 1R8SA 1EFHA 2IF2A 4B3DA 4GXQA 4L15A 1KU0A 2R4QA 4DXAA 2PWBA 3FDXA 4FXOA 4HZUB 1VSBA 4OQYA 1WXGA 2EDAA 4EB6B 1NUUA 2RHTA 1UBRS 1I80A 4N48A 3GXOA 3S2SA 4KQ1A 4IDBA 1Z8FA 3L82B 3NEPX 2DQ4A 4RW0A 3PFCA 3X43A 3RJ5A 2QRVB 5L3VA 5JJLA 2C7GA 1CWUA 3ASVA 3BMOB 5DLYA 1WW3A 5AWFC 2O14A 4BIIA 4GMGA 3PUZA 4C7JA 3THWB 2W2NA 5A0FA 1DB3A 1XNHA 3U7QA 3VPCA 4B32A 4WLFA 3DAOA 3IP6A 4BNZA 4JUDX 5IASA 2O2IA 1CRZA 5ALPA 3TQOA 4RHXA 2DSNA 1X1QA 3KQSA 3EBLA 3LC2O 3O1IC 1YZHA 4Q4AB 4EITA 1IJEA 4ALJA 4O2AA 1BMDA 2WT4A 2V97A 4KPUB 3NIWA 3L7CA 4JBYA 1DBVO 1QB8A 5C1DA 1NOJA 2YWGA 1PWYE 3MYRA 5T7BA 3OH8A 2OV4A 4LDPA 4Q1CA 2G67A 2ZT5A 4YAJA 5EJ2A 3S3BB 1Q7EA 1C1DA 3WWCA 5A4KA 1S8OA 2H85A 3KR1A 3C8ZA 3H1PA 2VTVA 1MJGM 4NS1A 4D6YA 3L4KA 2W2VA 2UUCB 2VBCA 3A3OA 3CR3C 4I4TF 2Z2XA 1SU6A 5JNRA 1I1NA 2C78A 4HDKB 4XOIA 1J0AA 1ZWLA 5TQVA 1AS3A 2Y9PB 3GP5A 3G88A 3FCEA 5EFZA 1LBTA 2DPGA 3I1IA 4X60A 4OYLA 1OLOA 1OKKD 1JG2A 2CLMB 2UYOA 4Y1RA 1I2CA 2XBUA 2DQZA 4URVR 1PEDA 3PE3A 2CK3A 5TY0A 5JC8A 1Y82A 1U9JA 2VNAA 2OO7A 4J7AA 2MMGA 2ORVA 4N5LA 3DZJA 2HU7A 3QA3E 4D6PA 1XP5A 2XMZA 2WUVA 2VUUA 3VAAA 4U0JA 3VPAA 1BCSA 2AI3A 1JTVA 3DOIA 3PYMA 3ROGA 3ZU6A 4WH0A 5KJ6A 4IJQA 2Y04A 3KSZO 3R0ZA 5AICA 2D4HA 2ZBEA 3AUXA 1YTUA 3AK4A 5BW8A 3LHIA 1A9RA 3HXTA 2YN2A 5CM8B 3OFJA 3AQIA 4G0WA 1M9NA 3AXSA 3UT0A 5FV4A 4NK4A 2IGTA 3L0OA 1C0KA 4MUEA 2VT7A 3DQPA 3SF8B 1OWPA 4BQNA 1X8KA 3VC3A 2QUIA 1UXGA 1Z08A 3K1AB 4IMRA 3T54A 2G9RA 3WSTA 3P9ZA 1OXBB 3ZGYA 3NM5A 1TKCA 2PYIA 5ED0A 5H83A 1R7RA 3PI6A 4EATA 3I5XA 3IAM1 4DBVO 1E1RA 3WMXA 4NBTA 3CRVA 4C4OA 4NZMA 3UOAB 3PE6A 3AKYA 3KKLA 1QYWA 3A2NA 4IZ6A 3F3MA 1NM5C 3OAAD 1E69A 3WIOA 3AJRA 3WWEA 1G16A 1UQRA 4BC1A 3U1VA 5H2MA 2V96A 3H5LA 2PR2A 4DJ5X 1H4TA 1G20A 2AFHE 1M1ZA 1RPNA 2NNWB 2VKTA 5FL7D 3UWPA 1S4MA 3HWSA 3LPDA 4LW8A 2QAGA 4ZT5A 1IZYA 2C1XA 1RXUA 3JYOA 4GOJA 1ORTA 2GILA 1M1XB 4IZIA 5EESA 4WEOA 2VYND 3UWKA 4ZOCA 3ZCTA 1ZUIA 4IUBS 3BGSA 5FLEX 1Z7YA 3CEJA 1DNPA 5LWQA 4JVLA 3HLTA 2DHEA 4Y2RA 2D3TA 4IB4A 1GTVA 5CLQA 2C29D 1EVQA 2ZVPX 3C6XA 1ECCA 4LGYA 4WFKA 3A36A 4O4HB 3SKVA 3GUHA 4MUJA 2DJIA 3N2EA 2Y76A 4QBFA 2X2OA 4OXQA 3ZVLA 5A0VA 4HHEA 1CVRA 2CNBA 1BX3A 1PLLA 4U9HS 1GGHA 1DBWA 2HRQA 3AUSA 3OU2A 4P1ZA 1LEHA 3V8RA 1W36B 4YAKA 1QPGA 5I7RA 5KKNB 1JEJA 4ZYUA 3M4JA 2QL9A 4RGYA 5EWJA 3NRCA 4R01A 3N5KA 4Z9FA 3UG9A 1E0DA 1C4OA 4PW0A 5G0WA 2JH3A 1KI6A 1TQHA 2Q50A 1UMCA 1EUCA 3NJ4A 1MENA 4JBNA 3SM9A 3B2NA 3FNQA 5EVJA 2DHDA 1SVSA 4KXMA 3BEDA 5AOCA 1UUFA 1NXTA 4JOQA 3N3AC 3G85A 3MTDA 3C1TA 4LDAA 3BKWA 3SJ7A 3IHTA 4HR7A 4H4DA 3GJ6A 3ZW7A 3O91A 2IUUA 3CMCO 2X8AA 1DCKA 2YZGA 1TK9A 3SYTA 1U3GA 2ZIFA 2FWNA 1E0PA 3MBIA 1IE3A 1IN5A 4C4ZA 2A6PA 4AJPA 2HR1A 4B3MB 1MVNA 1A04A 2R5WA 3UAVA 2DR2A 1FTNA 1JG6A 3G9TA 4YTEA 2FEKA 2RGNA 3ZWPA 5EKTA 3WYCA 2R6FA 4LJKA 2OBYA 4B7XA 1XTUA 1SHKA 3EZ2A 1TYCA 2BRDA 1W94A 3U7RA 1IYZA 4Q9JA 1W35A 1JHQA 4NG4A 3U3KA 4CDGA 1GGNA 2JAPA 2K7ZA 2WOOA 2O1XA 1L6RA 1CUYA 2SBTA 3DXFA 3CZQA 3E0XA 1PLKA 3REGA 3BHMA 1W36D 2PWAA 1L7PA 1WW2A 1YVRA 1AB6A 1AN0A 2ZAGA 3N6RA 2JEYA 3NIBA 4HLUC 3MFQA 4M8LA 4OFBA 1CJVC 1YU9A 2HHJA 2IXFA 1AUQA 4DRXA 5EXTA 1WEKA 1Y1SA 1XKXA 2EKLA 2OEPA 4M0EA 4O2BB 1E6EA 1SBQA 1BJRE 2IHYA 5I7EA 2OCYC 4KR6A 2FV8A 3KAQA 4H7IA 4IOJA 3OTQA 2H4WA 4ND7A 3KKKA 5EJ4A 1K6IA 3M81A 1VL2A 1ST2A 4YRFA 5TQ0B 1N7IA 4RD6A 3NZEA 4RY9A 4KVZA 4QGGA 1UIRA 4U2EA 2CVOA 2IC5A 3HN2A 1U04A 3DFKA 2LCIA 4JKYA 5JEDA 4W1PA 1YB4A 2Q5IA 4L9RA 4CMGA 1YS4A 1Y8QB 2QQEA 1A82A 3R8CA 2IHNA 1PV4A 5D7BA 1V25A 5EQJB 1CX9B 2Z6UA 4X7PA 1Z0FA 1QP8A 2DPYA 3SDSA 1ZUWA 4GX1A 3RVKA 3VU8A 4EO7A 3AP1A 1AQJA 2Q2VA 3K9GA 4DREA 5CIQA 5EA2A 2OZLA 1DG1G 2JGKA 1KOGA 3DVQX 2VAWA 1WKCA 2A14A 2C2WA 3G59A 4W7HA 3GLRA 3NI2A 2B0JA 4ZT4A 3N0TA 2OHJA 1O96A 1DWOA 1ZN7A 1N2OA 2HDHA 3D6JA 2GK4A 3FAZA 1H05A 4RLSA 3RC9A 5AVSA 1KEEA 1BRTA 3L7YA 1K8QA 5BW6B 5I6DA 1GYPA 2YOFA 3W8FA 1RJGA 4DCJA 1MABB 4KB5A 3W0LB 4P7JA 1KKLA 3QMPA 4Z6KA 1XDZA 2NTEA 1P19A 1PR2A 3HY4A 3QVXA 4AF6A 4FSHA 3K31A 4TN1A 1M2EA 5JSYA 1S1MA 3PI7A 2JGDA 4PNHA 2E4XA 1I13A 5JYEA 3R6GA 5C3UA 2BCJQ 3REFA 2CXUA 2VT3A 4IO1A 4HX2A 1CZHA 4K87A 5ALSA 4ER7A 1H6DA 1P0MA 3BF8A 1CNEA 3RT9A 5T64A 1RBZA 1G5PA 2LV8A 2XCLA 1WP4A 5BSTA 4NENB 2IZOA 3EWNA 1F3OA 1ZVJA 2SKDA 3KQVA 4F96A 2H4JA 5MHTA 2A94A 4O1HA 1GKLA 9LDBA 5KBYA 4QBKA 3C2QA 3FLEA 3B9RA 3V2YA 1PWXA 5KVVA 4PZLA 5B3LA 3OLCX 3VNUA 1N8TA 2VJNA 4JU9A 4HLQB 2CF5A 1G5TA 3OAXA 1C30B 4RK4A 1Q1QA 1GRQA 1SY7A 2WIDA 3PNQA 2WVGA 3GHHA 4L0CA 1PKXA 3AFNA 1M2OB 4UXIA 5I9IA 1H22A 2Z56A 4UC0A 4DRYA 1P4GA 4K9PA 4OHBA 3DHWC 4HBZA 3RGGA 4DGQA 1IHYA 2BE7A 5J4LA 1A5ZA 1YS1X 2FEWB 4UUAA 2IUEA 1PS9A 2ODPA 5KYWB 2GD0A 3B7WA 2QMQA 4QOGA 3TLEA 4D0LB 1EFAA 1I4TD 2QTWB 5AW3A 3VYWA 2DQYA 1XCOA 4QICA 5F2KA 3U81A 4BUJA 3T3PB 3W4JA 2XB4A 1IB6A 5KX5F 4UU7A 2IH5A 2NSLA 3QLUA 3MA0A 2GM3A 3VO1A 2FN7A 2JHPA 3SHTA 1FYWA 2PUTA 1E12A 1ATZA 2FEMA 2VRWA 2ZSFA 3V2UA 3JSXA 1D0IA 2GVNA 5JQGF 2RG1A 1DGQA 4V24A 1MXHA 1A9YA 2EVWX 2QTHA 3RS9A 4EH1A 4NECA 4DSOA 1W87A 3RARA 1KI2A 4RZIA 3OTWA 2H4ZA 4RYDA 2FMIA 3TQFA 1IY0A 2ZBUA 4M0CA 1MF7A 1JIUA 3IPXA 1O94C 4R1UA 3UKOA 4F1WA 3D5TA 4TVOA 1ZVQA 2QN9A 3A9CA 3AB3A 4J0IA 9MHTA 1VBKA 4Z4HA 3IP7A 1ZSNA 1U7XA 2BEWB 3M0EA 4TVSA 3BD7A 4LJAA 5IAGA 3Q3CA 1LV7A 2WSBA 2I34A 4OJMX 3TPFA 4AZVA 2POQX 1T5DX 4BNKA 3I58A 3NGMA 1XBTA 4EW1A 4IRUB 4PANA 4YMVA 1XZFA 1PDOA 5J5AA 2V7QD 5FA5A 1J7JA 1X7HA 2W6CX 4YAUA 4A1OA 4DW8A 5BSHA 3HU1A 3I6ZA 1XKLA 4UJ3A 4RDHA 4N47A 2GJKA 1U02A 3HXKA 1D2GA 2OQRA 1J8FA 3QXHA 1K7SN 4CMIB 4WPGA 3N7TA 4AS2A 1KSJA 2YQ5A 4BLPA 4O8ZA 4ETIA 1K2WA 1G59A 1Y1PA 2BFBB 3QKRA 4FMDF 2P2LA 4LTDA 2YDVA 2JHAA 3VR2D 4CV3A 3IEMA 3KIPA 1N4AA 2EBUA 5KYUA 4C20A 1WEHA 3Q3EA 3ABOB 1LPAB 4AZ3B 3WFJA 4Z7QB 4PZZA 5KNBA 3KKEA 2ICAA 2P77A 4YUYA 2D1FA 3S1AA 5FTJA 3PGMA 4JT8A 2IYPA 5FJJA 5FJGA 3KP1A 3WLMA 1K8RA 3ODUA 7GPBA 2ZYVX 4DR5B 2P9YA 3V8NA 5CXUA 1Z9BA 1HNNA 2Q6TA 1NT4A 3A4TA 4XDZA 5G1OA 5TMEA 3VISA 3VPXA 5BYAA 3AJ9A 4IF4A 1PG2A 5LZ2A 1JV7A 2WFLA 5AHRA 4I4TB 4K6GA 2EQAA 2XE4A 1CS0B 3UN1A 3L0IB 5FEUA 1USWA 1DAEA 2ONZA 5BYJA 1NQVA 4J2OA 1T29A 2C4VA 5AKLA 4JLNA 1X7YB 2FWPA 3LQKA 4UEQA 4FK8A 3RVPA 2YJTD 1VQ1A 1Y5MA 3AL2A 5BRAA 4PX3A 3GLVA 4RD0A 4A27A 4YT4A 1NBWB 2J9ZB 3NO4A 4A82A 1SOAA 3IBTA 3QM1A 1KVSA 1J0BA 2C77A 1JMYA 1NFFA 2XYRA 1T5HX 1I2MA 4R1TA 2Z9DA 1P29A 4GNRA 2D5LA 2XECA 3F67A 4TS1A 4BNDB 1B8UA 2IOHA 4AMZA 1E2EA 1GG2A 3DLPX 3T7KA 3GD7A 2YY6A 5AXAA 4LHYA 4W8GA 1UAGA 3MRXA 1JNYA 2QMOA 4I9FA 3L49A 4F4FA 3F6RA 2JAGA 1DX4A 4BOYA 3MTBA 5DSZA 1XTPA 3DMDA 4PSCA 3VNQA 4M9XA 4TYNA 1JAXA 2WD9A 2J45A 5JLAA 2C8VA 4OYRA 3ZI0A 2DYKA 4LJ5A 2PIAA 1N34B 2I03A 2YWDA 4DV6B 3U44B 1S53A 3OKCA 4WXEA 1PQ4A 2FXIA 4JYMA 4NTZA 4Y6GB 3P9PA 2Q1XA 4MRPA 5BV8A 3VDMA 5FUWA 4NJMA 5G4KB 3PFNA 2N0SA 3A3PA 3AVPA 3QJYA 1MB9A 4FZRA 3WNZA 4A5SA 1GZHB 2H06A 2P8JA 3WS7A 4OU5A 4DAOA 2ZCJA 2WR8A 3PHJA 4RJIA 4UUPA 4CM5A 5ALGA 1KAOA 3MJHA 3CNQS 4BXOB 4HUTA 5J2UA 1N77A 1QOQB 1H2HA 1X8XA 5JRDS 1GXSA 3ELUA 1U99A 4GKJB 4EGFA 3I04M 5A8EA 3AY3A 2Q2WA 3A1NA 3GW8A 1WY5A 4TRMA 5LFAA 1XWIA 4J1SA 1R0LA 4NFLA 1GPWB 3MEQA 4IJKA 1AF4A 3R3WA 4FHGA 4X3CA 1ODKA 2H07A 4XGQA 3O7WA 1T1GA 2BEVA 3X3HA 5C7OO 1F17A 4XCVA 2NU9B 3QYJA 2EX1A 3PQEA 2GSDA 1XMSA 3P52A 1AZWA 2FMHA 3NHZA 3L4EA 5MF6A 2EERA 4P0QB 4FP9A 1RQLA 2AOTB 1NAHA 4EJFA 1G4HA 1M7GA 1WABA 2BGNA 4PSUA 4F4IA 1L7MA 3WQRA 1DCTA 3ENWA 5AJYA 2VRCA 1SXQA 2DFVA 4J3NA 1QGUA 4I66A 1FFXA 2B4AA 4I1SA 1U1CA 3RHTA 1IZ9A 3GEMA 3MCWA 5DBHX 2ZYDA 2XH8A 1NJFA 2DKOA 3DMPA 1JRLA 3HYCA 2J3HA 3IAHA 2G82A 2F1HA 2NO1A 2R1UA 5D5PA 4AJ4A 3IUEA 2RKOA 4OM8A 5CVUA 5ALMA 5JALA 1RQNA 1UJMA 1TYBE 1YB2A 3B7GA 4BMYA 3K70D 5E6SB 5IAAA 5BSFA 5A6SB 5EE3A 2RAVA 4LBZA 5EJ9A 3Q8MA 2FDCA 2IU0A 4QA9A 4X24A 4LZZA 2BW0A 4IOLA 4LHWA 2P4SA 4S2EA 3TDNA 3NETA 1PFQA 1NWCA 5LP6C 1EA5A 1I5OA 4KXUA 1WU7A 3MS2A 4A26A 5EMKA 2OK7A 3TLYA 5AKYA 3M6IA 3IMFA 2Y4NA 4Y9SA 3BCUA 3C3AA 4EIYA 1QVZA 1CP2A 2ZI3A 4LMPA 3TINA 3GRAA 5JAHA 2XSZA 5H02A 4EB3A 2WILA 4C78A 1QG4A 1P1CA 3AIMA 3U49A 2H2FA 4YP1A 4ED9A 2BRUC 3D6AA 2YICA 4IGIA 2LIPA 1SCUB 4I4IA 3K8QA 3ZI4A 5SY4A 3GRCA 3G8BA 2IP1A 2NYAA 4QODA 5FD8A 1FE8A 1TT5A 1U7HA 3ADKA 3GJTA 3L7DA 4OHUA 4PYIA 4CEHA 3W1VA 1EINA 1WD5A 4G07A 4RADA 1BVRA 1CNFA 2D0DA 4ID9A 1N6OA 2J6BA 4JQCA 4K81B 3HYNA 3S70A 3NG1A 3ASUA 2BGJA 4N4YB 4KFUA 3IT1A 1Y4AE 1WV1A 2VH2A 4YJFB 5B37A 1DQNA 3FHLA 2O8FA 1W1UA 2XYGA 1SA0A 3A9VA 3Q1LA 4YCCA 3I9LA 2CEAA 3HJBA 1D2HA 3IALA 3MRTA 2XRFA 1IPFA 3AWDA 1TK2A 3BMCA 4NAUA 1UFQA 3SS9X 1QTIA 3DBHA 4ARUA 5AHZA 3BWMA 4Q3DA 2VP0A 3O74A 1X1RA 1BD3A 4TVKA 3T5BA 4IIEA 4LQDA 3MQFA 5DYIA 3SR4A 2OO3A 1QK4A 1CHNA 1C0PA 4HNTA 1O0SA 1YVUA 1VPVA 2YXDA 4V3BA 2X13A 3LH5A 4UATA 1JJ7A 5AK5A 2A7QA 3WLTA 5CDFE 4CG2A 1UXOA 3WDLA 4AROA 1N1GA 2GAOA 1OZFA 1IBRA 4I46A 2BC9A 1XXHB 2NTYC 4CFZA 1UBSB 2IT1A 4Q3NA 3UIEA 1SQ5A 3K72B 2HHLA 2HTFA 1TD1A 3C87A 3HDTA 4CT4B 4DXDA 2Z6AA 3LS2A 3HRHA 3UJ9A 1HQDA 3T9CA 5DYYA 3VYUB 1C0LA 1DAPA 3M3HA 1RCFA 1E0JA 2D2XA 4MCJA 4PXYA 1NV8A 2QXTA 1DAOA 2GKOA 2WF5A 2ZJ7A 3V7YA 2RI6A 3GLFB 2FSVA 1QYRA 1MNAA 2VVTA 1N36B 5T57A 1BHSA 2A9OA 3GLGB 3H5AA 3CNBA 3LHSA 5JANA 4KFTA 3B1KA 4H7DA 4QOJA 5HKAA 4GQIA 4QHTA 3L5KA 1VE9A 5DGTA 4Q82A 5ILQA 1TCBA 3N8NA 4EVRA 3EFHA 3NIDB 3ZVKA 3E0QA 1BX0A 1L5QA 1OT5A 2A9KA 3TD6A 3LPMA 5JS7A 2HLNA 5CB0A 1NN1A 4E4TA 2F4VB 1A8SA 2I8AA 4FLMA 3WBKA 4GPD1 3VZPA 5JHHB 2I22A 2O7RA 3ZBPA 3VX3A 1DJMA 3ZCXA 2WLTA 1J2RA 1J33A 2GPTA 2HB6A 3DKVA 1PKEA 1W0CA 4DMRA 2OV2A 4Z4GA 3FDZA 5DP2A 2PTHA 2IDZA 4ZYXA 3L7NA 2QU7A 3IEUA 4G4GA 4UNQA 3SNHA 2B5OA 2R1TB 4OGWA 5TQ2B 2GZMA 1HWYA 2P5UA 3R3ZA 3DV0A 1B2LA 4PYOA 4EX6A 4RMIA 2FNAA 1R0WA 3JWEA 3OT5A 1EFRA 3R3SA 4ZAWA 3ZUGA 5AVTA 1BMQA 1JI0A 3B36A 4QUAA 1MB4A 1N3LA 5CP8A