5TGZA

Crystal structure of the human cannabinoid receptor cb1
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
439
structure length
439
Chain Sequence
GGRGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLAAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDKTYLMFWIGVVSVLLLFIVYAYMYILWKAHSHAVAKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSWEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAIPDQARMDIELAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cannabinoid receptor 1,Flavodoxin,Cannabinoid receptor 1
publication title Crystal Structure of the Human Cannabinoid Receptor CB1.
pubmed doi rcsb
source organism Homo sapiens
total genus 167
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 5tgzA01
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5tgzA02
5LVAA 5H2IA 1QR2A 2V9CA 5AHZA 3X3BA 4TL3A 3TE7A 3HANA 2I1XA 4NC3A 1WSBA 4AMJA 2Y01A 1VJMA 2D5IA 4LTDA 2YCXA 5H2HA 3KAPA 3RZEA 1BRDA 2X2PA 4H2DA 1E0PA 2Q9UA 1E12A 4BV0A 3REYA 1QM8A 5J7AA 3LT5A 4J8PA 3OE6A 4BUOA 3QDCA 2BZSA 1F4PA 2PEDA 3KEGA 4QODA 5G2AA 3K1YA 4G70B 2YDOA 1FTGA 4LDLA 2FAXA 2GSWA 3PDSA 4QRYA 3AM6A 1CWQA 4DY4A 1GUEA 4DKLA 4PU0A 1AKUA 4XDHA 2Y03A 5A44A 4IARA 1S52A 3U7RA 1Q5IA 1WSWA 5G2DA 1H69A 3W79A 2BN4A 4X32A 5B6ZA 4FGKA 1XI2A 2Z73A 2MWMA 3S8FB 4Y9UA 5F51A 2QX6A 5LJLA 5JROA 4G72B 5EA2A 2F1OA 2WC1A 4C14A 5G28A 5LLDA 3X3CA 4FGLA 3EMLA 1YOBA 3ZHOA 3NLLA 4YAWA 3D4SA 4HEQA 1X77A 2KQUA 1V4BA 3QE2A 2KLBA 4LDEA 3HA2A 1AZLA 1QKPA 2EI4A 1KG9A 1ZWKA 4A4MA 4DIKA 3LCMA 1H2SA 2X2OA 1AKTA 1D4AA 4BMOB 5AX1A 2R4RA 1FX1A 3GFSA 3OX2A 2QWXA 5B6XA 1BM1A 2WJLA 4D02A 1R2NA 3UTVA 1DZEA 3HASA 2R97A 3B6MA 2NTWA 2HPYA 3N3AC 3S3BB 2W5UA 2ZZLA 5F12A 2B3DA 3QJUB 3AYNA 4MD1A 5B35A 3UTWA 5ETZA 2BMVA 2I35A 1S54A 2FX2A 1YKGA 1GG5A 3S3DB 3PWHA 1IXFA 3OE0A 3P0GA 4ICIA 1L9HA 3VVKA 5AWZA 2QPDB 2HNAA 3L9WA 4PTZA 3NHYA 3B6JA 1RCFA 1YCFA 3QFRA 1XYVA 1MGYA 3DDLA 1SG0A 3SVLA 1VMEA 3HLYA 5A4KA 1VGOA 1PXSA 4X1HA 1QHJA 1U19A 3HAPA 1HZXA 5EN0A 4IB4A 5H2KA 3OAXA 1DXQA 3B6IA 1FLNA 2X72A 1BRRA 2I21A 5FUQA 4GP4B 5B6WA 1C8SA 1YCHA 2OHIA 3UZCA 1TN5A 4DAJA 4GYCA 5H2LA 3F90A 1F50A 4OXXA 5G2CA 5JJNA 3O73A 5LMCA 4KNFA 2Z9DA 3OVMA 5JJJA 1C7EA 3S8GB 3CODA 1S8JA 4C76A 1J9GA 4G7SB 4LTMA 3FW1A 3OWXA 4LA4A 4C0XA 5AHYA 3QJRB 4PTYA 1YRHA 4N4WA 3NHFA 3QBKA 4JQ6A 2RG1A 1S51A 1XMEB 3NS0A 2AT9A 1NNI1 3NHSA 1BVYF 1XYYA 3F6RA 1Q5JA 4Y9HA 4XT3A 4XDGA 4XTLA 5LBTA 1R84A 2KS9A 3C9MA 4J4QA 1T5BA 1L0MA 3W7AA 4ESEA 5BR2A 2F95A 5H2PA 4DJHA 1RLJA 4HYJA 5DHGA 3UXHA 2KSYA 5F8UA 5B3KA 3NY8A 3UG9A 4N4YB 4YAOA 5H2MA 4FPDA 3RFMA 1QRDA 1FBBA 4FAAB 2OHHA 4QOJA 2I20A 3OX1A 3NY9A 3S2YA 3QAPA 1KBOA 4FX2A 3FVWA 1PXRA 1JA1A 2KSAA 4FA7B 4G7RB 1LN6A 1C8RA 5FX2A 4FGJA 3K20A 1P8UA 2Z98A 3EDOA 5B6YA 4GPOA 2G87A 2J4YA 3HARA 5NULA 1AKVA 3F6SA 4Y7CA 2YCWA 3QFCA 1H66A 2HNBA 4XXJA 5AZDA 3QBGA 3NFRA 3A7KA 2WJKA 1AKWA 2A5LA 5ITEA 2MTBA 4QOEA 2QMYA 2YCYA 4NLLA 1BU5A 4MBSA 1D04A 1CZRA 1OBOA 1FLVA 3OE8A 1J9EA 2FZ5A 3B6KA 3HAQA 3ZEVA 1S53A 4BWBA 1B1CA 4U7FA 3SN6R 2QPEB 3FX2A 1QBGA 5TGZA 3VHZA 4GQIA 1TIKA 4OV0A 3NYAA 3QJSB 3COCA 3TEMA 4N82A 1C7FA 4DILA 5B34A 3ESZA 4QOHA 3PBLA 5ULLA 3QBLA 3EH4B 3QAKA 4K5YA 1X0SA 3VGAA 2Y02A 1FLDA 3D7NA 3HAOA 2QX8A 3ODUA 4X31A 2FOXA 3UXEA 4AMIA 3L9XA 2XOEA 2Y00A 3BVDB 3F2VA 3HR4A 3OE9A 3V2WA 4N6HA 1AG9A 3JSXA 2KSBA 1QHEA 4U7HA 1T0IA 4WW3A 1IW6A 4R81A 5B6VA 1M0KA 4WAVA 1M0MA 2V5VA 5FJGA 2R4SA 2FVXA 4ZVNA 1CZOA 4IAQA 1H68A 1OBVA 1XT6A 2L6XA 4GI5A 4PXKA 4GP5B 1EHKB 3S3CB 3QJQB 1S8LA 4XTOA 2Q62A 1JGJA 1M0LA 5LWEA 4L6RA 5AX0A 3NHUA 1P8HA 4GR9A 4ZVMA 4U7GA 3PQRA 4GRVA 5H2NA 5B3LA 1ZX1A 4JKVA 3O2NA 5JJEA 1AHNA 1CZHA 2LNLA 3CAPA 1KBQA 2AMJA 5F4BA 3W77A 1I1OA 4CETA 3NSBA 2FDXA 1IW9A 3P0RA 3R6WA 4GP8B 2QR2A 1CZLA 3UTXA 1AKRA 1FLAA 1KG8A 5G54A 2JAFA 3NHLA 2FZVA 1P8IA 1GU8A 3ABWA 4LAFA 5KKHA 1O0AA 3ZPRA 2FCRA 4ZVLA 3FJOA 4QI1A 4EJ4A 3NHWA 3W78A 4YAFA 3KAQA 2ARKA 4NULA 1C3WA 2ZIYA 5H2JA 4ZVKA 2JAGA 4FBZA 5H2OA 2N1MA 3U7IA 2Z9BA 2M6RA 3OJWA 4MQTA 3KJ6A 1D03A 1SQSA 3FNIA 3N39C 4M0CA 1DXOA 3WQJA 1F4ZA 4XTNA 3NHJA 4L35A 3DQBA 3NHKA 3UTYA 5NLLA 3ES9A 1JV6A 1X0I1 1RTTA 2V5UA 2RH1A 2VT4A 2R96A 3KLBA 1J9ZA 1UAZA 2ZKIA 3EH5B 1CZUA 2MT9A 2M3GA 3GFQA 2Z55A 4QOFA 1JV7A 1DX9A 3OWHA 5LJIA 4N9QA 1TLLA 1ZWLA 1CZNA 1JA0A 1X0K1 3QJTB 2BF4A 1JFPA 3G5MA 5EMNA 4UG2A 4F8YA 2M6SA 4HS4A 1QKOA 1AMOA 5A45A 3NHPA 2QX4A 5B0WA 3TZBA 3OJXA 3V2YA 3VW7A 4H6PA 1XJIA 4GBRA 2FLVA 3MBVA 4G71B 1AKQA 5FA6A 1KGBA 5EAIA 4HYXA 2ZFEA 4BEYA 5DHHA 5C1MA 3N3BC 4MD2A 1F88A 1BRXA 3RPEA 3ESYA 3ESXA 2BPOA 2MOKA 2Z9CA 4C0WA 3C9LA 2F93A 4YQEA 4BMPB 1TN0A 3QJVB 4G7QB 3VI0A 1AT9A 4KLYA 4XT1A 3UONA 4EIYA 3AYMA 2OHJA 5ITCA 4UHRA 4MQSA 4JR8A 2BRDA 4LDOA 5G53A 1FBKA 5G36A 2XODA 1FUEA 4QOIA 3PXOA 1GZMA 2QX9A 5BUCA 4YAUA 3NHRA 2OYSA 3GAMA 1YDGA 4BEZA 4BVNA 4Y9RA 3QBIA 1YCGA 4CF6A 1E5DA 5BR5A 4S24A 2QMZA 4EA3A 1UCQA 3ZPQA 3T45A 1J8QA 5DYSA 3VG9A 3OX3A 1AP9A 4PXFA 4HWLA 2YCZA 5B2NA 1CZKA 4LTNA 4QOGA 4YALA 3UZAA 5LBUA 2Y04A 1OFVA 1RLIA 3GFRA 1XIOA 2YDVA 4QIDA 6NULA 1FVXA 1PY6A 5A8EA 4N65A 2NTUA 1KMEA 2HPVA 3EH3B 3EYWA
chains in the Genus database with same CATH superfamily
3JQAD 1MT3A 2PD6A 3F71A 3A3PA 3BUSA 2B83A 1I4TD 1XDUA 4RM2A 3QX7A 4ZVOA 3ZLUA 1M7GA 4TUYF 1YXMA 3G2LA 4J9VA 1UJ2A 4WLVA 4ZYZA 4JXJA 4QGFA 5EWMA 1J8FA 5B6IA 4YRMA 2VTKA 4AMJA 2UYQA 1EE9A 3TNDA 3G82C 4R1QA 2O7NA 3BK7A 1XPJA 1UBJS 5JJLA 5AW2A 3AQ4A 4U2EA 1FS5A 3HGTA 3FGNA 3L7DA 1JJBA 1QK5A 1X9IA 2OAEA 3KX2A 4G5GA 4EP1A 1WL8A 5EQTA 4S05A 3G89A 4KREA 3RJ9A 1KQNA 4UTZA 1L7XA 4GKKB 3P0JA 5HDQA 3R9KA 1D0SA 1TB4A 4NVRA 4XWGA 4K9RA 3RC7A 5DHAA 4ZGGA 5HRCA 1Q0TA 2XUQA 2YV1A 3GCDA 4AF6A 3IUEA 1J24A 1QHGA 3GPCA 2XA1A 5U4QA 4TS3A 3WYGA 1Y9EA 1Z2NX 4MWBA 1C8BA 4EY7A 5JPDA 1JFVA 4EKDA 1JDVA 2YDOA 1OX4B 4ZO8A 1GNLA 1MQAA 3U44B 3EIWA 3UIEA 2JEYA 3WYFA 1K4YA 2YRWA 2DXIA 5C51B 1DCTA 2BGLA 1JTEA 4DY4A 3DF7A 5DXJA 4XDHA 4OJQA 4Q1DA 1W44A 3X1YA 1KI1A 3LAWA 4GYKA 4MW6A 4WKPA 4DBVO 2FZKA 1H69A 1TCBA 2X77A 3BK2A 4LCBA 3V2GA 1GUDA 1NHGA 1YTUA 4FHZA 2ZWMA 5TX7A 4YCLA 5C9ZA 4DMKA 3EG9B 5FKJA 5H80A 1VKZA 2BYTA 5TGDA 2D3TA 2GR9A 3CMMA 1DZ3A 3FIUA 3ZHRA 2ZJ7A 5A3RA 2VEOA 1AS2A 3HPQA 3V8MA 2XMRA 4DC1A 3AH8A 2AXQA 3TW0A 2AFVA 3AEQA 4KLCA 3WGMA 4DYHA 1FDUA 5K3FA 4WK0B 5F7XA 2XUPA 4J0IA 2JATA 4KR3A 1QGUA 3WSWA 4EFNA 3L1IA 1DTWA 4EAAA 2PPLA 3AV3A 4YMLA 4WJZA 5ALDA 5ANRB 5ITVA 4BLQA 1LBQA 2OAQ1 3EMLA 3VYRB 4W1QA 4NFHA 2C4HA 4XW2A 4Z51A 5EHXA 1LC3A 1GADO 2DY0A 4UAGA 3ZK9A 3O3CA 4MHSA 2XE4A 2QGZA 2O14A 4B3MB 2DBZA 2P27A 3RSFA 5JWRA 3IP7A 1S01A 4LDPA 5LZ5A 3LUHA 4JUBA 3ILYA 3U39A 4DCTA 3D7LA 4H1TA 3FFTA 1N5MA 2NQ8A 4MVJH 4M0MA 2GDZA 2GYYA 1ZD4A 3ZKWA 4BMNA 4DWWA 2GT1A 4ESVA 4IS2A 5FUWA 3TIVA 2VP6A 1T9GS 1YS9A 3ROEA 3RYCA 2Z09A 4A8TA 4CNBA 3WBFA 1T5SA 4ARIA 2J5RA 3W1VA 2NPOA 3ELYA 3RYFB 2PQ6A 4H60A 1NT4A 3GLSA 3BK1A 1FUYB 1IC6A 3ND5A 4P3YA 2IYSA 5TIIA 3BWYA 2NSHA 3T3HA 1X1BA 3WGOA 1UBRS 3QX8A 4ZOEA 4BECA 3D3NA 2FUG1 4GEKA 1QRTA 5AW3A 2CXNA 3ZOZA 3HG7A 5GONF 3DT6A 2MYUA 1OH7A 4BJ6A 5TF4A 2IC5A 2YJ6A 1M1UA 5U9CA 2ZZLA 5DEOA 2OC9A 3OURA 1UFVA 2YBEA 4DMHA 3JAMA 2QN2A 2BMVA 3UTWA 2QX7A 4EYQA 2E4WA 3BBLA 4QAQA 3SR3A 1W5TA 2QYOA 3EDMA 2AR9A 2ERXA 4EUEA 1YKGA 4TS9A 1H1LA 4ZRNA 3X1DA 1RYMA 1OZFA 2N3ZA 3C41J 5ED4A 2B99A 2HTFA 4M1MA 2QPDB 1PWHA 3TSYA 3ZIUA 1V7PC 2GHIA 2OBFA 3PJEA 1ILWA 5TQ2A 1IXRC 3BDAA 2FEXA 3B8HA 4OHBA 3A1VA 2O23A 1G6KA 4TQ9A 2OR3A 4CT5A 3QFRA 1F14A 3BMNA 3TGLA 1PQ4A 1NQVA 2P8JA 1YRQA 2NUTB 3EVTA 3KQQA 1TF2A 2FMKA 4N4AA 4JMPA 3W34A 5IVIA 3G13A 1CU1A 5K4HA 9MHTA 3CUVA 3LBFA 3WLAA 1UBGA 2EBUA 4HGPA 2IP2A 5CDFA 5HQ3A 1OFIA 4G4GA 1I7DA 2VUUA 3M6IA 3LDHA 5EXDA 1XFDA 1QOZA 1ZG3A 4G5SA 4UAJA 1BX1A 1WRBA 4IGKA 1VYUA 1VSTA 4NCXA 4DT1B 4EG0A 4URVR 5CB6A 1V5GA 4P3KA 1IBKB 5B1SA 4Y6OA 1QH0A 2J08A 3A4YA 5H2LA 4F5YA 2EBWA 2VDVE 3FD8A 1UWVA 3TCXB 5M7EA 2VJOA 4N48A 3AW8A 1H85A 3BXEA 3OESA 5LCXA 3T1NA 2PGDA 5DM2A 2P40A 3KXDA 1OHHA 2QXUA 3C3JA 3TW8A 3H9EO 1S8JA 1SVLA 1V39A 1CUHA 4OJNA 5ESRA 1OIVA 5TJ9A 1KZ9A 2HMAA 3RTEA 2P90A 3S4YA 3EGCA 5JSZA 2NAFA 4LXGA 1TADA 3I4FA 2ENUA 2Q1YA 4FLEA 1CP3A 2XF8A 2CE7A 4DNFA 1BHO1 5FP0A 1OVMA 4QXQA 1C50A 3Q7QA 1W76A 4NZZA 1Z8NA 3NS0A 2HRRA 5GWXA 2O8FA 1FP6A 3JRWA 3MWFA 4P7BA 4EARA 4EB8A 1CQIB 4XDGA 2J3QA 2GPYA 4B7AA 5L6MB 1PEKE 2DMRA 3ABIA 3C9MA 1DWUA 3FKSD 1ENPA 1T5BA 1G8AA 1XZNA 4PG5A 5LQNA 3L0BA 1GN9A 1HV8A 5FTKA 2XUKA 4CN9A 4M46A 3RCBA 2FA9A 3WOHA 3DC7A 3UMVA 1G6HA 2XECA 2YCBA 5B55A 5JY1A 1H2AS 1I14A 4DSNA 1Y82A 3IAM6 3AHHA 3I32A 3GUCA 2Q4TA 3VPAA 3C8UA 3OLCX 4L5JA 4KVZA 4R2LA 5KPJA 3IEVA 1NBHA 2WUGA 3PI6A 1XZAA 3IMCA 2RCNA 4JFAA 1Q84A 3C5HA 4OMFG 3H4VA 5C1IA 3K32A 1EP1B 1O97C 2VWGA 3CX7A 4KDFA 3SZGA 4JX9A 2NPIA 3JVUA 3KTDA 1R0YA 2HJGA 3DA8A 3V1YA 3PA6A 3R20A 3L8YA 5JRJA 4K0KB 5LOVF 2WZQA 4YXWA 3EW9A 4LZWA 3K20A 2Z98A 4YI5A 1T3ZA 3M3HA 1E5LA 3BD9A 1JQKA 1QYCA 1UM9B 4LQ4A 1Q17A 3B9PA 1ZD3A 4D5GA 2VUSA 4ALIA 4I4TA 2ZZKA 2R6DA 4H6XA 2A7XA 1W73A 2R6FA 1H4TA 5ARCA 4PQEA 3ZJUA 3EPHA 3QBGA 3DBLB 3DWGA 3MRVA 1F5SA 2F6RA 3DNMA 2Q2VA 1V5WA 4WT7A 1IBMB 3VISA 2B7CA 3ANSA 3FXAA 3OPYI 5U1PA 3RSLA 4AD8A 1I94B 1EVEA 1O9GA 3EFEA 5C1OA 1N5DA 4MBSA 3DONA 3VU0A 4R7ZA 4X61A 2LWIA 3ORSA 3U7GA 3GJ4A 3DMHA 3MWYW 2NVUB 6ADHA 1D04A 4WNAA 3MTEA 5K0SA 5KTSA 3WJ1A 2CD7A 4ND8B 4KV7A 3NH6A 2J9ZB 2XCQA 3C5VA 2QJTA 2NXEA 1JQDA 3IUPA 1LH0A 3K9CA 1KFJB 1SBIA 4P54A 1X3LA 4XEUA 2PMDA 1TTQB 4FONA 4UTOA 2FPUA 3ILXA 3D0QA 1E8MA 1I3NA 1KSHA 3GB9A 5AK0A 4IBOA 4RK6A 3L7BA 2BJVA 4D9CA 2GM4A 1NXWA 3C6KA 3FLMA 5WRFA 4BFCA 1EJ0A 4HLCA 3CKMA 2V3CC 5CT5A 1ZVMA 1VGVA 4CG1A 1PWEA 3DE7X 5JCOA 2QOEA 1HDGO 1LNSA 5CGZA 5B34A 1A8UA 4KMOA 4QTXA 4MI9A 3UAXA 2OQIA 4X94A 1P2UA 2O8CA 1IZZA 1YB1A 5KQGA 1JHDA 1UBFA 3T4EA 1Q0RA 4PS1A 2ID4A 3M33A 3MCVA 4K9PA 2G70A 5F64A 1F51E 3OLXA 5JBNA 1Y8AA 3VC7A 1XLTC 2RDMA 2QW8A 2N0SA 5HRAA 1N8SA 2JLQA 2XOEA 4QDUA 1FDRA 3EJ6A 2WFAA 1TUGA 4C01A 2RH5A 1HDZA 1VBFA 4OB7A 3UMGA 4YRKA 4B3FX 2FK7A 2R2GA 1RBMA 5CX4A 2ZITA 4B6RA 3AVYA 3ZHZA 4BMVA 4IIGA 4R9RA 4ZO4A 1QC5A 2QUKA 1Q16A 3PEEA 1CWUA 1MIHA 4FT4A 4FKBA 3OIDA 3C5EA 1WF6A 4UU1A 4A0RA 4W5TA 1Z2CA 1PNQA 4WFIA 3SE7A 4XGIA 2QM8A 4IIHA 5JQGA 3U1VA 4AQ7A 1Z18A 1JHZA 2BKXA 1JH8A 2XD4A 3C3YA 3AHEA 4X6XA 4QFCA 1AQJA 1EUQA 2ZTVA 3I92A 3KSAC 3OTOB 2OXEA 4QUEA 5IT0A 4HYEA 2G28A 3OF2A 1V95A 1W94A 3LC7O 4JELA 3RSCA 4AWAA 1X2EA 3EXIB 1UQUA 3VR6D 5ER6A 4BLWA 4N5LA 5AX0A 3GJ0A 3N76A 4MP8A 3IBYA 1RJWA 3EH1A 2AVNA 4ZVMA 2WD7A 3ZU6A 3NDPA 4HQ6A 3C87A 3H1FA 5EESA 5KX5F 4YI3A 4H7EA 2VNAA 4LX8A 1VHTA 1XN4A 3R23A 2Z95A 5FA5A 3Q41A 3L4KA 1AHNA 3VO8A 1MW9X 1ZD8A 3QFFA 3BJEA 3U7FB 4NEQA 4MMXB 4DCCA 3GNSA 2HTEA 2FZLA 4O08A 3P9KA 3UJ8A 1N2EA 1P2FA 2ODNA 3CTMA 3LUJA 3AEZA 1NLUA 4ZANA 1L5MA 1SKAA 3NVKI 4B6PA 3HN6A 4IIEA 3SC3A 3LLCA 1ABEA 1MB3A 4YLYA 1P8IA 2N46A 1FXSA 4JQZA 4JNCA 1VL5A 1FP4B 3FJYA 3TLBA 1Q14A 2VZEA 4U63A 4W4TA 3BX1A 3UMSA 1O0AA 1P9LA 1XEXB 4JBLA 2WIDA 3HJTA 5EIXA 4CR8A 5G4KB 1PJSA 1UAAA 1VI6A 1Z62A 2YIMA 3F5MA 2IYVA 1ZR4A 4LYDA 2O4UX 4G5FA 3CN7A 4XD7D 3CFYA 1JFTA 4KI0A 3FR7A 4L02A 3L7YA 4NX2A 4RE5A 4WA7A 2Z0MA 1ZJ6A 1ZN9A 4RSGA 3MPUA 1EG7A 2P6PA 4I5IA 1CUEA 2IEDA 1HTWA 4BO7A 1KF0A 3I64A 1NYLA 1LLCA 2EBHX 5C80A 2JIOA 3M5CA 4IVPA 1ONBA 4FE7A 3NBZC 2JC3A 1RTTA 4MYDA 1IUOA 3UC5A 4X6UA 1X8KA 4KK4A 5CPFA 2MT9A 3LCRA 1Z3CA 4QOFA 3HB7A 5DXAA 3ESRA 5IBRA 5JWHA 4BCBA 1OKKD 2FXIA 1SKYE 5JYCA 3M7IA 3OJCA 5I9MA 3RIGA 3ZXSA 4QSMA 1K88A 1IATA 4Z1OA 1XELA 4XSGA 4ZJZA 1FBTA 4MW1A 4UG2A 1EQAA 1LI4A 1KEEB 1PR5A 4R2IA 3HCAA 1RRKA 3RM3A 1Z7BA 2ZLBA 3PQ7A 1XEWX 4C5CA 3CE9A 1P7YA 1XPRA 3QUBA 3G5LA 3UWKA 2HA6A 3JZFA 1KGDA 2FMFA 1Z68A 2VDQB 4Q9IA 4JJ7A 5DHTA 4M9XA 3CB4A 1HMYA 3EGOA 1XZQA 3I8XA 1DAKA 1Z13A 5E4TA 4K6CA 1J23A 4JEHA 1WLYA 3CNOA 4HTAA 3P9ZA 3CPHA 3CY6A 5CM2Z 4RC9A 5GY7A 1T2NA 3GUVA 4E5PA 3W2HA 2W8ZA 3N0XA 2AOTB 1QIDA 1T9CA 2HREA 2R6ZA 1DKRA 1E18A 3EDQA 3MIIA 4I50A 2AOVA 2BKVA 4R0NA 4EVQA 4KXVA 2BPOA 4YBRA 2L2QA 1QKIA 4YJGB 5E7IA 5LFAA 2B1RA 3WGLA 4GUAA 4H31A 1GL9B 1NFRA 2F1HA 4QARA 4RM3A 4TXNA 4UDYX 1AT9A 1FXWA 5EJ6A 2OHJA 1RRFA 3BERA 3FPAA 3DTYA 1RC8A 4IIUA 3CW2A 1G5TA 2M9MA 3EQ7A 1GZMA 2ISCA 2BFOA 1QFSA 3L79A 1WKBA 3FBWA 4QLBA 3U4QB 1O08A 2H07A 2HT6A 4DBLE 2LIVA 3C6ZA 3DPUA 1SUBA 1WE2A 2DHDA 1NWHA 1QKKA 3I2HA 3MINA 3NS7A 1T0JB 4TT8A 4ZI5A 2OYSA 3CF2A 4AROA 1NZFA 2B4RO 1Y1KE 4XIFA 4Q37A 2Q9AA 4A8JB 4M7PA 4EKYA 4H7FA 4CF6A 4UOZA 2QT9A 5I9SA 3F3KA 4NZPA 5DGHA 4KMRA 5EE5B 1GAXA 1MG5A 4IW3B 5IX8A 3K53A 4YC7A 1QPZA 4IDPA 4H6VA 1GDDA 4JSRA 2JBWA 3QENA 5BW6B 3OTGA 5FHQA 1XTRA 1B23P 5B2NA 1GJRA 2GYUA 1BD4A 3DAYA 1O2DA 3IXLA 4RZQA 4C07A 4GRDA 4LJ9A 3PGVA 4PC3A 4TSFA 1D4ZA 2HAEA 2PGXA 5AQ1A 2AKYA 1Z17A 1NXQA 1HFWA 2J3LA 2JJ2D 3ZWPA 2H63A 4EZEA 1OT5A 3HJNA 4V2IA 1OH5A 3ZXUB 4FD3A 1K4KA 2VDUE 1P0QA 1R1DA 1YDWA 3HJRA 3S7TA 2B0CA 2DQSA 1ZL2A 3O83A 1V37A 2G8NA 4M0LA 5KTNA 4JL5A 4GDMA 2FWRA 4RPKA 5DM1A 4HF7A 3LWNA 1P9WA 2H1LA 3PGXA 4RZ3A 1D09A 3ZDDA 2C4TA 2QLMA 3PEVA 3T9FA 3ZWKA 4IIJF 1GAWA 3C6BA 1UOQA 3HSYA 4X7RA 3T4XA 3G02A 3V9PA 1UP4A 3DMYA 3LLUA 3DOHA 2AWOA 2X1LA 3CNEA 1KYYA 4M76B 3GG2A 4W7HA 4YACA 4MDEA 5GM2A 3M70A 3OLVA 4PFJA 1WVGA 2YJ4A 4BKMA 3UT5B 1LS6A 4JS0A 3SFVA 3L3BA 1NR5A 5IHXA 5AOBA 1RM5A 1WF3A 4B1FA 1BMTA 2FCAA 1X7ZA 3OCVA 3WISA 1TECE 1BEUB 3MGBA 2PEDA 2ZBPA 2Q7OE 3JRNA 2R48A 3K0FA 4QDTA 4GL2A 4BX0A 4LHSA 5I7HA 4YCNA 5G2AA 4PLWA 5TY0A 5KVVA 2QTWB 3OZFA 3ZEAA 3BXPA 2FAXA 4E11A 2QF7A 2DT5A 2YNMC 1GUEA 1P4JA 4PU0A 3RYTC 1V45E 3OAAA 2PH1A 1E66A 3EZYA 4BNMA 2V4UA 5JI3E 1K63A 4CLHA 2HJHA 2VR1A 1B6TA 1BDBA 2ST1A 3SM9A 4EITA 1I9GA 1FRVA 4C6TB 2A9JA 2ODWA 3E22A 4GSKA 3K6KA 1GZ4A 2FHPA 4WESB 2XR1A 3VI3B 4W9MC 4BNLA 4JT4A 1V3UA 1EIZA 3PPWA 4TN5A 1L4FA 1WXHA 4AJ1A 2FPMA 5EJIA 4EA9A 3NC1C 2BFAA 3IAS1 3EGXA 3VPFA 3PXXA 4JI6B 1FRZA 1OAOC 3ETLA 2R7AA 1M6EX 4NHOA 4ZAXA 4ZHSA 5IUKC 2Q07A 1BE1A 1KK1A 1XZCA 5AKGA 2YYAA 2ZE8A 3BE8A 3H6KA 3IE0A 5AR1A 2BDEA 1P2SA 1M8GA 1YOBA 3CEMA 3GJ8A 3M49A 4O2AA 4MQFA 3RWBA 3V9AA 2GB4A 3LUKA 4OU5A 1DAGA 4ZCQA 3WG9A 5IYZA 2JAUA 1A4XA 5D85A 5F3WB 2A67A 1GRRA 2I4RA 1UFQA 3BRSA 4PZPA 2Q0HA 3JQ9C 3KNZA 4JA2A 4XDZA 3HFSA 4AB1A 4EYSA 2V6BA 4JVNA 2IWRA 3J81A 2YZ2A 1QCZA 3THWB 1ODSA 2C4UA 2QEQA 3L6UA 1L5KA 2AUMA 1XTJA 1Z5ZA 4YV0A 3BTUA 2V4ZA 3INGA 4UTNA 3WO1A 2FPIB 2YYYA 4U2BA 5E38A 3EIHA 1Q1AA 1W4BA 2C42A 4BNHA 4BMOB 2QTTA 3K70B 4K2HA 3TOVA 1HYQA 3RAEC 5AX1A 2QROA 4LF7B 1IY9A 4GBMA 2R4RA 1RJFA 4Q16A 5CJPA 4PZZA 4UUNA 3OX2A 4J16C 1TZJA 4PY2A 4P5DA 4QNMA 3TIIA 4EMTA 1BM1A 3FCOA 3I6YA 4OGLA 3N07A 3VNAA 3A6LA 3BCHA 1FVFA 4MVJE 4GL4A 4RLQA 2R84A 5AD1A 4CJXA 3OQVA 5CIQA 5IJAA 3DL2A 2NTWA 1D1SA 4G09A 3F9CA 4PHHA 5FFNA 5CVTA 3LYHA 3NWEA 4RGVA 4CM8A 2AFRA 1PT7A 1OFUA 3SHFA 5JD6A 5D3MA 4WLFA 4LZLA 4M8SA 4G67A 4OHOA 4Z0HO 5CXSA 4B34A 4YQFA 3T9CA 3TXXA 3KKEA 3E82A 2RHDA 3H6HA 4BEJA 3HCWA 2O1WA 1WG8A 4QYIA 1K3TA 4ICIA 1LGYA 4YRRA 5BURA 2VF4X 4JODA 3K9FC 2PTHA 5EGSA 1IZ7A 1VTKA 3VO9A 5IAOA 2Y1XA 5D3QA 1DKQA 4F7DA 3LQ2A 3H5RA 1PZHA 3NPAA 3ZH9B 1CY6A 2E0IA 4OI4A 1C9NA 3OQIA 5DLEA 4MEAA 1P4HA 4P5EA 1S3GA 4RVNA 3B5IA 2NU8A 5KYUB 4XARA 4XQ9A 1Y80A 1ZA1A 1XGKA 3B1JA 4HZUA 4DDWA 5BN4B 3H2HA 3FNRA 3AUKA 1SELA 2J3HA 4YMSA 3LHDA 4LV5B 4BKUA 4UVIA 5JNUA 3DBRA 1IYZA 2XQGA 3I9LA 1YCHA 4RE6A 4QU0A 3O8RA 2Y4NA 1F4LA 3LOUA 5FLXA 1F4VA 3A2LA 2WIAA 3IVCA 1Q21A 4JYAB 1QQAA 4EO7A 3O73A 3ENKA 2C0QA 1Y1LA 3PIRA 3NATA 4XAQA 1P5FA 3D6UA 1DWOA 4R40A 3SIWA 1NY5A 1HEYA 1F1JA 3BL5A 2UVQA 3DFFA 4NFYA 4DIOA 3K1JA 5JSUA 4MQ6A 2IEAA 4DPMA 4F3YA 3K2EA 5BSHA 2REQB 2OORC 1OX5A 3DV0B 3QWIA 1TOAA 5E7MA 1B1AA 4I1YA 1P6UA 1R9JA 2QSJA 3FROA 3OOWA 4W1PA 5FWXB 3VU8A 2B4YA 1Y4DE 4F04A 4MR8B 1SZCA 2NX2A 1FTYA 4OXQA 5I4CA 3ETNA 2II6A 4KX5A 1JHRA 3B3JA 3LK6A 2NO7A 3VGPA 3D8UA 4US0R 3EGDA 2I4MA 2VP3A 1F9EA 3PCXA 2C3PA 1LU9A 3LBIA 5AK4A 4OQLA 5FAKA 3MCUA 4EB0A 3U7HB 5JHGB 2A59A 1KIFA 2R8EA 1BOOA 2R9VA 1D5CA 1YR1A 2RSLA 2X5JO 2YHUA 3HBNA 4C0SA 2CSUA 3ELWA 4CM6A 2ZRGA 4ZCLA 5A05A 4AT1A 1N6KA 2J09A 3JR3A 1EPUA 4P4SB 5DTQA 4BV3A 4BMZA 3MT9A 3EGEA 13PKA 1XB2A 2OD7A 5CH5A 1KYZA 4NK5A 4F1WA 3DKVA 3RUFA 2P91A 1J97A 2BFBB 2EZTA 2QTVA 2IPAB 4I4LA 3VR3D 1AUXA 2RC5A 4JKYA 4A7PA 3HK2A 2QT1A 3PQCA 3HP4A 5ALJA 5KU7A 4RTNA 1UEJA 4YAOA 4TKLA 1I2BA 1FPQA 1B8VA 1KH1A 2PNJA 1NJ8A 4PX9A 4R2MA 1LDMA 2DP4E 3BQ9A 1QRDA 2RHCA 2WKWA 3F5SA 3NHAA 3UK0A 1QAQA 2PUBA 3R75A 3CLTC 2XIQA 3OZRA 4O1MA 4OKNA 5ETJA 4F2WA 2VQDA 1DEAA 2VSQA 3BD6A 1XHEA 4QIHA 3UT6A 3OOEA 1IBRA 4TMXA 4FGJA 1X38A 3FZEA 3IQGX 5KJ6A 1JFFB 4R8SA 1AE1A 3U4HA 1KQFA 3D6JA 1PJTA 2D1FA 1KMMA 3FSGA 2O05A 1C3JA 4DG8A 3H11B 2YICA 1NXPA 4P7JA 1PQYA 4JI0B 1HLPA 2A9PA 4H7DA 4X90A 3WZ2A 4DYDA 2WJKA 4QXAA 4M38A 1AKWA 1BXGB 2IV3A 2QNRA 1HSOA 2DWCA 2MTBA 4RHFA 4GBED 5A3SA 3AVTA 3DQQA 1SBYA 3OZXA 3QA3E 1KDOA 1P18A 4WTOA 3DTVD 1NYQA 3W9UA 4CCWA 4ROTA 1FIUA 1RIFA 3GRPA 2EX0A 2RGBA 2W6IA 3E9EA 3G5TA 1L5LA 4A8JC 3KVRA 5C81A 3H2ZA 1O77A 1T5TA 1YU9A 3QG1A 4GPZA 1DIAA 2NV6A 2ZTLA 2ZTSA 1OVGA 3B6KA 4MPJA 1XVIA 2WIBA 1SIBE 4OBEA 4P83A 5CDHA 5FEUA 2QLNA 1YQWA 3SJ7A 4U7FA 4E2YA 3I9FA 5GJCA 4BB5A 1PLKA 3W5VA 3Q7RA 4Q7QA 3VZDA 1QBGA 1T9HA 3Q0TA 2PZJA 3ZZTA 3UJ6A 5LSAA 4N8DA 5EXPA 5EJ9A 2IODA 1SY7A 4KUGA 3NYAA 1MMFB 2B2NA 3SIPA 4BNYA 5EPOA 1DEXA 1M7HA 3GBVA 4IHJB 3R7WA 3PD1A 1MHPA 1QB8A 1CUDA 1JKXA 1M2OA 2PL9A 4MEJA 2AX3A 3O1IC 4QOHA 3MAJA 5ADUS 5JAMA 1SUSA 3A4NA 3GAAA 5K09A 3MIZA 1OAKA 2SCUA 2ZBRA 4NAUA 2PBZA 1DO2A 5EINA 5AH0A 4H1UA 3MN1A 4B3IA 2H3HA 2D1RA 1JAIA 2DKFA 4GFDA 4LYAA 3QKSA 2QTBA 1XMJA 4DLYA 5TPZD 1DDIA 3JWPA 2YIJA 2KSBA 3D31A 3NTLA 4XD2A 2VS1A 3RGWS 4DIUA 2JLVA 4DCMA 2W93A 4PW0A 5ITSA 2AJBA 4RXTA 1JMVA 3R0XA 5AVZA 3T9DA 4Y2GA 4DCPA 4M1OA 1SCBA 1ULHA 4HGRA 5DLQC 2Y99A 3CPEA 3KK0A 3ETHA 1W93A 4GM4A 5IJ9B 1V35A 1QGZA 4BJ1A 4FFNA 1T3SA 3QMWA 5GVRA 2XTAA 3WIBA 1Q1QA 4UE6A 2CEKA 1L4KA 2Z3WA 2KJQA 4EHJA 2DPGA 1G4AE 1H2FA 5LYJB 2G9ZA 4L6RA 3QLUA 1PRYA 3QVUA 4Q3EA 5HDBB 1R8XA 3LUAA 1K5DA 4HBZA 5J4LA 2HY7A 2OK8A 3AEKB 3F6EX 2I2WA 1OI2A 1EJ6A 5JO0A 2UZ4A 3PQRA 3LUGA 1N78A 3OCJA 2R7NA 3I9OA 1UFRA 3WL8A 3ZG6A 4DE5A 2HDWA 721PA 2G1JA 2YWCA 1FU8A 1CZHA 1VE7A 2OSBA 3OZDA 4S35A 3ROQA 2HXGA 2LNLA 5DNCA 1MX5A 2AMJA 2ZPUA 4IEEA 3NSBA 1Y6ZA 1WJGA 3B3GA 1MEJA 1WPQA 1IAVA 2AZMA 1ADGA 3G2NA 3B3AA 3P0HA 4HNHA 3ICOA 1SJ9A 1XC7A 3GJ3A 1AUPA 4MKZA 4AF7A 3KKLA 2FEOA 1UAGA 4KOAA 4V02A 4B4UA 1MENA 1A9YA 4KPYA 1IZ9A 1R4ZA 4JBNA 2ZKLA 3UC9A 2D6FA 4UXJA 5LNK1 2C96A 2E7ZA 2QQGA 1SXIA 3V4ZA 3FJOA 2EFJA 4BO4A 4ED9A 2C2OA 2FP3A 2IHKA 3H2BA 4P3XA 1ADFA 5EPEA 5IULC 2V96A 4NULA 5HIKA 3OBBA 5CNMA 1VSBA 4UFNA 3VPDA 3T3MB 1A9QA 3RT9A 4DM7A 1WXFA 3ANNA 2PUHA 4PLFA 2VHJA 1LKZA 4V0OA 2PMKA 3OJWA 4UBKA 5J2UB 1RI5A 3QF4A 2YN4A 3H8WA 3RFTA 3NWOA 1PFVA 4YCCA 3PIDA 2NZVG 3VJMA 1X7YB 1E3WB 2BR5A 3K70C 1M8PA 2HHHB 2RH1A 4WLUA 5G02A 4UNRA 3FCEA 4CZ2A 4BO0A 3FF4A 4I1VA 4MGYR 4M8KA 1OX4A 1H65A 2Z55A 1MVLA 3G1UA 3GFQA 1ESEA 3HACA 4RKQA 1P91A 4YAJA 2ZR0A 3S28A 1YUBA 2ANCA 2Z58A 3CRW1 3FTFA 1UDAA 4DRXA 2BF4A 4BX3A 1IG3A 1K0UA 1K6MA 4KVFA 1VSUA 2GBPA 1VB3A 2IZ5A 1OC2A 1LSJA 2OQRA 3CKLA 2XMSA 3P0IA 3QH4A 2PUEA 3EQ8A 2BW0A 2DBVO 4M86A 1HDXA 1YFKA 2F4NA 4FYPA 4YRJA 3TTTA 3ZIDA 5DP1A 2WM8A 1XYGA 5E2IA 2JLUA 1MOPA 2PR2A 1R4MB 1SQ6A 3DLHA 2XYRA 2MU1A 3OTQA 5HXAA 3RKUA 1ZOLA 4N5DA 1UPCA 5EAIA 2XUJA 3C8MA 2O0LA 1KY3A 3I61A 1SURA 2Y9PB 4AJOA 4U6QA 4UBMA 3PK0A 5KBYA 1ZR2A 3ZZUA 2DFLA 4IGAA 3A3OA 1JJVA 2AEEA 4KNVA 3RPEA 1M2GA 2HCBA 2NXCA 4G63A 1NJ1A 1ZCFA 5DN6D 2CFRA 1UBSB 3CMCO 5LQMA 3W5DA 5IW8A 4C1NA 1FNDA 2AGVA 1JDTA 2V9PA 3KELA 4ZPJA 2W6NA 1OOEA 2ORED 4BO5A 4QGSA 1E9BA 4OK5A 4RJJA 3LQKA 2J6HA 4BPBA 2ZEJA 3B48A 4YHBA 4QOIA 1XWIA 1E6WA 1EJBA 1YGYA 2I1WA 2JFNA 3ICVA 4ZT2A 1NX9A 3QE3A 3WKCA 1EFHA 2BSXA 2XUOA 2ZT5A 1DIBA 3ANLA 3K0AB 4PHCA 4L07A 4UDOA 5FBRB 1L7DA 2Z4SA 4HJRA 4HNAA 4LE1A 4MA5A 1YCDA 3BZWA 3KZMA 5TQVA 1SVOA 4EB3A 5L4LA 1Z7GA 3FYUB 5CEJA 5JNSA 1F7UA 4FTWA 1RMQA 1E0AA 3BN3A 4FMDB 3I9JA 4CMAA 3PGMA 1S2NA 2HZBA 3AY7A 1EX9A 3BH0A 2VKQA 5EC8A 3SYMA 1CCWA 3WB1A 1G8SA 3ZCXA 4C0LA 4C6SA 4CTNA 3GFFA 3ZJTA 2K2WA 2ZXFA 1Y3HA 1J8QA 1NA5A 1S89A 4NCJA 1OI7A 4ZEOA 1SXJE 4PZAA 2Z2JA 2YBDA 5F1YA 4Q93A 4UJ5A 1Z56C 1FFHA 5BWOA 3T7CA 2I55A 4TL9A 4PYNA 4FHDA 2ORVA 4MDHA 2ZJAA 2P2GA 2CFCA 3A1UA 4G5OA 3AZQA 4N6GA 3TLYA 1FYVA 4JUCA 4BY9E 4N76A 3JVEA 3DYIA 3L6RA 1TPYA 4OBWA 3WP1B 2DC1A 3AY0A 3U13A 1WXWA 3DVSX 4XM1A 1L7MA 1PS9A 2B6NA 1NVGA 1R8YA 4BYMA 2B8JA 2J5XA 1XLWA 2VA8A 4Z3KA 1DC7A 1KORA 3FPBA 4JC5A 3WMWA 1EFUA 3PD0A 1KBZA 1XCLA 1T3TA 2NUTA 3WMRA 5C7OO 1WPRA 3R7FA 1GN8A 2XA2A 2FN3A 4F8JA 4MKHA 1M5TA 2B94A 4JUAA 3Q5DA 1NQAO 1VE3A 4Z9AA 2BR4A 4E51A 6GPBA 2R8ZA 2JI6A 1MQ9A 5FHRA 4BEWA 4J8PA 3RRMA 1XKXA 2WV7A 4MICA 3KQWA 4FDAA 4OL0A 4WK4B 3WTBA 3E9ZA 1C3OA 1UQTA 1DCMA 2CLCX 4FC7A 3QDCA 4D26A 3OF5A 1NAHA 5DW3A 2BEWA 1EVIA 1NMYA 1FJHA 2N1BA 2QTAA 4CR6A 3SNKA 3RARA 3HBMA 1G291 5AKZA 3N7AA 3AR6A 1IWPB 3HADA 4FQ8A 2OV1A 1XVTA 4RK5A 3TD6A 1AM4D 4G07A 2GAJA 3JYOA 4KIFA 2Q28A 1W85A 5IH7A 5MN4A 3JD0A 5LLSA 1U2RA 3DEFA 5AJYA 4AKIA 1QIFA 4N7BA 4MUEA 5DGCA 3WLLA 2P4EA 1E4OA 1TYEB 1VBKA 2QW1A 3CUUA 4J6FA 1ZU5A 4GD3Q 3PXAA 2J4FA 1ZNYA 1IL0A 3FTNA 4YP1A 3NBUA 4URWR 4MJ3A 4O3MA 7MHTA 4XUGB 5P21A 3V5NA 1ODCA 2W48A 2Z73A 3K0HA 3QPCA 4V0LA 2P2NA 4G8JA 3GBSA 2QRUA 4X1IB 3ZCQA 4HQFA 5LJLA 3O0DA 3K7EA 2CVZA 3VR6A 4K9NA 3GJZA 3UNXA 2BL4A 1CR6A 1L5NA 5JEDA 3DTNA 4PPNA 2QQEA 3WGIA 1OW3B 1C8VB 2C8KA 2G4VA 3LXMA 4JR0A 1G20E 3WVNA 3CT4A 2BI8A 2WW8A 1Z16A 4G6ZA 3OT1B 4HEQA 1Y6QA 2ADMA 3DNPA 4HGQA 1NVMB 1YJAA 2ZFUA 4HLDA 1EGAA 1ST2A 3VR4H 1KKLA 4QATA 1X92A 8AT1A 4HQNA 4OQDA 4CEIA 1T10A 4TTIA 3TZCA 1AZLA 1H4QA 3F3SA 2FSHA 2VHUA 2L82A 1AGRA 5AHKA 3FZNA 3UFXB 3C1UA 1OA0A 2VSFA 2VWQA 3UJHA 1N3LA 2F90A 2G0TA 3MGAA 2Q5FA 4RABA 2CUTA 3GFOA 5CXUA 1T2EA 5IZCA 3PQ5A 2Q4RA 4UEQA 4TQAA 2PBLA 3SC2B 4ZV4A 5LMUB 4EJ6A 2HW8A 4W6QA 1XBTA 5AP9A 2PV7A 4O2BF 4XIGS 2PQ0A 3QXHA 2HM7A 4I55B 1UPTA 4RD0A 5FOVA 5BN5A 5B6XA 2OOKA 3MGCA 1C7ZA 3HRIA 5EE3A 3TQQA 4KQWA 2ECPA 4L8VA 4BO3A 3Q1KA 4V0ME 1KOLA 4R6WA 1R8JA 3AVXA 2J85A 4PLGA 5F12A 4O02B 4AJ2A 1US8A 1VCMA 2ZB3A 4QTTB 4D9BA 1D1TA 2VAWA 3GLHB 3GRUA 4O8ZA 3VR5H 4MWGA 1JEQB 3LPCA 4GZ6A 1ESNA 2C2XA 1MH9A 1JSRA 1KJQA 2W9XA 2NNLD 3NH9A 1W0KA 1JHXA 1XTUA 5A9TA 2ZVPX 2GEVA 5J4YA 3SK0A 1GZVA 4ZRMA 1ZHFA 1RR6A 2D0DA 1RYHA 2J5QA 1IONA 2FEKA 3IIKA 1YB2A 3K5IA 4IDOA 4QE3A 3IP5A 4I4IA 1ZEJA 3B2NA 1GXSB 4R71A 3SIXA 1SOAA 3KSDO 4Q7MB 5TLSA 4UUOA 1SRQA 4JU8A 4LJ7A 1NUQA 1Z37A 5ALSA 4ZOBA 4ZAVA 1PVVA 2LNDA 5HCUA 3QJYA 3DDOA 3FUVA 4FZRA 3O95A 1A50B 1OYYA 4EI8A 2B8EA 3DL7A 1A7UA 4GWLA 2XWJI 2X3YA 4DZTA 2FMXA 3EQ9A 1PKEA 1S6YA 3WAJA 1YR6A 4TMFA 4F2GA 1T2UA 4PCVA 4QO7A 4XA8A 4DSTA 1RQRA 3IAM1 3Q2KA 5EIFA 1UL1X 2A1TR 4JGGA 3D6FA 1FNNA 3BF7A 3HO8A 3R4CA 4QELA 4UTXA 3GCXA 1QS0B 2WM3A 2P9QA 1Q77A 4UCXA 2VJLA 2QGFA 1PBNA 1GQ2A 1YRHA 3TEFA 4EHAA 4YT2A 4ZAZA 1O6GA 1R4NB 4NY1A 1ISGA 3BH7A 1HXHA 2HRBA 3REQB 1YZ3A 1RCTE 4Q4AB 1NNI1 2VK8A 3NHSA 1JLSA 1N8KA 1P6XA 4BUJA 3N59A 1TEZA 4PZ9A 3GJ5A 3IRVA 4IEFB 4RA6A 3ZQ4A 4AM8A 1T91A 4QRDA 3T9BA 2EEZA 1B3BA 3JQ7A 3K8ZA 4IDQA 5J47A 5LBTA 1GGVA 2F1KA 1UF9A 2XT0A 3B7GA 1M2HA 3HDVA 1IJBA 3LDUA 3O3MB 2IYFA 4WKBA 4EX6A 5LYJF 2ZT7A 4RF3A 3HDGA 1GZSA 4ZC8A 1PK8A 1GSAA 1A7JA 1RWOA 2QPLA 1X1EA 5H2PA 1TNDA 1RLJA 2GILA 3G49A 3HBFA 3NCTA 4HYJA 1HL3A 3SJBA 4A2PA 1Z8DA 4DR4B 3U31A 4A16A 2F9MA 1TGYA 2X8AA 4C0BA 1L5OA 3IOBA 1IHUA 1VZ3A 3LHKA 1PHRA 2QENA 3RREA 1DIOB 4MRRA 5BVGB 1PSZA 1G20B 1LNZA 3PTLA 4FNAA 3UKDA 2XDQB 1NNUA 2HWYA 5HFAA 3KKQA 1DI0A 1KAGA 3N8KA 1IBLB 2WG0A 2A9VA 5DVZA 3G23A 3WLQA 3ZK7A 4BX8A 3CCFA 4EPWA 2QRVB 3Q1LA 4HDKB 4UU8A 4D96A 1RZRD 2JLRA 1Z0IA 3HUDA 1N7JA 4MR7A 3CF0A 3DLPX 3E7XA 1ZIYA 4BO8A 3M3PA 1V11A 1F8GA 3VR0A 4XR9A 1VJ1A 2G1PA 2PO7A 1C41A 1BKYA 5AM5A 1RAGA 2YFYA 4RFSA 1XEXA 5KREA 3USZA 1HE1C 1WDTA 2PX0A 1M1NA 3GIDA 3I34X 3KQVA 3L1HA 1CVRA 3H4IA 3L4SO 2IZZA 2WKSA 1T4MA 3P9SA 4MR9A 4NZOA 4FILA 5F77A 5AVOA 2HPAA 1ULBA 2PJDA 2UVPB 2G67A 3C1TA 3FA2A 3QVOA 2X2FA 5K0NA 3T5PA 2PX8A 3SFZA 2V0CA 1JSXA 3S6JA 2VQEB 3C3PA 1R0ZA 4TYPA 1KVUA 1P74A 4Y1RB 3U62A 4HLNA 3B1XA 2YCYA 1Z36A 4NLLA 1CUWA 2XXBA 4FE4A 5E4YA 4FP9A 2VK4A 2AZ4A 5FFMA 3VOSA 2XCRB 1U2ZA 3K73O 3FYUC 4WKCA 1Z12A 1GFZA 4LPKA 4PIPA 3D3KA 1GQQA 1M0WA 1Z4JA 3ELUA 4HDSB 4EBBA 5BNWA 4HDMB 1J9EA 1CRLA 3JVIA 5UKDA 5HF5A 3VKGA 3MM4A 3BDIA 3F5QA 5GM1A 3W6OA 5AESA 3CVYA 3NG1A 2ZANA 4DDUA 2IOYA 2GF9A 3FMIA 3C6XA 3QJGA 5BOSA 2X8LA 3TSWA 5JUWA 2ZYDA 2J6BA 3UUWA 3E2IA 3KKPA 4AP9A 5IANA 1QTQA 3K8OE 2DAPA 3N2GA 2H2IA 4NCIA 3G0BA 4ZQHA 4AECA 5KOJA 2BUCA 5CEEA 5JAQA 4N82A 1ISPA 4U9IS 4WUTA 4X92A 1MOQA 3ESDA 3PG5A 4I1SA 1PAUA 5B4VA 1KO4A 4Q1BA 5ULLA 3IT2A 3VNQA 4X1YA 4PANA 5EHIA 1R6XA 5FTJA 3FVRA 3BPSA 2Y02A 4ZYUA 3V3TA 1C8LA 2NO4A 4GQBA 3NFYA 1RWBA 3UAZA 5HQTA 1OPRA 4X31A 4V1CB 3FMOB 2CYCA 5JNRA 1XPUA 3PT5A 4OF4A 4LXUA 4DWVA 2QM3A 2JLZA 2QSUA 4YMWA 2OILA 1YRYE 3P96A 2GQ0A 1JYFA 5IJ0B 4J0FA 2ES4A 2WPNA 2WG1A 5AKHA 2OLJA 1QOPB 1ULUA 3R3XA 3ZX5A 1V8PA 1XDDA 1OXVA 1XQYA 5MGBA 4JOSA 1BVUA 1YDEA 9GPBA 1N0IA 1Y5LA 4CL8A 4C3ZA 4WNIA 1M0MA 2C5BA 1OA1A 3RKSA 2IF0A 4ML3A 4BLPA 5LIRA 4J94A 2B4AA 1EZ1A 1UPBA 3M5DA 5J23A 1W75A 4JVMA 1KSFX 2HYIC 4QHTA 1UK7A 3TKLA 4ZGBA 1OTHA 2OGZA 4EDHA 5C8DA 2H65A 3P97A 1RC1A 3SKYA 1GU0A 3MYYA 1Y9AA 4JVLA 1YQTA 2BFMA 5K4GA 1E2PA 1P3DA 2HWKA 3E9RA 1LTQA 4RCYA 4AZWA 1GRCA 1EHKB 1Q12A 2OCGA 2AJTA 4FOSA 5BSVA 1A5BB 4MMYB 5TS2A 1TZCA 1F6BA 1AQNA 4O8CA 2AQIA 2Q3EA 4MW4A 7REQB 4FCVA 1LLDA 5H83A 2QGNA 2AR0A 1T0UA 4P36A 1Y4ZA 4PG4A 2CNLA 1PZNA 4F3NA 5DHPA 5K0EA 1PVOA 4BEVA 4XRGA 4OP3A 2OCIA 2GPWA 2PNFA 3LYLA 2GM5A 3DM5A 4GICA 4QDKA 2C3UA 5CFZA 3CF6R 4F11A 2A5JA 3OFND 4YJ2A 1QGDA 3HJGA 1IW9A 4R7GA 1DU4A 1O95C 4HUQA 5TEWA 1ZKMA 2Q6IA 3GXOA 3ZDQA 1KZYC 4EECA 2C2ZA 1U7XA 2VDWA 4H4DA 1RS0A 2VOJA 4DMLA 2BFFA 2ZI9A 4DPKA 4IPTA 3BB4A 1E3LA 4MKRA 4KPUA 2Q5HA 2R87A 2LRHA 4GXNA 1V8DA 2XJ4A 3NIFB 3SC6A 1YD7A 3ZI4A 4HX9A 3ZHXA 1LI5A 4WVFA 5AI6A 1HMPA 2CXPA 4B2LA 3RIXA 5JZVA 2J6CA 5IMSA 5JNLA 4MI1A 2A9OA 3HN7A 3LFUA 3A4LA 3AM3A 2ENWA 1NU6A 2OEPA 4PWYA 3QPWA 2ZULA 4PINA 3VU9B 3AR4A 1O97D 1GIAA 4OB8A 1BHJA 5H2OA 3UB2A 3ZLJA 4F4CA 3U7IA 3KVOA 1GZHB 4NE9A 1E5VA 3FOEC 1A7KA 1SCUB 1Y7PA 2DUJA 2VJCA 1SQSA 3BFVA 3FNIA 3PIIA 4WERA 1BDMA 3RJTA 3ZD9A 6YASA 4RKWA 2EYQA 4WZZA 4M37A 3QOXA 4CCYB 2EKQA 3AHJA 4L35A 1G7RA 3L7IA 4HQOA 5EKSA 3NTUA 3GLFE 3DKKA 1DIGA 3ES9A 3I42A 1GV0A 4R9UC 1FFGA 4EFDA 1LCIA 1NT2A 1U04A 1XCOA 4PRYA 4EO9A 1X42A 1OXKB 4DB2A 2GN0A 3CLSC 4WWHA 1NIJA 1ESCA 4CEJB 4Q6BA 1VIAA 2EKBA 3NKVA 3OP1A 5AVRA 1NI5A 1FZQA 4UE2A 3ROZA 3CRMA 4WL0A 5EMJA 4NDAA 2XOKD 1NVWQ 1R16A 1WVMA 2VPIA 1YRAA 1U1CA 4OTZA 5LD2B 4P0QB 1QO9A 1TEXA 3A28A 3GPBA 4G2TA 4WLOA 5B0WA 1NSTA 4YJDA 1YAHA 3G59A 4C6TA 2QI9C 2ZRDA 5K5EA 4M7OA 5BN1A 4EGCB 1NW5A 2GZSA 2H0RA 3MMPA 3Q3IA 3SX4A 4HZIA 5DM70 1ZCBA 3G85A 3I58A 3U9LA 4R0MA 4M53A 5JVDB 1AKQA 1L7BA 1O8BA 1CUFA 1Z15A 5FA6A 1YE3A 2FSIA 3WGTA 4PN3A 4OQFA 5FF9A 4ZN6A 2WUWE 1NASA 5E6UA 1JR4A 1KQPA 2NUBA 4FDVA 5FPTA 1JJ7A 1EXMA 1QO0A 4MARA 5AKJA 4AUMA 5KB3A 4RNDB 3AO0B 2EQAA 3E6AA 3CWCA 4XYBA 1JE0A 1U63A 3E4CA 4KU4A 4JP8A 4YFYA 1OF1A 1Z88A 2ZB4A 3B2EA 3KG2A 3D6AA 5DNVA 4CV0A 3VR3A 5ALFA 2WMDA 3VPCA 2LD4A 1IK4A 1QQ6A 3WGJA 3WGNA 4G7QB 1KFKB 5GV7A 2YJ3A 1FDOA 3RT1A 1QPGA 4LYHA 4UARA 3AUSA 4MQSA 4JR8A 1N57A 6AT1A 3NJ8A 2R6HA 3BMCB 3RSHA 1GQFA 4Z7QB 1TJPB 5FTLA 3THWA 5K4AA 3AT1A 1E4EB 5LZ2A 2JAPA 1DFGA 4LJ6A 4RKEA 4L16A 3UMBA 5TS3A 1D2EA 1U0SY 1PJCA 3LG2A 4EZBA 5HK9A 5HHTA 3ZJ5A 4I19A 3PFFA 1NLMA 4N0DA 4OA5A 3ZCRA 5JZOA 3DKPA 3EEIA 1P44A 1VJ5A 4TSRA 4B73A 5IEJA 1Z29A 3AY6A 3W3AH 3SXUB 5FWNA 4I55F 4DLZA 5K8UA 2BGKA 2QMZA 2I3DA 3GEEA 2O6LA 1C4KA 5EUBA 5KYWA 2Q5EA 2VRCD 4GYYA 3UANA 1RHUA 4LE2A 1XO1A 3D7KA 2ZETA 4E70A 4JIMA 1A4RA 2JL1A 4KGDA 1VSVA 3LT4A 1NPYA 2Q6KA 2Y04A 4D9HA 5A4IS 3NPMA 5C35A 2HQRA 3K0BA 1ADBA 3I62A 2Q6VA 4ZVRA 4AZ0A 4BFUA 2QI9F 2QLBA 2VYFA 3N2IA 1LSSA 3DB1A 4F4IA 1BQ4A 2HPVA 4XWYA 4LY3A 3REGA 2D1TA 3D3QA 3E3OA 4PC1A 1DTEA 3K2BA 1HOTA 2VP2A 1VPWA 4LWZA 1QHIA 4DCNA 3HY4A 2SKCA 3ZGYA 2RBEA 1XTTA 2H5IA 2VF2A 4HH0A 3ZJVA 1S2DA 4NC3A 3O03A 3BKXA 5KWJA 5ARBA 4O4JB 1T6NA 2D5IA 3ZUGA 3EA5A 3H9JA 5DCYA 3WRYC 3GRVA 4WY5A 3G7SA 1NX6A 5BN4A 2FN7A 1CQWA 2HSZA 2XAAA 3W5SA 1PUXA 2O6HA 3NNNA 4B84A 1MFPA 4PGMA 3RV3A 2P75A 4D8TA 4LCEA 2W6ZA 5KYXA 4ZOLF 3N2LA 1ZBDA 1W7AA 3WKAA 2G5GX 1ECFA 3LK7A 4P81A 4PPQA 4X00A 5C8ZA 3BMOB 5BYJA 4Z2AA 1NJ6A 4P8RA 5CB4A 4I1PA 1PR6A 3ESAA 3K72B 3T8YA 1DBSA 1DMRA 1H2BA 1TC2A 2CXHA 7YASA 3E3NA 1E79A 1N6NA 4J7AA 4F45A 1ZL0A 3IKLA 1OFHA 2OO5A 5TPZA 4R7TA 2YASA 3TZHA 4RMNA 5BR7A 4Z86A 4YIHA 1C7RA 4RVUA 3MELA 4OKSA 1CWQA 5K3BA 3FLAA 1PV4A 3P9QA 1CT9A 1SGWA 2ZYSA 1KPGA 4JOBA 1LB1B 4AUKA 1TA9A 3W79A 2ETXA 4DTCA 1YJ8A 1YC2A 3KDSE 4A03A 1V9CA 1AGYA 4LIPD 1R9MA 2PKRA 1W4ZA 4E88A 1NP6A 4YCAA 4E2WA 5JYDA 4DLXA 2P35A 1GCAA 4YHHB 3QI7A 5FUXA 1ZUWA 4AG3A 1DKLA 4RZHA 2HKIA 4RX1A 1ZRMA 3DDZX 1GRQA 3JQ8A 5HS6A 4JYZA 1Y1PA 4DDHA 4W7IA 1GKLA 1KJZA 2PSHA 3A6ZA 1BX3A 1P3Y1 4HYTA 1EUDB 4L6IA 1UOEA 2XBMA 1TIBA 2DERA 4FDTA 4RH1A 4BNUA 5F98A 2IHBA 4JLVA 1C3VA 3HZHA 4GP7A 3VC3A 5B37A 1ACJA 4NRDA 3IR5A 4FFWA 2OP1A 1M6HA 3ZI7A 5HCIA 4EUSA 4KBGA 5I3ZA 1CJCA 2QKYA 4OSOA 3FFAA 4UVDA 1W0CA 3ACDA 2CVPA 4A1OA 1M73E 1VPLA 2IYXA 4ROSA 3DDUA 1H1TA 5TGTA 2HPHA 2EI4A 3GIWA 2VPTA 4GX2A 4YROA 1EM8A 4IICA 2H00A 2B78A 4ZRDA 4FBGA 4QUGA 3TBHA 5BV0A 3ZWOA 5I6DA 2ZI5A 1U94A 4YRCA 4EY6A 4TQUS 2X2OA 3BCRA 3R3WA 4CT0A 1V1RB 4O63O 3C7KA 3CWZA 3BGVA 5TT0A 4E03A 4EL0A 4KYUA 2G5PA 4IJ5A 3WDLA 3OFKA 4KLZA 1RAIA 1VLZA 2J0EA 3A1TA 3KC2A 5DTRA 2DLCX 1XJ0A 4R0VA 4OMCA 1Z47A 1RQ2A 1DZEA 1U7DA 2VJMB 3KCQA 1W1WA 3H84A 3N3AC 3MWGA 4HS9A 4XVRA 1E3JA 3TW6A 4MVJA 1JG4A 1BJKA 1BXRA 4BZWA 1G41A 2B8TA 3C3AA 1JU9A 4MYSA 3W4KA 4BGIA 4MQEA 1A5SB 2LPMA 4KSYA 2OV3A 2OV4A 4KAAA 5CLIA 4QPDA 3HI6A 2A3RA 1GL6A 4LHWA 4BNDA 2G80A 2WHRA 4G9GA 4DJEC 3HBAA 5JC8A 1F17A 2WQ7A 4FR5A 4PNPA 5F73A 3VVBA 4OI0A 3DZCA 1L5VA 2ZRNA 3EOBI 4BZPA 3JAKA 2FPSA 2YYZA 5HEKA 4HFMA 4NFSA 1GTL1 3MD0A 1JI0A 1JZTA 8ABPA 1XMXA 5BSGA 1X0XA 3TOXA 1YC5A 1RP7A 1O54A 4NECA 1RQXA 1ZITA 2ZDGA 4Q4LA 5ED0A 3O4VA 3OI7A 5J58A 1DJMA 5T3UA 1SG9A 1CF2O 3FDIA 3S81A 1BE6A 1IUNA 1BHQ1 4DQLA 4U7JA 4IB4A 1SK8A 1CB7A 3SU8A 3MJVA 3W6PA 3EWAA 4BS9A 1BRRA 4RQAA 1J7KA 2I7TA 2YWGA 1JVBA 1XTBA 5LZ8A 3GD5A 3M4ZA 2IBTA 4H0CA 3HDHA 1CS0B 1DJPA 1D2GA 2AN9A 2WDPA 3EJWA 1F50A 3OG9A 5JJNA 3I2JA 4MJ7A 5C0OE 1E1DA 1Q1ZA 5IJWA 1Y8QB 3JQPA 1HE8B 2JRLA 5JJJA 1JQBA 2EVWX 5DYIA 4DHWA 1JHQA 1NJ2A 5JQWA 1ISHA 5AUPB 3S8GB 2ZIFA 3ESQA 5L3QA 1JIKA 5LA6A 3CR7A 3MQ4A 1S2LA 4MUKA 5BNZA 1T36B 2O8BB 1USGA 5HMMA 4G7SB 4OOEA 2YV3A 3ZBPA 3X0DA 2ZM5A 4OIFA 5ESWA 3M6XA 2R5WA 1V5FA 2CVHA 2O2XA 4ZZ2A 5CCEA 5FTNA 2R1TB 1UBUS 3LL4A 3LZCA 4E7PA 4CCAA 4KE6A 2B1IA 4W8HA 4N4WA 3CEPB 3FCUB 2EX4A 3R0VA 4JQ6A 4OIMA 4OYHA 1GQSA 3W4JA 5IJ9A 1XZBA 4BUZA 1CHNA 1M2JA 2QR3A 4JBXA 2BAGA 1G7TA 3L02A 1BS1A 4UATA 5LBIA 3HCNA 2GJAA 3BQMB 3JD3A 1ZH4A 3R7AA 1F9AA 3M6MD 5AVXA 2PMCA 4IHAA 1JKJA 4MRMA 1MV5A 2I8AA 4G84A 5FI1B 3ZHYA 3WC4A 5A0TA 1P61B 5CURA 1GYPA 1EUCB 4PZUA 2UYCA 1ZU4A 1K66A 1SHKA 3AP2A 1H0SA 3BTVA 4QLAA 2I71A 4UXHA 5LD2C 5BR2A 4YDHB 1NL3A 1NN1A 3HR8A 3ETGA 4GXRA 4Q3KA 3O8BA 2NZ2A 4QU9A 1OD6A 1DRUA 5CDGA 1VOTA 5AM3A 1CUVA 1DARA 3GXBA 1G17A 3NY8A 2OE2A 2PRJA 4Z9XA 2HU7A 3QXCA 5FBHA 3ADCA 3H7AA 3A4VA 3I6QA 3VR2D 2XUHA 2P78A 2OO3A 4JP5A 4YPOA 2CHVA 3V6LA 4NEGA 5AT1A 4UNNA 1T13A 1TA0A 1ZI8A 2A6PA 2OFWA 4FSDA 2OG2A 1GPLA 3VZRA 3X2SA 4BJHB 4FZ5A 1A8SA 2Q3BA 2XGSA 4FX2A 5TE9A 3FVWA 4DA7A 5D86A 2JFWA 1G21E 2BR3A 2HRDA 1YAJA 3ZN2A 4RZUA 2A4KA 3Q9UA 1BDJA 1N1GA 3KSBC 3ISJA 4UVGA 5H82A 2KB0A 4PEVA 1FNBA 2IOQA 4AMGA 1YS4A 4H3HB 5AUQA 1QVWA 2CKDA 2XMGA 4DM3A 1PGJA 1NBMD 4QFDA 2UUBB 3HL4A 4YONB 2QUZA 1J0CA 1KQ3A 4WEQA 1RXYA 4LJLA 2WU8A 3JAWB 5FJIA 4XXJA 4KH0A 4P1ZA 3ZGNA 4RA9B 2EFGA 2JLXA 9ATCA 1VLVA 2P62A 4NATA 4CE6A 1O87A 3BIJA 4XCQA 1OBFO 5HMLA 2VPPA 3DZDA 3HKEA 4G0XA 5J2UA 1I2AA 2PGNA 3I9V1 3RT7A 5JXGA 5J2TB 4HGNA 4LDZA 3U3ZA 1H8ED 2X5KO 5JAUA 5D2CA 5EHNA 1RLUA 3LX5A 4EI2A 5KSZA 1GQYA 1U0HC 3K4HA 1H6CA 4CLRA 1HYGA 2O06A 3QNWA 3RBAA 2NU7B 4XLTA 2AFHE 4DV5B 2PX4A 1TO1E 3AOEA 4RJKA 1SCKA 2ZBDA 3TO5A 4ENQA 5FUYA 4H7HA 2RHBA 4XGQA 3VJRA 3FX2A 4Q03A 3R7BA 1MP0A 2W6CX 4HWKA 1G7CA 1Q2UA 2XTMA 4BO6A 4MUHA 1OBCA 2BOVA 1BE0A 3AF0A 2VRBA 4YMIA 4UZSA 4BZQA 3HVIA 2YJZA 1CRQA 2RHTA 3U19A 3UOWA 3QJSB 1PZXA 2Y2VA 5E6SA 4ZHQF 4R9VA 2Y1OA 1LTHR 1I6LA 4JP2A 1CIJA 5TARA 3GAFA 4J91A 1VKJA 5F52A 1RMTA 4Q19A 3V8VA 5IABA 1BSVA 2FG6C 5L4SA 3RFVA 1N6RA 3QAKA 1XTVA 4B79A 4G0WA 5ES4B 5BSWA 3OEEA 1JW9B 3OJLA 4KI7A 2WWIA 4MLZA 1C1DA 2E6KA 5CTJA 4H1HA 3WJ2A 4G89A 2WYWA 2WQZA 4CLOB 3LUBA 4MAMA 4DLBA 5H9VA 5KCMA 4KV9A 1K7YA 3HJBA 3EK2A 3KXKA 3RVOA 5E2BA 1MEEA 1EBUA 1E32A 1KNQA 3JV7A 1QGAA 2PSSA 2YJGA 3DE5X 4C2TA 2AG0A 3OMXA 4M1EA 1E4VA 4WW3A 3TPFA 3VSEA 4IGFA 2ZJ4A 4XIJA 4R81A 4FMPA 4OU4A 4WAVA 3DDHA 5DGDA 3ND7A 2H5LA 2I2FA 5FNVF 2J9RA 2RBGA 4WN9A 3NP7A 1BA3A 3M5WA 3NX4A 1YV9A 3QK7A 4I6JA 4P6VF 1KDPA 3UJPA 1LWNA 2YTZA 1JG3A 1DBRA 2QORA 3U3JA 2DT8A 2O5RA 3FSEA 1V1MA 3JASA 4QVKA 4UOQA 5D87A 1Y6JA 1Z5PA 5DGIA 2YVAA 3U0VA 4HAYA 3AINA 4AUNA 4Y6GB 3KEOA 1QHHB 1YMQA 2GBLC 1P8HA 1AN9A 1EP9A 4WOKA 3VNBA 5ICEA 4PBTA 2NQTA 1ZXLA 2O7QA 3I0ZA 3KBBA 2BFWA 3OM8A 3GJ6A 5LB2A 1AMNA 4J49A 4KK3A 4IJVA 1LFDB 3KPJA 5BMVB 1VDMA 1ZX1A 2V6MA 2Z6AA 5K0TA 1OB2A 2G76A 1ZRHA 3ADPA 2XCLA 1T1GA 3IESA 4MX8A 4BJ5A 1HYEA 4LYEA 4TMTA 4IWNA 4OYLA 1QGED 3WKEA 1TVMA 2R00C 5AK3A 2AQKA 4GX0A 2DG2A 4YREA 2P2CA 3H1GA 2FW7A 1EGMB 1Q3KA 2PCJA 1H2WA 1WXDA 3CNLA 5FI0B 3RUPA 2RGAA 4A6DA 4S2UA 3AR5A 1LJUA 2JFBA 3T3GA 2BY4A 2Z1MA 3DOFA 4B3DA 3ANYB 1IM5A 3M4XA 1G21B 3KPWA 4J4BA 1U7ZA 3T7TA 5JXWA 1FE8A 3ZQUA 3K5PA 1AH2A 4O4JF 1PZEA 2OVFA 3JTMA 3KAQA 3ST7A 4EYOA 1QRAA 4JL6A 5LN1A 1MXFA 2KI5A 3RHSA 3CLTD 1RDFA 1AIPA 2N1MA 2V1UA 2X1VA 2Z8XA 3RBXA 1WX1A 4MQTA 1U0JA 4Z3DA 5DCLA 5C5CA 3ZDYB 4QD3A 1N9KA 1UJMA 2QNIA 2RKOA 5DGXA 4WVLA 1HT0A 2B5OA 3HKCA 5FPQA 3UJCA 4ZYLA 5JALA 1YIAA 4X7PA 3ITKA 3T95A 2ZXUA 4NONA 1ND6A 2VHEA 1Z0AA 2VNKA 5GJBA 1W36D 2Y1FA 2C77A 3NAQA 5T4EA 4EG3A 1MN6A 2WP8J 5A3QA 3RTDA 4CKCB 4KR7A 1QF9A 4AAYA 2CUNA 2BFCA 3CT6A 3QY0A 4HDNA 3VKWA 1H8HD 2J67A 3E2PA 3LQQA 1GSOA 4FMBB 2YWXA 1QHXA 2GFQA 3LDGA 4MSUA 3RVMA 1N1MA 3DMDA 3ANXA 1ORTA 5IDWA 1ZMBA 1T2CA 4J29A 1WB5A 2WJ4A 4QPNA 3NHPA 2XF2A 3QKIA 3I5YA 4QWWA 2HRCA 2OQ2A 3N86A 3HP7A 3OTIA 4P22A 1X74A 5EXSA 3SYTA 4O6VA 3MF4A 1KKMA 5FR2A 1NRXA 2DX7A 4U02A 2EDAA 5A02A 3ZHSA 1PEAA 2J41A 3DZIA 3O4JA 3DMTA 5GONA 5BQXA 2FLKA 5TQ0A 1E7YA 2ISQA 3L07A 4D80A 4N40A 4DN6A 4EKNB 4LNAA 2RGEA 3MWEB 2WBLC 1Z0UA 2QTRA 1FU7A 2AR7A 2IA5A 3B8EA 3AR2A 1AD2A 3L8MA 1F88A 2NUPB 3HCBA 4TLEA 4G86A 4XPIA 2JDIA 1ZN2A 4UM9B 1OAAA 2PKYX 2NV0A 3ZBTA 4GMGA 3B82A 3MJSA 4FJ2A 3Q12A 4J6EA 4ZXPA 5IXSA 4Q4DA 4BMPB 4TYNA 1ZJ4A 1N77A 3QJVB 4EJSC 3NRJA 5ALEA 4NPHA 2D2VA 1NGSA 2Q21A 2W2MA 2KW5A 4W82A 4BBPA 3SJCA 1M1XB 4QG3A 4YRDA 3NEPX 4V0SA 1OU4A 2IE0A 1O89A 2QX9A 2AE1A 3KD2A 4IP0A 1T5IA 3N58A 5J5CA 4OHMA 2RHGB 3AFMA 4TTVA 4WQMA 2VAXA 5EG5A 3W7BA 5KTKA 4Q24A 4JOCA 4BLTA 3MUEA 3WI7A 4CKWB 3PZRA 1YDGA 4ZI7A 3MUFA 3TI9A 1XLVA 2ZWIA 1GKYA 2R6JA 1TC1A 3T3DA 4ZJUA 3IT1A 1DGQA 3G6KA 4GBJA 3VPGA 3ZPQA 1JJFA 4L3VA 1F0KA 5EJEA 2RD2A 4TKVA 3RIEA 3VG9A 2PIDA 4PXFA 2JEZA 4EQ6A 1OFTA 3GC6A 1EK0A 3LIPA 5EJMA 3B7WA 1ZSVA 5JFGA 4UKDA 3FYSA 3H13A 4HB2A 3KLPX 2O57A 3C74A 5DBHX 3V33A 1SXJA 5JTUA 4WASA 3ZDBA 1NVFA 2VXYA 5JRZA 4US2R 4J0KA 1NUAA 1XIOA 4EKIA 4Q3LA 1FW6A 1CNMA 1YQ9A 2FPWA 5D84A 1P5JA 4DBZA 2HSDA 2G83A 4WCVA 5DHSA 5E7QA 3RJMA 2P67A 4MUNA 5LYYA 5LZ4A 4KFUA 2C3YA 2HXYA 2MMCA 1Y6FA 3KDAA 1IH8A 2VBCA 2XV1A 3I3OA 4G0PA 4ZV9A 2ZUVA 1RWWA 5H3CA 3C3KA 1L7VC 2X8WA 2IH5A 3D0OA 5ALGA 4FFPA 3UMRA 3EN0A 3PFCA 2RJ3A 4TLLB 1V4VA 1Z25A 3OZ7A 2W98A 4J43A 2H4ZA 4NI5A 4EEZA 2P9EA 1VJGA 5M04A 2BHNA 1Z2AA 1DRKA 3HRHA 2VT2A 1UZMA 5K3EA 4LTDA 1YULA 2VZLA 3HCRA 3LI2A 4MEBA 1YQEA 1XMVA 5H59A 1RE0A 1NJSA 2C2BA 3PQEA 1SR8A 3LCJA 4EHBA 2F9LA 2W6MA 3MGKA 1NLFA 3DAFA 3KPYA 1JQAA 3QMVA 3T99A 3WNBA 3QE9Y 4J1QA 3ITEA 2UYGA 2R65A 3UV7A 1BW9B 4R69A 4MS3B 3LQ4A 3E5MA 4PSVA 3G7NA 3KFVA 3WKBA 4AZ3B 5JZSA 4WXMA 3UF0A 3WYEA 2BZSA 2GPTA 1GA6A 2C7OA 1A2OA 4Z9FA 1U1IA 2ZRHA 4YRFA 4ARSA 4Y6LA 4PYMA 1XMIA 4FMCB 3TPCA 3DS8A 2VDOB 4BJ3A 4XCXA 1D1QA 1GRNA 4LDLA 1V47A 2AF4C 4MV9A 1QOQB 4IMJB 5K0FA 3SQXA 1NR1A 4AS3A 5D01A 5K99A 1HORA 3IIIA 2XVZA 1WMAA 2Q5LA 5HIMA 1C29B 4PYIA 1ZMRA 3T4UA 1WSWA 3LDFA 3VX3A 4E5DA 5B7PA 3EVBA 2DUUA 3GJYA 2C1ZA 1DEKA 3LNCA 3I0NA 2DEUA 1NDQA 1RXIA 4AJKA 4TT3D 5D7NA 3PVZA 2JGNA 3LO8A 4TVBA 2BEUA 1XVUA 3REQA 3LUCA 3JQGB 4X32A 5LQSA 3TTVA 1COZA 1W88B 5CLGA 1JHMA 4BV8A 4DQVA 2GAOA 3FWZA 3VKUA 4Z1MD 3TQIA 6PFKA 2DSNA 2IDJA 4BVBA 3W3ZB 3F73A 4MOWA 2O5VA 1MO6A 2VH1A 4M55A 5C37A 2LKCA 4BGUA 2EGHA 2BUBA 3FHOA 3STWA 4RTJA 1KS9A 3HNPA 4NOLA 2PJZA 2VPWA 1MB2A 3Q3HA 4OSEA 4XJXA 3TN7A 3KUXA 1E9EA 3LQRA 2KHZA 4PHGA 4DF3A 2F1OA 3H5LA 1FFAA 1MU0A 3VDNB 2CLIB 1A27A 2RIPA 3VSCA 4EABA 3X1WA 4A91A 1ZVKA 16PKA 3STUA 3TBKA 2A5GA 3EDRA 1QG4A 3R9IA 1X7WA 4P9NA 2Q2QA 4MUYA 4N8SA 2PKCA 4D9FA 4EFMA 2YWFA 4CRWB 1QE5A 3CKKA 2BMWA 4RD6A 3USCS 1DQNA 2VQSA 2IYUA 3EEYA 3H75A 4Q9DA 2FZGA 1N32B 1L8QA 4MH0R 2V6IA 3PHJA 3UQYS 4E7OA 3HXPA 1Y8CA 3E0XA 3VMFA 4KFCA 1F2UA 1X7XB 1Y37A 3E9YA 1RC0A 2OTCA 2AZXA 1PNTA 3ONFA 2W0SA 5ALYA 2W58A 1A1SA 1QJ4A 3QSYA 4G4SO 4RTQA 2MINA 3DFMA 4M83A 2BCGY 1XD9A 3Q0IA 1T8TA 3O8QB 5DI9A 4XFJA 4JDPA 1X94A 2QRNA 4MB2A 3MSCA 4BQOA 1P7CA 1MRSA 1PGOA 2RJNA 2UVPA 4KSBA 1YB4A 2K4MA 4FYYA 3I01A 6LDHA 3P9CA 1KE2A 2F3PA 4EHFA 4H0FA 1VRVA 3B5EA 1Z6XA 3BE4A 4TGLA 3FCCA 1DSSG 5HBRA 2JAOA 3M4NA 2QUIA 4Y18A 4UFPA 4V0MA 5FADA 3JWIA 3FKQA 3I5MA 5J2TF 2IY9A 3MBIA 3RS9A 3THXA 4JC4A 1X9GA 4TQGA 1GG5A 5ALQA 4C4SA 2QPTA 3ZVMA 1BROA 4HDSA 4DUZB 3WLKX 1SC4A 2PAAA 1HOXA 3B6JA 2GD1O 4CIVA 3INRA 4LMAA 3W6NA 2Z43A 5JMTA 3IV6A 1W52X 3QIAA 2I1VB 1TM7E 3RK4A 1UJCA 3I9MA 3QKRB 4XXHA 4BP3A 4DXHA 4ERXA 2F43B 4E6EA 2J32A 1KTVA 1N6LA 1S1MA 1YQQA 1UKZA 3CNBA 2QN1A 3FCXA 3KJQA 4R98A 4YIKA 4X1HA 1Z22A 3ZCVA 3K09C 3HGQA 3QWFA 4NDZA 2I78A 3Q9NA 4G2NA 4AW9A 3ANMA 2FR8C 1KPHA 2H16A 4JJAA 1JQ5A 3LGAA 3TEJA 4MLPA 2VJQA 4NBVA 3EZFA 4R3UC 5DTEA 2Q6OA 4GP4B 5FUQA 5IT4A 4RZSA 1UWCA 4WEOA 4ZU1X 3T7IA 5KX5A 3U6KA 2AKEA 3DO8A 3U16A 2PS9A 3QNUA 1B93A 3BYZA 5IPFA 3TNFA 5DBOA 1RWVA 1ZESA 3F90A 3JZAA 2HBQA 4V1CA 5D7BA 3GMTA 5ADWA 1YF3A 1V8OA 4EHKA 2BT4A 1II8A 2OG1A 3PDIB 2XVYA 3O9MA 2GBCA 4OJTA 4CF3A 4NNOA 3DLCA 2JCYA 2VAPA 4KNYA 5EVJA 1KXJA 3DQZA 3OCYA 1AV7A 3MEQA 3GN2A 5CBPA 2PFGA 1A9SA 2O2IA 3OWXA 3Q8WA 4B75A 4EY3A 5AHYA 2V45A 3ZW8A 3DNFA 1TQDA 2UZAA 1ID1A 1FYFA 2X0NA 4DDKA 3O8DA 2ZTUA 1IFXA 4D6PA 2A92A 1X19A 4IJQA 3V97A 4K9SA 3C43A 5LQJA 1B6SA 4BVJA 1OZHA 3V55A 4R5HA 1U5BA 3DZJA 5LQUA 2VF5X 4PGAA 1C9JA 4GHWA 5KWEA 2ODTX 1CP2A 1AX9A 2X0JA 4JL8A 1RAAA 2H17A 1QHSA 1Q7CA 1Z4NA 2EIXA 2OCAA 2X7HA 1L0MA 2XJ9A 3E23A 5EMMA 5CCDA 4DR5B 2GYWA 5TDHA 1Z4OA 3N2KB 3ZWBA 3CX4A 3GWGA 1SFRA 1G42A 4U2KA 2QL5A 4KXLA 5DHGA 5FWDA 4YX9A 2WTXA 1PTKA 1USWA 5G3YA 5K0ZA 1E9VA 2VRCA 5BMVF 4ETMA 1I4DD 1M33A 4F6CA 1T3LA 4XPZA 3TLXA 1MOSA 4R41A 1MTZA 1KJWA 2X8JB 3NWPA 3RRYA 2B35A 1HEIA 5H2MA 2W2LD 4ZMRA 5KO2A 4MCHA 3VUEA 2C9OA 2PH7A 2VCEA 1P2TA 1WD5A 4BMDA 5AIBA 4KAJA 4M98A 3LPAA 1N2BA 1LBSA 4RTSA 3RF6A 2JVIA 4RH0A 5H5JA 5B1DA 1B73A 4Q7KA 1MH1A 1R7RA 3AR7A 4ER7A 5AQEA 3LLSA 3OT5A 2C98A 2HO5A 2R86A 2XZTA 3P52A 2BTOA 1M2NA 4CMJA 1Z0JA 2IYPA 3U4AA 1G8YA 1JAZA 2QPOA 2ZJZA 3E58A 3CURA 3GCWA 1GCGA 4AC9A 2QTHA 3EQ2A 3MW8A 3PC3A 2PAFA 5HZMA 4O25A 5D5HA 3F6SA 5FXMA 3LWZA 2P3SA 4KHPB 3M6UA 2RONA 1CDEA 2DETA 2NZYA 3AKZA 1NN3A 1ZAYA 2BELA 3F98A 3LSTA 1TK3A 1L5RA 4URFA 4K3UA 4X41A 3I09A 1NBIA 3QV1A 4I3GA 4P98A 3K6SA 4X71A 5EPUA 1XNQB 1YKSA 4E94A 2ODEA 1HQKA 3RUHA 3TTUA 1DDOA 4AZVA 3D2BA 3A2NA 4OQQA 1ZI6A 2NUAA 1B15A 2XGGA 3TSZA 1I0LA 1JIVA 5IDQA 1IPEA 2B4KA 4MVJM 1JL3A 2GZAA 3EHDA 3QVLA 3IAEA 3OQJA 4GMKA 3OE8A 1SWVA 1JI3A 4P0TA 1N5IA 3U4IA 1E98A 4MI6A 3REOA 2FSVC 2C9BA 4IJUA 3GBPA 4MQMA 4TXHA 1R12A 1GOTA 4X84A 4F5WA 2PDAA 2JI7A 2HIAA 4E13A 4P4NA 3SN6R 3FNHA 4OHZA 2QPEB 3CUSA 2Q41A 2WF8A 3V3KA 2CK3D 5K45A 4R9NA 4BKPA 3G1TA 1QP4A 5DIZA 4D3YA 5B4UA 5JS8A 2G88A 4A0HA 4C4PA 1XNGA 2Q4DA 5AJXA 4P86A 1YHYA 3GDFA 4D46A 1RSZA 1B0AA 3HDTA 2IW3A 1DAIA 2OCBA 3AJRA 1LPOA 2COKA 1JLLB 4LISA 3BFKA 4RS4A 3SYKA 4RDHA 2Z6UA 3E1KA 2XW6A 3QBLA 3FUWA 2OT3B 3UA3A 3LA8A 3V7WA 5LXTF 3IOCA 2LXNA 3JRXA 3N8IA 1ZNZA 2Y77A 3AVQA 3DCNA 3EVDA 3HYSA 3OJOA 1QTIA 3ZNPA 1U7WA 2B69A 3LD9A 3WQQA 5K0GA 4L9SA 5KDDA 1U28A 3UHPA 1ZK1A 2E85A 3QMMA 4XEHA 1P80A 3HR4A 1UDCA 2ANBA 3CLRC 4MQUA 1P19A 1PFWA 4MGIR 5FWYB 1YT5A 4Y30A 5L8VA 1PYGA 2VJAA 1EK2A 1QHEA 1KZHA 1JTVA 3Q3GE 2XUFA 1ATIA 1O94C 2QSZA 3FWPA 4L8LA 4PZDA 1H5UA 3GDHA 1KAOA 1S8FA 1V5EA 3ETCA 2PYZA 4AJJA 1GPAA 1M8KA 2FF5A 3G68A 3JZIA 4MCAA 2QLLA 4DB4A 2NG1A 2W6OA 3PE6A 2G9RA 4AJPA 1L1QA 4HI0E 4EEXA 3CLKA 4GLLA 1ZHHA 3I6IA 3ONNA