4GP4B

Structure of recombinant cytochrome ba3 oxidase mutant y133f from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Ligand Access to the Active Site in Thermus thermophilusba(3) and Bovine Heart aa(3) Cytochrome Oxidases.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4gp4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4gp4B02
3UADA 1E65A 5I28A 1X0K1 2KSYA 1V10A 2YDVA 1LN6A 2Y00A 2KS9A 1J5DA 1SF3A 2YARA 5TK2A 5PAZA 3D12B 2Y01A 3H4FA 1XB6A 4NB7A 4EF3A 5I6OA 3NJMA 4JHVA 3C9LA 3PWHA 1NIFA 4KO6A 4BXVA 1NINA 4LDEA 3NSFA 4HZ1A 1NIDA 3QDCA 4X1HA 1L9OA 3FU7A 3V2YA 1M57B 5I5MA 3PBLA 4XTLA 2GC4C 3DQBA 1M0LA 1F56A 2J57A 2FNWA 3EHBB 1J9SA 3IN0A 4BWUA 3QAPA 2J5WA 4G70B 4JHUA 4PCYA 4Q89A 3PLYA 2CCWA 4KOCA 1GW0A 3T6ZA 4AZUA 2JAGA 1MG3C 5B1KA 3NP3A 2I35A 3U25A 4E9QA 3BVDB 4G7RB 2J55A 2PCYA 2Q9OA 1WA0X 4G7QB 4X31A 4BV0A 4E9RA 4FAAB 4L0PB 7PAZA 2XX0A 3KW7A 2R4RA 3NY8A 3FQ1A 4UHRA 1L9PA 2BWDA 4A4MA 1CWQA 1QKPA 1GS6X 2XV3A 1AG6A 3IE9A 3WQJA 1I53A 1MG2C 1S51A 5B6WA 2Y03A 1SDDB 1WAEA 2GB2A 3OM3B 1AZNA 4QKTA 2OV0A 5A45A 3S8FB 1JVOA 1PY0A 2AANA 1ET5A 2HZHA 1X0SA 4N4YB 3X1GA 1BAWA 2ZONA 3AW5A 4DP9X 4FBZA 2YCXA 1CYXA 1MZZA 1AS6A 1UATA 1OCZB 3HB3B 3VGAA 1KBVA 1X0I1 2WSDA 5I6NA 3KJ6A 4OV0A 4RH4A 2IDSA 2IWKA 1JFPA 1QNIA 3SN6R 5G36A 3ABGA 3ERXA 3ABMB 3ZX1A 2DWTA 3HANA 1YLBB 2VW7A 4L6RA 2ZXWB 4J4QA 3DIVA 2Z55A 4GP5B 1OCCB 3NYKA 5PCYA 2JXMA 5J7AA 1ZDQA 1BRRA 2CUAA 5AX1A 3FQ2A 2WJLA 3OMIB 1NICA 5ANHA 4F2FA 1L0MA 1PY6A 3WG7B 3WI9A 3UZAA 1KV7A 1KGBA 4E9SA 3MX0B 5D4HA 1ZV2A 4AMIA 3AYNA 3FU7B 2GC7C 2L6XA 3NSDA 2XV0A 3NSBA 4HCFA 4M4RB 1ASOA 4L35A 2AT9A 1O0AA 4IAQA 1AIZA 4W1TA 3SBQA 4A2GA 5E9NA 1XJIA 2XWZA 3HARA 1PF3A 1NPJA 1OCOB 5B2NA 1S53A 4IB4A 5JJEA 5B6ZA 2MTAA 1JGJA 4AI7A 5D4IA 2NRDA 1PZCA 1RKRA 2YQBA 2JFCA 3X1NA 5AKRA 1R84A 1QKOA 2R7EB 1V55B 1GU8A 1ASQA 2QDVA 2PEDA 5F8UA 1OE3A 1FA4A 3S3DB 2ZIYA 1PXRA 3ZEVA 1CYWA 1E5ZA 2P80D 2YAPA 4WAVA 2ZWNA 4DPCX 4DPAX 3QJUB 4EIYA 1A4AA 1KGYE 1A4BA 4HCGA 4YSRA 4YSUA 4TL3A 1N68A 1AS7A 4YSDA 4PAZA 1L9HA 1A4CA 4GRVA 1GYCA 1ZIBA 5B3SB 1NIEA 1GUEA 1A65A 1F4ZA 5FJGA 5B34A 5AX0A 2AVFA 2H3XC 3T45A 3EH3B 5DYSA 4AKPA 1CUOA 1TEFA 4QI1A 4UG2A 4DP5X 3AZUA 3D4SA 4X32A 2TSBA 1EZLA 4QIDA 5JJJA 3HEIB 2PPDA 3X1EA 3FYIB 3FU9A 3NJNA 4XTNA 1ASPA 3P0GA 2IWEA 1JZGA 2PPCA 2HLEB 1PAZA 2BRDA 3EH5B 3UACA 3ZPRA 1GY2A 3FPYA 2F95A 5I5IA 3NJIA 5AHYA 2BP8B 3MBWB 4HYXA 4DAJA 2YXWA 2FWLB 1QLEB 3WIAA 3X3CA 4JKNA 1Q5JA 2YAFA 3X2QB 3ZPQA 1FWXA 2BP0A 4UAHA 2BO0A 1J9TA 3RYMA 1RZQA 1M9WA 3JTBA 3QQXA 1H68A 2YAMA 1Q5IA 4YL4A 5AHZA 1QM8A 1ETJA 3UABA 4MD1A 2Y02A 5DHGA 1F88A 3VW7A 2J56A 2OJ1A 4GYBA 4BEZA 1NPNA 1PLCA 1XB3A 4YVNA 1AZBA 3ODUA 3VG9A 5A7EA 4YSTA 1L9TA 1C8RA 1VJMA 1AAJA 2NTUA 2YAOA 4HAKA 4G71B 2HRHA 2XLLA 1AQ8A 1XMEB 3SBPA 1HFUA 2EIMB 4MQSA 4F7KA 2B3IA 4UANA 1GS7A 3OMNB 2AZAA 3AM6A 1IW6A 2IDTA 1J9QA 1VLXA 3QJSB 2DYRB 3X3BA 5ITCA 4GXFA 3NJHA 1KG8A 3T6VA 4KNSA 4FA7B 3SQRA 5H2MA 4JR8A 4WW3A 1KMEA 1BYOA 1J9RA 2UX6A 4P5RA 3TBCA 4BXSV 2GHZA 2R7EA 8PAZA 3UTVA 2VT4A 5H2NA 1RZPA 3TA4D 3CDZB 2AZUA 3FQYA 1H2SA 1S54A 5B6XA 1E0PA 1ZDSA 3NSCA 3QPKA 2IDUA 3PDSA 5EN0A 2FT8A 2VM3A 4BEYA 2Y1AA 2VM4A 1JV6A 1BEXA 1PCSA 2QPEB 1JZHA 3QJQB 1KCWA 3ZDWA 2IAAC 1AZCA 3FSVA 1MDAA 3ABWA 4IARA 4JQ6A 1PMYA 4YSAA 1P8HA 3ABKB 3ASOB 4GP4B 4HYJA 4Y9HA 3S3CB 1AANA 4UF7C 4HWLA 3T71A 3ZIYA 2XXFA 1JERA 2PPEA 1NDTA 2FQGA 4BDVB 3A7KA 1WA2X 5F7AA 3WKQA 4DP7X 3AG1B 3OD3A 3N2JA 3QJVB 1VGOA 1BXVA 2BP0B 3L45A 4YSCA 1SJMA 5H2OA 2XX1A 1NIBA 1IBYA 2CALA 4YVUA 1AACA 2Q5BA 2BP8A 2DV6A 2YAHA 4N8UA 3GYRA 1GS8A 2H47C 5FC9A 2A3TA 2PLTA 4WTQA 7PCYA 5I6LA 1OE1A 3NJLA 2PPFA 2JKWA 4XT3A 1TU2A 4BWBA 1JZJA 1W8EA 5I6MA 4YSPA 3FT0A 1SNRA 2OCCB 1TN5A 4CSZA 1ZPUA 1B3IA 2EINB 4N6HA 2M3GA 5ITEA 2FT6A 4KNUA 2I7SA 4X4KA 1L9RA 2ZZLA 1URIA 3FS9A 4HCIA 3OQRA 1E5YA 3PXOA 6PAZA 2XXGA 2ZFEA 2H5UA 1C3WA 1FBBA 3IBOA 4DP2X 5LDUA 2YDOA 3NY9A 2ZOOA 3CAPA 1RCYA 4NAJA 5H2JA 1X9RA 4TXVB 3HAOA 2HX9A 1BXUA 5EHFA 2XYBA 3NT0A 2Y04A 3UZCA 1AT9A 4GP8B 1JVLA 3QJRB 2I7OA 4MD2A 5C1MA 3NJFA 3QBIA 2MRYA 2PPAA 1S52A 3CODA 3QJTB 1FBKA 3TASA 2EILB 3NJKA 1HAWA 3HAPA 4A2FA 2FQEA 3QBGA 1WS7A 3CDZA 3QAKA 5G2AA 3FSZA 3PPSA 3MBVA 1JXFA 4YSQA 2EIKB 3PAVA 3TBBA 6PCYA 3JT2A 4N4WA 4FPDA 1OE2A 1BRDA 3OAXA 2CAKA 2FQDA 4E9VA 4KNFA 5ETZA 2BW5A 4GYCA 2HX7A 3OE0A 1UAZA 5I26A 1AZRA 2BZ7A 1AG0A 2UXVA 4DJHA 5B6VA 4KO7A 1AOZA 1KG9A 4P5SA 1IKOP 1KBWA 2BW4A 2RACA 2XU9A 1NWOA 2RH1A 4DKLA 2UXFA 3H4HA 2BZCA 4PXFA 2X87A 1PLBA 2CJ3A 3AYMA 3CZUB 1S8JA 1JZFA 1SHXA 4BDVA 1ET7A 2YCZA 1XIOA 2HXAA 5B1AB 3T9WA 1MGYA 2I20A 4K5YA 1M0MA 3PXLA 5I6KA 1E12A 1TEGA 2WO2B 5H2HA 2IWFA 2X72A 3IN2A 5G28A 1GZMA 2JAFA 5G54A 4KLYA 5B1JA 4DP8X 4DPBX 4HHWA 3EF4A 1M56B 1BQRA 4QLWA 9PCYA 1XB8A 4EJ4A 1P8IA 4AKQA 4GBRA 2KSBA 3HASA 1E67A 1TKWA 1WA1X 2VW4A 2GBAA 4F2EA 3CVDA 2WJKA 3NJGA 1TN0A 3C75A 1JV7A 4MFHA 4KNTA 1SHWA 3VHZA 1NTDA 3SBRA 2W88A 4G7SB 3PQRA 1PZAA 2DWSA 1M0KA 1CC3A 1GR7A 2W8CA 1NIAA 4E9XA 1HZXA 3C9MA 3NSYA 3QBKA 5H2IA 5BR5A 1BQ5A 2XUWA 3FSAA 4DP0X 4LDLA 1A8ZA 1KDJA 2IH9A 2VSMB 3CVBA 5A8EA 1OOWA 3S3BB 3KW8A 4HIPA 3UGEA 2YCWA 4E9WA 4BWWA 4KOBA 3COCA 1W6LA 1BRXA 3AG3B 3AY2A 2HX8A 2QPDB 1BQKA 1IBZA 4G72B 3PAZA 5D4JA 1DZ0A 2EIJB 3PAUA 4BVNA 1GY1A 1R1CA 2VW6A 1QHJA 2YXVA 1U19A 2UXTA 5A44A 2XVBA 3V9CA 3GDCA 4NC3A 1JZIA 2G87A 4GPOA 1IUZA 1PLAA 5TGZA 3QBLA 1ILSA 1C8SA 3ASNB 5B7MA 3FYEB 3CG8A 3OE9A 5IY5B 4A68A 1PXSA 5G53A 5G2CA 2CBPA 3DDLA 1V54B 3X1FA 4AKOA 3UTXA 4ZK8A 3VVKA 3ABLB 3DTUB 4HHGA 5B1BB 4AMJA 3AG4B 1AR1B 1DZEA 5I6PA 1IC0A 2YAQA 1OV8A 1NZRA 2I21A 3FPXA 3REYA 2HRGA 3GXUB 4KO5A 2I85A 1S8LA 4AX3A 1HAUA 1X9UA 4BWTA 3V2WA 3RZEA 2GI0A 1KYAA 2XV2A 2X88A 3HAQA 1BYPA 1UCQA 1DYZA 1NWPA 2P80A 5B7EA 5H2PA 1KDIA 3BQVA 1PZBA 2IDFA 2YAEA 3WKPA 5B7FA 2DY2A 3EH4B 4E9YA 3UONA 4E9TA 3RFMA 4EA3A 1JXDA 5I5JA 4XT1A 4A2EA 5H2LA 5B35A 2DYSB 4ENZA 4YSSA 5B1JC 4MBSA 2UX7A 2VMJA 4YSEA 1F50A 3X1BA 5B6YA 1JXGA 1AS8A 4DP1X 5AFAA 4QRYA 2FTAA 2VSKB 4HALA 4YSOA 4XXJA 1AP9A 2GSMB 2I1XA 1ET8A 5BR2A 1N70A 3FSWA 3G5WA 3TU6A 1WS8A 3NJJA 3UTYA 2IDQA 1ZIAA 3DKHA 1J5CA 5AZUA 1A3ZA 2R4SA 2PCFA 4KO9A 2HPYA 1E30A 1OCRB 3T6WA 2F93A 4LDOA 5AWZA 2FT7A 1FFTB 3N55A 4DP6X 1KCBA 2Y69B 2AFNA 3FU8A 5JJNA 1P8UA 4JKVA 1SF5A 2QT6A 1R2NA 2Z73A 1W6WA 3IEAA 3UTWA 3S8GB 3H56A 1IXFA 5G2DA 3AG2B 3OMAB 2WO3B 3T6XA 1AZUA 4BUOA 2PP9A 2PP7A 2TSAA 4K9JA 4WKXA 5F7BA 3V9EA 1L9SA 1ADWA 2PP8A 4Q8BA 4W9ZA 3WNJA 5TK4A 2E86A 2NTWA 2KSAA 1SFHA 2FQFA 4A67A 2B08A 3ZBMA 4CSPA 1OF0A 1PNCA 3OE8A 2LLNA 3UAEA 4NERA 1BXAA 1IW9A 3EMLA 3WNIA 1PNDA 2N0MA 1EHKB 5KKHA 4GY4A 4M3HA 1SDDA 2GIMA 3CVCA 5AZDA 1MZYA 1ID2A 3PCYA 5H2KA 3NYAA 4XTOA 4A2HA 4A2DA 2LNLA 5LWEA 1JZEA 3NS0A 3VI0A 5DHHA 2UXGA 2IH8A 2EI4A 1GSKA 3UG9A 2QDWA 2J4YA 3UAAA 4A66A 2YCYA 2FJSA 2BHFA 4DP4X 2BWIA 1QHQA 4BK5C 4MQTA 1CURA 5B0WA 4PXKA 1T5KA 2VN3A 1JOIA 3NP4A 1BM1A 1L9QA 1SFDA 1ILUA 3OE6A
chains in the Genus database with same CATH superfamily
4MMXA 2OP4H 4PCKA 3U9UA 2P24A 3CZGA 4WWNA 3VNYA 1LN6A 2NNAB 2KS9A 3VE0A 1MI5B 2QQNH 2IF7A 4QWWC 3GB7B 1RK1A 3ZUNC 1E5UI 1PCXA 1PG7W 4WFFD 3AWGA 1MCRA 4I9WD 3ARWA 1IL1B 3OHXC 2WXPA 1MCSA 1UCBH 3CZNA 4Z7QB 1JWUA 2VDML 2AJSL 1OPGH 1JV5A 2VIRB 2XWTA 4ALAC 1CLCA 1LWJA 4G70B 3SKUD 1DBML 1E8WA 1IGTA 1L0PA 4MXQC 3NRPA 3NP3A 3RFRA 3GJFA 2IH1A 4L4TB 3ELQA 5E2TH 1NOAA 2IFGA 4LCCA 3PE9A 4LHUG 2BWDA 1WUZA 3R1GH 4J4PD 2YUWA 4XMWA 3K2UH 3ZHLA 1FGNL 4PJDF 4B9FA 5CSBA 2BVPA 2LR4A 1CDJA 1JG9A 2EEAA 2XC8A 1R5VA 3OL2A 1HH6A 4UILL 2BRRH 2DQFA 5EU6E 5SX5K 2X4QA 2V5MA 4H44C 2YEQA 3ROOB 3WO4C 4F57H 5D96B 5KSAD 4M4PA 1QEWA 3FTWA 2AAVA 5ID0A 4DP9X 4GI6A 1NGYB 4LSQL 4PRPE 1PZ5A 2W9DH 3RX8A 3MNZB 3OWRA 1OCZB 3ARGB 4HJ1A 2WLIA 1JPSL 3L4XA 4H0LC 3UZEA 1W2KT 1SVCP 2JCWA 1N4XL 2XWBA 4GMSL 2GEEA 2O5ZH 3RX7A 4AH2B 1LM8V 3O3DA 1E7UA 4PGBB 4RFNC 1A6WH 2SODB 4KY1H 3VA6A 4AZ8B 4H20H 1T1YA 4P9MH 5DQ9A 1S4IA 4FQXD 1ZDQA 4XNMA 3ZW3A 2ZSWB 1JGDA 2RJMA 3FQ2A 4OSUL 3LKNA 2ADFL 3RDTA 3FU3A 1YMMB 3ZYJA 4PJAF 1U8QA 4YGVB 4ZAKA 3D85A 5FA3B 4JM2A 2W81C 1BVLB 5DI8B 1ASOA 1FVCA 4P2QB 1K5NA 3EO9H 4BZ1L 3HARA 1W0WA 1I9IH 1NPJA 2VDKL 2BOCA 5HHMD 1XGQB 2Z7ZA 1K5WA 4PHZA 2BVTA 1TVBB 3SD2A 2HMID 2A6DB 4DGIL 5F7NC 4J27A 4JUSA 1KIRA 4WFEE 1KF9B 2Y23A 4G8GB 4PS3A 5DHYA 2VLKD 4OQTL 4LL1A 5DVKA 1NAKL 2EDTA 3B37A 3X12B 1LDPL 1AH1A 5DQJA 3FO2A 2D0HA 4J6RL 4Z9KB 4LEOB 4Y4FD 1WIPA 3ZE0F 2QKIC 4AQ1C 4MXWH 4R7DB 2ZIDA 3I75A 4MZ3A 4P5TD 5D55A 3RVWD 3I84A 4AYFB 2ENQA 4H25A 1TYRA 3BC9A 3ATEA 3RKDC 4UDUA 4HGMA 2BIMA 4DAGH 4BZ2L 3PGFL 1KYUA 3BKYH 4OLXL 4QRRA 3KXFA 3BW9B 1B9ZA 3FO1A 1BFVH 3W39B 3IB4A 1H3PH 4HYXA 2YXWA 1TUPA 1N5YH 3X3CA 1TF4A 1D5IL 4L1HA 2ZG2A 5AW2B 2WP3O 5FGSA 5C07E 3UBXA 3WD5L 4AEIH 5TE7H 3DXAA 2Q76B 2W5PA 3VI4A 4ABUA 2MCPL 2NTFA 3W1ZA 2M83A 2LGNA 4BGDA 5AVYB 4OM1H 2NQCA 3G5VB 3JT0A 3QFJE 3EGSB 4XXWA 2CDEB 1EZVY 5IMMB 3ODUA 4YX2H 5F0LB 2ZQKA 4G5ZH 3I3EA 1F00I 3SDDC 4G7VL 4YHIB 4N0YL 1NCHA 5DD5H 3FCBA 5IMOA 1ORQA 4OIFA 3OMNB 4GOSA 3IDXL 3QDME 4JFEA 1MKFA 5DZLA 1A3RL 5JPMB 4TVUA 1A2YA 3IKCA 1HXYA 2G9HB 3QAZB 4DVRH 1KBGH 2YD6A 2YQ3A 2JTYA 3PQYB 3LZQA 5L2JA 3EXLA 3BD3A 3TFBA 3BUYB 5FF6B 2GHZA 5AYTA 3ZOAA 4HH9A 2NY0C 4JFUA 1ZSDB 1FIGH 1EMTH 3NVQA 3MV9E 1UD6A 3DROA 5H8DA 3VW3H 3UJIL 3V5DA 4OVVA 4KDVA 5EF2A 2MCAA 3NSCA 3SKNB 3REWB 2BIIA 5IBLD 2YA2A 4CC1A 5DZAA 5BS0E 1S7QA 25C8L 4KJPD 1ZE3H 1INQB 5FYLE 2Q7YA 2YWZA 4IARA 4MNGA 4JQ6A 1MOEA 3ZKMC 2EO1A 1ZWIA 3RA7L 4HD9A 1Z9LA 4NZFA 3ABKB 3JVGA 1X4XA 2R0WL 1FCCA 3UP6A 5EFIA 4GS7B 4PW9A 3NEOA 1WZ1H 1FAIL 2FQGA 2B5IB 5F8RC 2VH5H 3LZOA 5E8OB 3VFMB 4YQXL 3QEUA 1BXVA 2JCCA 3RNQB 4MXVE 2EACA 1GGIH 2BZDA 5H2OA 4M1CC 3HB3C 5DUML 4EIZC 1NBZB 3ILQC 7PCYA 1YDPA 5I6LA 1G4MA 4BFIB 1MREL 4EPSA 3KGUA 1E43A 3L4TA 4HIEA 3BUBA 3JQOB 4ZFFB 1NBVL 3P3YA 4EQ3A 3HPLB 3BN9C 1F2XK 1ZPUA 4PJ8B 1UYWL 3PNWB 3VYOA 2GITB 1AC0A 4YO0B 3ZRSA 4DJMA 3ULUC 1NGWB 1S7RB 1YAIA 4NCC1 5DJDA 1QBAA 1FBBA 3QIBB 3V52L 3KYKH 4NAJA 5CD5C 1X9RA 4QXWA 2OR8A 1BXUA 4TOYH 4LKCB 3SDCB 3G6DL 2AK4E 3P2TA 4P07A 2AJXL 3QJRB 2I7OA 5D2LE 1VFAA 2OS7A 2UZXB 5KSVB 3TURA 2L7UA 3CODA 4UQDA 4DIXA 3WO3B 3FT3B 1JGEA 4XMVA 5GRXG 2Y07H 5HI5C 4HJUA 3KPSD 5HGBB 4OW6A 3QW9A 1JI2A 3QDGB 2XZCH 2IOOA 2NDGA 1E2WA 3ZZLA 4C4KO 3OAXA 2ZOLB 2ZUSA 2APTA 4CW1B 5DRNA 2BNRD 5EBWB 3VTTA 4ISVA 4WO4B 2D3LA 4NO0D 2NZ9C 1WSST 4JY4B 4Z3TA 5JZ7D 3L3OC 1YG9A 3IFPA 3B2XA 3QK0A 4TNWK 4PV8A 3GSVB 1I3UA 3QSKB 4LVHC 4AQAB 2OTPA 3STZB 4IKKA 4ODSL 5TQ2H 4PCSA 1MJJB 3KWTA 1KCUH 1MCOL 2HXAA 3WKNA 2ZWZA 4X5WA 3OKNA 4ZO6A 4B9ZA 5EN2A 3PL6B 3N40F 3L5XL 1S7XA 1P9MA 2ZKHL 1JF1A 1NGXB 4U1KB 5E5RB 4M8VA 4C8XA 4X7FC 1QRND 3AM8A 4XVTH 4HCRA 4IU2B 4NUQA 3S2CA 2KSBA 2X6CA 2YBRA 5EZLB 2R29L 4NN7C 3BFWA 4KNTA 4DCQB 3ZYIA 3BWUC 3OZ9L 3S5LB 2KPNA 1MFAL 5GGQH 3KH3A 1PLGH 3B1TA 2ADJA 5CR1A 3PWPD 1XBDA 5TJWK 3RGBA 5LJYH 2ISDA 3S98A 3EBIA 3PWVB 2WAQA 4UV7L 1E4XH 2ZXQA 3MUGB 4BWWA 2WWNA 5F7FA 2CIIB 4X9YA 4UT7H 4AUJA 5GXBB 3PRZA 4HS8L 1NCNA 2VOTA 3CMOH 3C8KB 4K94L 3MFFB 1VACA 3P30H 4IYKA 4JKKA 4N6RA 5F9OH 4XE0A 3QP3A 3UZQA 1JZ7A 4NC3A 1JV2B 2YPVH 3TV8A 5GHWH 5TGZA 5F97E 4MMZB 3S96A 2YRPA 4Y16B 3RWFB 2ERJB 4Q4IA 5GS0D 4HUMB 1KCKA 4HJGB 3V8OA 2DWXA 2ORBH 2LFEA 3IMUA 4XPBH 3LHPL 5J9PA 3KLAB 2WAHA 2FX9L 3AG4B 4B3VA 3K0WA 1IGML 2DWDA 2E8ZA 2OMUA 4PJAE 5A6LA 3WE1A 2HRGA 4BH7A 2HA1A 1ETZB 3RZEA 2C9RA 3D9AL 4KVNL 4ABQA 4WWID 2P80A 1CGSH 4JM2F 4U3HA 5D71H 5L6YH 2NY6B 1QYGL 2BSRB 3CFJB 3D39E 1TCRB 2GAZB 5HYJA 1DJHA 4E9TA 1HHGB 5E2WL 4MQTB 1XZ0B 4ZXBA 4A2EA 5ALCH 4NKIH 1D5RA 4M93C 4J4PC 4KXBA 5E03A 4L8BB 1MRFL 1Y0LA 1YC7A 1G7LA 2E9JA 2J12B 4LLWA 2N0KA 3LRMA 3D2UA 2C26A 2G2NA 4NOFA 2GSMB 2BMKB 4HMEA 4M8UA 3VXUD 2C1OA 3ZE0E 5KSAC 1HU8A 1E3ZA 2J4WL 4XP1H 5BR2A 4OGXL 2I5YH 3IAPA 1X4ZA 2QGBA 3PPEA 4M7KL 5E1AB 3UPRA 2DYPA 2RMNA 4IRJD 4JDTH 1DVFA 2HUHA 4MZIA 2R4SA 2L04A 1FFTB 5FR3A 1I1FA 1YEFH 3ZRFC 1J1PH 3NA9L 4MAUH 1J0JA 2CGRL 2UY7B 3FU8A 4CMMA 3L5IA 3K80A 1W6WA 2VDNH 2YKKA 2APXA 3PGCA 4FQXC 1LHZA 5FO7B 4Y1AD 3GSRB 2AQ3A 1FLTX 2V9TA 3RTQD 5IT2H 5F6HI 2J2ZA 4IOIA 5F89A 1T83C 2JKXA 1KELL 2OMTA 1OF0A 3UTTD 2E8YA 4EEEA 4XCNA 4PJ7B 3VI4F 3UG3A 3CIQA 1ID5I 4DTGL 1QW9A 4POZD 5INDA 1IGCL 1A1NA 3APCA 5KKHA 4E5XG 2Z7YA 2CDFA 2X89A 1SDDA 3C6SB 3HI6H 5BRZB 4I1PA 2HMIC 1BAFL 4W70A 4D8PA 4G6AD 4XTOA 2N7AA 1KXVA 3UCQA 1CFVL 5AUMB 1FZOA 1YJDH 4W9FC 5FKAB 5L2KA 4GRWF 4QIRA 3ARFB 3MA7B 1KN2L 2WVUA 2Y06L 1G7PB 5JR1L 3CFDB 2B15A 1MW1A 1KJ2H 4FXGB 5EUKB 4Y4FC 1I31A 2ATAA 3FT9A 4GBXA 5BV7B 1JPEA 4L3ED 3CVIH 4P5TC 1QSEE 1CVSC 2D2OA 1OO2A 3DMMA 4LQFH 1X5HA 1YEIH 5C0BB 5TK2A 1I7TB 1H19A 2Q3XA 3CPLB 2OMYA 3QPXL 3ZPDA 3AREA 4RRPG 2P44B 4LVNB 3OB8A 1XR9A 1FH2A 1ES0A 3NJMA 4C56E 3GXTA 4MS8D 5IR1A 43C9B 1NIDA 1SLXA 4P57A 5CO1A 4TTGA 4EZJA 2V2XA 3FZUD 4I88A 5C6TL 1A6PA 4P9HL 4S1RH 3QR2A 3QISA 4HUUB 1F3RB 1SPDA 2DICA 2WKLA 3FTGA 4OZHA 2ZTBA 4FAAB 3D2TA 5D7HA 5GGSA 2JCCF 3DO4A 4LLAA 1F5WA 1M05A 4Z6AT 5FPIA 4Z76A 1O9VA 4J8QA 1DANT 3WNNA 4A4MA 1T89C 3GBMH 3N04A 4N28A 3WHXB 5JQHC 2COQA 4QOKE 1YPZB 1R5WA 3O6KL 4HKZA 2R2BB 4P2RE 3SODB 3IAQA 5I30H 4Q58C 1WAPA 2I9LA 3ULVF 1FJ1B 1HZHL 1V3JA 1Q1JH 1ZVNA 2ESVB 2E76C 3IDYB 1W0VA 5IB1A 1JVKA 4A7UA 4XGZB 2F8IA 5KS9F 3BVXA 1PEZA 3FUJA 4QHUA 5CN2A 2G30A 5JIHA 1YEDA 4OV0A 3IDMB 3WFBL 3A3YB 3UTZA 3LEVL 3ABGA 5TH2B 3NDZE 4ZSOE 1KIQA 5IBLC 5EBGA 4CDHA 2Z55A 4KJPC 1T7ZA 4Y19E 4PLNC 2EVJA 2D03L 5TF1L 4OFVA 1IM3B 5CBEB 4MNQB 1L0MA 1FVEA 3FQXB 4CRPA 4P4RA 4YOKA 3DDFA 1V7ML 3MX0B 1D2PA 1ZV2A 3MUY1 4M7JL 1G5AA 2XV0A 1RK7A 4FTVE 3IDIA 3MBXL 2AT9A 1HHJB 1VHPA 2HPOA 1C08B 5H37G 3L3GA 4GKNA 4YUEL 4PHXA 3WKYA 5JJEA 4FJZA 1FNSH 4ZQKB 1HXKA 3QEQA 5T5FL 1PZCA 4LPWA 4L4JA 3S0PA 2VDRB 4FD0A 4Y9GA 4A6YL 3GBNH 1JTTA 2QJDA 1GOGA 1JPGB 3TT1H 1IQDB 4XVUD 4OIIL 3PWLB 4TQHA 3IU3A 2BNUA 3MLXH 1NMBL 1UD8A 3ULUE 4X6BA 1VPOL 1PU0A 1NC2B 4RSYA 5T5NF 1H6FA 5E2VL 4PV9A 4MHHI 1KGYE 1VZGA 2CBOA 1PY4A 2ZCHH 5E8NA 4WJG3 1IAIM 2VCOA 5C0JA 4Y2DA 1ZIBA 4MCZA 5K93A 4LVOC 3W0WE 1F4ZA 2ATKB 5AX0A 3NQKA 5BPPA 3O6LL 4TUKH 4ONHA 4O02A 3E8UL 4HJTA 3FCTA 3CFTA 3MRRA 1T21A 3G5XB 1L7IL 4H2AA 4UQ2B 4KROB 5K39A 4JHAH 1XXDC 3IK2A 2AEPH 3ZPRA 3FT4B 1X5KA 2F95A 3IETB 1I7UA 2GSIB 1B4JH 5L7XH 2IAMB 2DKUA 5AKSA 1FWXA 4MWFB 2A6JA 4HETA 3JTBA 2DJUA 5D7IB 3NCCB 3DJZA 1XGZA 3MLRH 1XR8B 1OALA 4BA0A 5JZ7C 4X6CB 1XB3A 3HHSA 3VG9A 5DRZB 4Z0XB 3WJMA 4B96A 3LKPA 2F61A 3WSQL 5I19L 5J0BA 4OLWH 5FK9B 5C0GA 1TZHB 4CKVX 1NCCH 1FYTD 2IH3A 2ZOKB 4BRJA 1AQKH 1J9QA 1MHHB 2IDTA 3O4LE 2CKBL 1K4DA 3MROB 5T1KA 4NKOA 5EZIL 2VMEA 3WU1A 1PZ3A 4EOWL 3IT8D 4JR8A 4GKSA 1R3KA 2UX6A 1FDLH 5DJZA 2ZWSA 5GPRA 5IMKA 1IAKB 2ATPB 1U36A 5D1XA 3VG0H 4TQ8A 3BDYH 1CGTA 1PPIA 1XGYH 4M48H 3RPIA 3V6FA 4PJCA 1CBVL 3NTCH 4AE1A 5HHQB 2DQDH 1WFUA 4D0DB 2YMOA 4BEYA 4H8QA 2X4PA 1OY3B 2BOBB 3H9SA 1ZLWK 2E47A 1PFOA 1UWEH 5CU5A 1UXMA 3ABWA 1BIIB 2GI7A 1Q72H 2GHWB 1AGEA 2OJZH 5D8JL 1Z0NA 3ASOB 5EA0L 3MREA 1XMWA 3ULSA 2AEIT 3VU2A 2QFRA 2X9WA 4PJ5D 4HWLA 1SM3H 5C2BL 5CN3A 4PBWD 4J3XA 4UNTA 3UJTL 4UIMA 5AKTA 3VVVA 3GMQA 4BJLA 2R2EB 2O4EA 4OT1H 4YSCA 1WF5A 2QBWA 1B0RA 5DSCA 1KB9J 2OP4L 1DCLA 4LEXH 1EV2E 4IJTA 4PGEA 1BOGA 4WFFE 3QORD 3NJLA 1CLOH 1DTUA 4XHJD 4W4OA 1TVHA 3O4OB 5CCHE 4BWBA 4AVHA 1PVHA 3MRMB 1TN5A 3SE6A 5GS0C 2ZUUA 2Y7NA 1TKWB 5EIIB 2FT6A 3KXFE 1ACYH 1SJEA 1UCBL 1FN4B 1NFDA 2OR7A 2F15A 3ESMA 3WMQA 1BVNP 2O61B 4BE5A 1OPGL 3FONA 4GUPA 3LX9A 4NXSA 2EVFA 1D7FA 3EG9A 2ENYA 3NY9A 1I1AD 2ZOOA 4GAYA 5LG6A 4NQDD 3VI4E 3RWHA 3UTSD 1XEDA 2DM4A 5ISZD 5E2TL 4GEJA 5MP6H 3UZCA 3CFQA 1U3YA 4WW1A 1S9WA 3QBIA 3WIFA 3LS5H 3R1GL 4TQIA 4EVNA 2OMXA 5DT1H 5AL0A 3GS7A 5AYUH 3K2UL 3SCMD 3AS2A 2Y7SA 1UQSA 3CZSA 3VXOA 3FK3A 1E3XA 2VMFA 5I73C 4GRWE 3W9DB 1KLGB 2BRRL 5LWYL 3Q13A 4UU9B 3MRCB 4F57L 4EJ1C 5KUMA 3EOAB 4LHUD 4Y5VC 2EDRA 3T0DA 3DOSB 4JFEE 1ZHNB 1RPQA 4Y4HD 5FUOH 2J5LB 2DMGA 3JV0A 2W9DL 2ENJA 5BMFH 1QLFB 2H7WA 1E90A 4N87A 4QYAA 3PABB 5DK2B 1D5ZA 1T22A 2BY3A 2DQHH 2G5BA 3QUXA 1ZHKA 4GQZA 4PJBB 4Q6IA 5CP3H 5I26A 5AG9A 5FB8A 4FXTA 4IRJC 4RAVB 2IFFL 4PWJA 1KBWA 1RZGA 2O5ZL 3IYLW 4B9CA 4U6YB 1A6WL 2K6WA 4BDVA 1VEMA 4KY1L 4H20L 1XL4A 3CTTA 3KG5A 3II3A 4JKWA 1KZYA 4P9ML 5KANG 2UZYA 3B6SA 4NZDA 2XN2A 5BXFB 2HJKB 4OH2A 4MNGE 3ZR6A 2F7RA 1M6OB 2O30A 1H9VA 4JNXA 3RTQC 2A9AA 1S3KH 5G54A 1GZPB 2Q3ZA 1SDAB 1CI3M 1NM9A 1UXSB 4I18B 1LP9E 4MMYB 4F37F 5HHME 3BEVB 3EJTA 4NJ9H 4X98B 4XC1H 3U36B 6CGTA 3EO9L 2NSMA 1IC7H 1H3XA 1I9IL 3TO2B 3MUHL 1FV1B 7FABH 4POZC 2DQGH 4OZHF 5FCUH 5CLWA 2ZYIA 4C55A 2ZICA 2DWSA 2F8OA 2V2TA 4GT7A 4XAKE 1FZMB 1KGUA 4GIOA 3F6LA 2XUWA 3FC8A 4UZGA 5IKCA 1QUPA 3CFBA 3NSJA 5T1DH 5JW3H 2X42A 2PCFB 4IRSB 3B9AA 4XMUA 3TBTA 5C3TA 2XVKA 3RGVD 3ULVE 3LH8A 1JXKA 2R23B 2HX8A 4MXWL 2DB8A 3PNRB 4KDWA 3RB5A 3P3TA 4Y4KC 3I6LD 5GZND 2EJ1A 4ODWA 1CE1H 3NPSB 5KS9E 1S5HB 1XGPA 5I8EA 2HVBA 1F4WH 3H7BA 5A16B 1BFTA 1PG7H 5C0ND 4F8PA 5C0IA 4OCRH 4DAGL 1YEHH 5I1AA 3BKYL 4QPEA 3IVKA 3RWCA 3HAEA 3ZMNA 4IBUA 1V54B 3CHXA 3T4AC 4MS8C 4Q6YA 1BFVL 4V1DD 2XZQH 4MB4A 1P7QA 2B59B 3J27A 1H3PL 3UC0H 3FZUC 3CBKB 4Y8AA 4ADGA 4U6TA 1N5YL 1IC0A 3DX8A 4Z23A 2P8PA 5TE7L 4X8CA 4JQVC 1GGTA 2E56A 2DQJH 2OSYA 1KFAH 5KSUA 3IPBA 2J1WA 3FRPG 4LHQB 4OM1L 4YHKH 2QPFA 1ANUA 1PG7X 1PZBA 2FX7H 1NKRA 4HLJA 4HUKB 1SQ2N 3VD4A 3L48A 3SE3A 1H3WM 4YX2L 3DVGA 4G5ZL 4P49A 1S9YB 4WTZG 1U8MA 3TZVD 4K5MA 1BWWA 3VH8B 5DD5L 4HWEH 4YSEA 2FEJA 4AYID 4EI5D 2VWEC 1WFMA 5T1JA 3HPJA 3QS3A 4PRHD 4JCLA 1A02N 4DVRL 1MXGA 1RZIB 3IGKA 1X44A 1BZ7A 3MO1B 3HA0A 2Q8BH 1WS8A 1VKXA 1RK0B 3CWGA 5EO9B 1FIGL 1EMTL 1EFXD 4F7TB 4JY6B 3VW3L 1H6EA 3T6WA 4EIGB 2G3MA 5E99H 4LDOA 3N55A 3EJUA 5DJ2A 1P1ZA 1CBJA 2Q3AA 4NEHB 5I66B 3LQZA 2PWDA 1WP6A 2Q7NA 5CP7A 4WDIA 3V6ZA 1TR7A 2KQMA 4PR5A 4WKXA 3IGAA 1NFAA 3U0TA 1MIEH 5E6UB 4BFKA 3KLHD 3K6DA 2PWGA 2X4TA 3RHWF 5TDNA 1WZ1L 2K4WA 5DJYA 1CFMA 2BHYA 2VH5L 4YPJA 1UVQB 5FHAH 1BDYA 1T04B 2F0CA 5CKGA 5C07B 1GGIL 1FZJA 2YJLA 1BXAA 2KDGA 5CSGA 1EHKB 2Q86B 3F3HA 1G7JA 2OX5A 4YE4H 4XNUH 1MZYA 3QFJB 1CD8A 3A0OA 4H26A 1KCVH 3AB0C 4JN2B 4XVUC 3VWKA 5FECB 4LLYA 5AAWA 1TZIA 3NCMA 3F7YB 5KYYB 5FYKH 1WITA 5E1GA 1AFVH 3Q7JA 1TTRA 1HHIB 1QSFD 3QDMB 2B8OT 3LKQA 4NWUH 1IAIH 1U8OA 3KYKL 5AVVB 2V7NA 1A9VA 1U8HB 2D9CA 5ITFB 1J1OH 5B22A 4TOYL 2YPLD 2ZAIA 4JPQA 2DD8H 1S5IH 5J1AA 3MV9B 4PJCF 2GEQA 3RL1B 2ADYA 5HYJE 3BZ4B 2RHEA 3NFPB 1KPUA 5DJ0B 5BUGA 4IBSA 4LDEA 3D6GA 1J0IA 4X1HA 1L9OA 2VUOA 1GKEA 2XY2A 3M86A 3CDGA 2XZCL 3DQBA 5T3ZH 4NZJA 1F56A 3WMPA 4P3DB 2JIXD 5DJ8A 5DEJA 3RBGA 4JMNA 1JPFA 2ED7A 5JW4Q 5SX4H 2FAUA 2VXQH 3CD4A 3S36H 3F65A 4L0PB 1WFNA 4N24A 3HN8A 2WSKA 1MLCB 1A9EA 3Q44A 5LCVH 1JFQL 4M62H 5IROD 5LNGA 5TQ2L 2Y03A 4UT9A 2DIJA 3REVA 3FUIA 1KCUL 5E5UB 2HPTA 1CQYA 5B1CA 4PJIB 4F8OA 1MNNA 5C09A 1DFXA 3B3IA 1BA9A 3KPLA 3S37H 3BDBA 1VGEL 3TJEH 3DYMA 4XN5A 5CEZE 1MZZA 3S36X 1UATA 2PO6A 1RP8A 1ICTA 3LMJH 5IV2A 3BWZA 4MDIA 4IDJH 3IJSA 4RFEB 3O9WB 1RERA 1IT9H 3TEZA 3ETSA 1DN0A 3HANA 3EZJB 3KWUA 4WU7A 1DVTA 2AK4B 5GGQL 3MRDB 5CSZB 4XR8C 4Z7VA 1PLGL 3GF8A 5C6PB 2HAZA 2HRPH 2EC9T 5L2KE 4KXZI 3PDOA 5KSBA 4NNYA 1E4XL 4O2FA 1E5AA 2A4ZA 3HC4H 5A1AA 5HY9B 2D31B 4UT7L 1YMHB 4D9RD 1UZ6F 1OK0A 5GISH 1P2CA 3OG6B 1WQVT 1U3HA 3S97C 4PRNB 2J8HA 3CMOL 5I76A 4HG4J 4OZIA 5I2IB 2DQTL 5MERA 3P30L 1S53A 5F9OL 1BZQK 1TO5A 2YRLA 2F58H 2NY1D 3EO1B 2X6MA 4NPYA 4U3SB 5D4IA 4DFHA 1SXNA 3RWDB 2YPVL 5GHWL 2YR3A 1OM3H 4W9HC 2CRMA 1R84A 4HJIA 3QORC 3V4LA 3DX9A 4XHJC 5F7DA 4BQ9A 1WWWX 4JFFB 1QR1B 4ZW8A 3KH4A 2ORBL 4DPAX 4XPBL 1CIUA 4NM4H 3WTSA 5D4QA 3TVMB 1Z3RA 4WJKB 2MNWA 2JNZA 3QUGA 1SYSA 3SE4A 4G8FA 1P53A 5DUBB 3HS0B 1J9CT 2N01B 4C4UA 4U05A 3MV7D 5TF0A 1I1AC 4CGTA 1CGSL 1G6RH 5D71L 4LQ1A 5L6YL 1JBJA 3D0LB 2CD0A 2FL5B 4OZHE 4L29B 1WIOA 5ALCL 1A6ZA 4NKIL 1ZT7B 2X4NA 3O3EA 1U4FA 4OCSH 3L4ZA 3SCMC 2WVVB 3MJWA 1JYVA 3VFUA 3H6AA 3G08B 3BYTA 4PJDB 2WTPA 4AXWA 3JUZA 5DS1A 3I3BA 4Y4HC 3MRBB 1CLZH 1J9TA 4XP1L 2I5YL 3DVIA 2QHRH 3I6GB 3U83A 4IBWA 4QKXB 3WUWG 1W8OA 1JNHB 1R3JA 5C0AA 4BA8A 1D5MA 4JDTL 2E6PA 5D2NB 5D5MB 3HR5A 2GBUA 2VDLB 2ZCZA 3HNTH 4ZUUB 1XIWB 1WV7T 1YEFL 1A7NH 4DP1X 4L1LA 1J1PL 4J3TA 4G71B 1A4JA 1ZJAA 4MAUL 3V95A 12E8H 1FFNA 2LE9A 3F12B 5DHVB 5J13C 3OSVA 1PKQB 2K0RA 3V0DA 2VDNL 4JQIH 5SWSA 4D7BA 2BCKB 1J8HA 3PV7A 2Q8AH 5IT2L 5EF0A 3I9GH 1I9RH 1Q38A 2FD6H 2QQKL 1G6VK 2PTTA 3UTTE 8PAZA 2ICWJ 4IGBD 1XH0A 1U3JA 2VT4A 5H2NA 3TA4D 4LKXB 3CDZB 3P02A 4XRCB 5LHDA 4PJAB 1EXUB 1FFPA 3ARUA 2BFVH 3MRHA 1PL3A 5J7CC 3HI6L 5CEYA 1JV6A 3T0ED 1PCSA 2IGTA 3QEQE 4WW2C 1PY9A 1EO8H 3DVFA 3D39B 4PWIA 1LWRA 5AVSB 3QUYD 1KBBA 4AGQA 1IBDA 1YJDL 5IW3A 4EBQH 4YSAA 2OTUA 4YXLH 4DNLA 1EGJH 3HJ0A 3O3BB 3KYOA 5BNXD 1I3GH 1QOKA 3QFGA 3QXDA 4FMVA 3QDJD 3RGVC 1KJ2L 1SJXA 5FDWB 5JTWA 1C5DA 4EDWH 4OFPA 5FYLH 3ULAB 2YOCA 5ANME 3CVIL 4ZD3H 2EKSA 4DO5A 4GAGH 1WEJH 5GZNC 2LOEA 4HK0B 4AQEB 3T0XA 2BP8A 2QV4A 3J8F7 2L7QA 1YEIL 2D7MA 4HS6B 3FMGH 1FFOA 4CJ1A 2AP2A 4J1UA 2I60L 3D4GA 3U6XA 5HDWA 5C0NC 3NCFB 4WWPA 2V37A 1DJXA 4Z5RA 5I6MA 3QIWD 3OKOA 5DQDH 1ETB1 3KMDA 3CAFA 3ASWA 1D6EA 2DQMA 4QI3A 3OQRA 4S1RL 3FT2A 1RU9H 3BCFA 4HX1B 4U6XA 4ZW6A 1DVXA 3O2DL 1E7VA 2CGYA 2COVD 2LQRA 2YK1H 5IIEB 5CZXD 2JJVA 5I1EL 4XH2B 1LMIA 3AQZA 3SBWC 3TCTA 3Q05A 2XYBA 1A14H 5SWZA 4NIKB 2VQ4A 4YHNA 3MRLA 1RUML 4WGWB 1G0DA 2VERN 4HXBH 4NOBA 4Z7UE 2GIYA 3GBML 2VWEE 4H0IA 3TA3C 3TZVC 4MAYA 3ZZQA 3ZTEA 4PP2B 1TDQA 4XOCA 1JZ2A 4EI5C 2CNZA 5I30L 4JHWH 2EIKB 3PAVA 4TNGA 5E70A 5EUOA 5HP5A 2MQ3A 4WI0A 4XVJH 2EEBA 3S35H 1Q1JL 2CK2A 3VFVB 2MHAB 3L6FA 4QHNA 5D7EA 4L0YA 2BOLA 3OPZL 4LPVA 1KULA 2BW5A 4PYHA 3WCYA 2C9VA 3OXRA 4DJHA 3IDNA 1S9XA 3E1ZA 3OJDA 5D1XE 4FI7A 1CXHA 1F13A 1UADC 3FRUB 2WVSA 4P2OD 2UXFA 3AAZA 1M71A 2JB5H 4H4NA 4IRZH 3AYMA 1I8IB 2AK1H 4PJCE 4B5ZA 3B9KD 1KFGA 4X4ZA 5DD1H 3H9SE 1G7HB 4ORGA 4PJGA 1XCQA 5H4YA 3T9WA 3S35X 5IQOA 1FL3B 4I2XE 4D2NA 2WO2B 5H2HA 3QA3A 1QI4A 5A6IA 4FHJA 1MY7A 5B1JA 4AJYV 3KLHC 2VC2B 4N2IA 4NUJB 2O1AA 2WO4A 5I17A 5GS2H 3QCVH 4KXCA 1HTYA 1ACCA 2FWOB 2VW4A 4HZLA 3N44F 3DVNA 4OF0A 5DC4B 1FNSL 5GGRB 1MCHA 4JFTA 4ENED 4IMLA 3LDBB 5FKPA 3LYRA 4NO3B 3MLPA 3GBNL 4YDMA 3MLWH 5E7FA 3AWEA 5HDBF 1B0GA 3TH4T 3TT1L 2I32A 4BFNA 3C9MA 5DGRA 3JTSA 3H2PA 2WBKA 5JDSA 4EE2A 2WXNA 2MCG1 4F1SA 4Z7IA 3MLXL 4N90D 4WNQB 3V7MA 3K81A 2CIKA 4DKEH 3KVQA 5FGBA 4QOKB 2H0JA 1KT2A 5LGJB 2ZCHL 1K85A 4Y2LA 3BKCH 3TBVA 1H15B 5K5YA 4P2RB 1HESA 2N1TE 5L4MA 3QQ4B 3NCYS 3GINA 1I9JH 1BPLB 4NQEA 3CX2A 1FC2D 1BQHA 4AVJA 4TUKL 3L3HA 4YEEA 4GPOA 1XD1A 2J6EH 5JXAH 5F2FA 4RDQF 2WP3T 5G4NA 3N91A 2F53A 1JDAA 4JHAL 4XZUB 3MNMA 1WCQA 2AEPL 3IMVA 4ODTH 4D9LH 4AQOA 4ZSOB 4FLOA 2IALA 1ODUA 2OBGA 1B4JL 3PYCA 5KYWB 3QUMH 3BAIA 4U1HA 4JL1A 4Z7VF 5L7XL 4NN6B 1IBFA 1N59B 1F6AA 2EDQA 3EW3B 1OV8A 1AHMA 4OLEA 3OBAA 5BOPA 5KSBF 3NGBC 1FL6A 1ZA6B 1UZ6E 1RZ8A 5FFLA 1HK6A 4MBOA 4UM9D 4YBLC 5DHMC 5EBMB 1NKOA 2KQNA 3FL7A 3MLRL 4ALAH 4LMQI 1T4KB 4OZIF 1PX4A 5HVHB 1BG1A 2OK0H 15C8H 2JV6A 3BLPX 5IEHA 3P73A 3KBFA 5DK3A 3LVTA 3KPQA 3FQUB 3TC9A 3GXMA 1FYTE 3MLVH 2HJFA 4TUOA 4OLWL 5IROC 3QRLA 4MMXB 1UWYA 2KC0A 1NCCL 2JJWA 2LTQB 3FB8A 2P24B 1AQKL 3F85A 1II4E 3NCBB 3UEQA 3VE0B 4AT6B 3WFHB 4WENB 3PWUB 3M88A 3RVVD 1FGVH 3CCHA 3AQYA 5SV4A 1FDLL 4Z3IA 2CBMA 3VG0L 1KIUA 4AGMA 3IFOA 3BDYL 5D7SH 4M48L 1XGYL 1JWUB 2JJUA 4H8VA 4YPGA 1JPTH 2BP5M 3NTCL 5KANI 2DQDL 2UWEB 2VZ1A 4N0CD 2XWTB 3K2IA 3RFZC 1L6XA 1XTLA 1CCZA 1IGTB 5A43C 2X09A 3SPHA 1SF5A 1UWEL 2HT3D 5AW8B 1AHWB 3GJFB 2IH1B 4JQXC 3V55A 1RJCA 3LOWA 3M6DA 1QFPA 1Q72L 3ECBA 4J39A 2WXJA 2WO3B 4LCCB 4N0UA 2BK8A 2XXMB 3L5JA 1L9SA 3QR1A 3JZ7A 1BFSA 1P7KA 1SFHA 1B0WA 3LH9A 2B2XL 1R5VB 5AWNL 4OT1L 2VQ1B 2DQFB 2X4QB 1U8NA 5E5LA 3WNIA 2N0MA 3SPVA 1BLNA 1QEWB 4LEXL 2NY1C 5ID0B 4JW3A 3WLBB 2IGLA 4HS3A 1DSFH 1PZ5B 5ADOH 4UTBH 5ABDE 1HWHB 1CLOL 2CRZA 1W72B 1DDHA 2A0LD 3FKUS 1JZ8A 3MBEA 2WLIB 3LIZA 1HL9A 2A74A 4G9DA 5AAPA 2UXGA 4RAUA 1GW6A 2VE6B 3IJEA 5F1NA 1ACYL 1ZY9A 2Z1PA 4O2CA 2YCYA 4CA4A 1QACA 3SIKA 3O3DB 4TL4A 2BRQA 1T1YB 1EAPA 1CQKA 4V33A 3V4PH 4XNMB 1X5GA 5CLYA 1EBPA 5E00A 5ISZE 1UUNA 3D09A 3LKNB 4F2MA 3RDTB 5AAMA 4AG4H 1SXZA 5MP6L 2IOMA 4FI6A 3APNA 1KSRA 4JRXA 3D85B 3BSGA 4C4KT 4JM2B 2P5EA 4O9HH 3QFDA 5DT1L 4X7TA 2P9RA 5AYUL 1K5NB 2IMNA 1AO7D 4W9CC 3EIFA 1A6TB 5FGRA 3MLTA 1VFBA 2BOCB 3CDYA 4NQQA 3VRJB 4BK8A 1A25A 4YXHH 4LGRB 1RIVH 4QRPA 1UHVA 1M0LA 1T1WA 32C2A 3NQIA 1D9KA 1KIRB 4LLVA 5IB5A 2EUVA 3OXSA 5FUOL 5DHYB 4MJID 5BMFL 1T83A 4FL4B 3F62A 1SGKA 5HHOA 4JJOA 3GMRA 3U25A 2DQHL 3GXDA 5DQJB 3FO2B 3Q8CA 1KACB 4OZFH 5D1ZA 1KC5H 5FW6A 2O6PA 4KRPB 4NFCA 3I75B 2FZ3A 3QIUA 3VGHA 4OU3A 3NIFB 5B6WA 4JGMA 1WAEA 3PHAA 4HKJA 1GXEA 2ZUVA 1N0LA 1PY0A 4N4YB 4ZW3A 4UDUB 2EKJA 4WFHD 3QC6X 3MRPA 1S3KL 3Q8FA 4QRRB 2VDPB 2FIKB 3KXFB 2NQ3A 1NCBH 3OGOE 2K8MA 4Y9CA 3FO1B 2XWCA 4U1NA 3FQWB 3R4DA 4IGBC 4GRMB 3QWOA 4NJ9L 3MQIA 2YEZB 3OKKB 4XC1L 4UYQA 4HJJH 1IC7L 4RH4A 5LBSH 3UBXB 4BINA 7FABL 4PRIA 2DQGL 5G36A 2ZXCA 3DXAB 4AMXA 1LO5A 3VI4B 1D7DA 3T0EC 2XG4A 1ODAA 3C6LD 1JJUA 3DIVA 3NK3A 1OGAA 1TFHA 3QWRA 1AIFA 2PW2A 5HGDA 2R2HA 5JHDD 1VADA 3QUYC 5EZPA 4KKCD 4HDIA 4NQUA 3G5YB 5T1DL 1RXLA 2WJLA 5JW3L 1F86A 1NMCC 2ZUQB 1WYJA 5GS3A 4OGZA 5JXED 2FO8A 2KS0A 1AQDB 1UEYA 5KYUB 5E7BA 1SUHA 1USQA 3H3KA 1P0SE 5EUOF 4FULA 4HCFA 2ZUWA 4KGJA 5E8PB 4D0CA 4IOFC 4RA3A 3V6OA 1ORQB 4U1IB 3SBQA 5F6IC 4OB5H 1CE1L 3B7TA 3EYVA 3RBSA 4JFEB 3JXAA 2AXGB 1ZOXA 4ZNCD 3X17A 1F4WL 1E27B 3KPRD 4H1LH 1A2YB 5B8CC 1HXYB 3WN5B 2XWJA 3WFHA 4JDZA 4DZ8A 5KJRH 1MWAA 1HYRC 1AYOA 1PG7L 4KPHH 4LCWD 4OCRL 4U1JA 1YEHL 2WNXA 3SPGA 1R9FA 3JBG7 3BAJA 2YD1A 1EAQA 1W80A 2GUOA 2R1XB 3FFCD 2DLIA 1JK8A 1O7VA 4H5SB 3QIWC 3EOTL 3PFUA 5JOFA 3KVPA 4JRYA 1FYHB 3LPWA 2XZQL 3L8QA 3QJUB 2VAAA 1UKQA 3UC0L 4PJGF 2J3SA 1A4AA 1YN6A 1S7QB 3LKSA 4FNRA 4YSRA 4CVZB 3KEDA 5F3HA 1NGPH 2Q7YB 2DQJL 4MNGB 4Y2OA 5CIPH 3ULUH 1ZWIB 4PLKD 5B34A 1QBMH 5CZXC 4L3CA 4YHKL 4EMZA 1SEBA 4MJ6A 2FX7L 2OSLA 3ZJAA 5B3JF 4P23D 1XH2A 3U6RB 1KY7A 1TTBA 4I0PD 4BFFA 4XBMA 3MYJA 3LRSB 2DTMH 1AKJD 3NJNA 5DYOA 4F92B 4HFWB 3R8BB 3QEUB 5HDBE 1PAZA 2JCCB 4Z7WA 4HWEL 4EN3A 1QO3B 2YSSB 2CR3A 1BSIA 3B5GA 2XHNA 3ZR5A 5H35A 3BAYA 3VGAC 2FWLB 1QLEB 1YDPB 4N8VG 3Q5TA 3ZPQA 2R1YA 4XCCH 4P46B 4HIEB 2BO0A 4LIQH 1TTCA 1K6QH 2Q8BL 1WISA 3L9EA 5IMLA 1BD2D 3F01A 1NPNA 2AABH 1R24A 5JO5A 2DL9A 4P2OC 5DJDB 2ITEA 3D0VA 3SBPA 3B9KC 3WY1A 4LOVA 3TT3H 3MRGA 1ML0A 4X5RA 4XPTH 3AM6A 2OYKA 2DYRB 3HBGA 3QJSB 4Z7VE 4NAMA 3VJ6A 5E4EC 5I0YA 1VFAB 1MIEL 2OMWA 3C5XA 3SQRA 3BZFB 2C3VA 5KSBE 4LLQA 1JGEB 5FHAL 5C0DA 3F7PC 3R4RA 2DEXX 4PS7A 1E8ZA 3QZBA 3QNXA 1ZDSA 5DHDA 1KGWA 1ULVA 4OZIE 4ENEC 3PJSB 4YE4L 4XNUL 1BGXH 1GZHC 1S7WA 1U2YA 3K6FA 3Q9PA 4OKVA 5DRNB 3WY3A 2IAAC 4ISVB 3WKML 5JPNB 2CJUH 3EFFA 2GJ6B 3NH7H 1KCVL 1BMWA 3E2HB 4MKTA 5GJSH 3IFPB 4O2EA 1F3DH 5FYKL 1QSFE 4IW4C 4W6YB 1AFVL 4PV8B 3VQLA 2XA8L 2XXCB 1FP5A 2NTSP 4P48A 3WKQA 2EVIA 4YS4A 1LD9A 4NWUL 1SXBA 1IAIL 2GPZA 2R2CA 2A7BA 5I9QC 1MJ8H 5FUCE 1J1OL 4DGVL 2VRKA 1G1KA 2XG5A 2DD8L 3GI8H 1S5IL 1JF1B 1DQJA 1GCYA 2NY5C 4AE0A 1BQLH 4TNFA 4UWQB 3HKZA 4N2AA 4OUUA 2WQUA 1Q9LA 3AQXA 4NI6A 1P4UA 1JMXA 4N6HA 2YBRB 1F97A 1AD9B 4U2YA 3TYFA 4U6HA 2F2HA 3MXVH 4HCIA 4YDVA 4C58B 3EADA 5T3ZL 5C9KA 1NC4A 3PWNA 2H5UA 4JMXA 4G6JH 2J71A 4GG8A 2VXQL 1I7RA 2WIIB 5IM7A 4FFVD 3S36L 1EHXA 4FA6A 2QGEA 4TQEH 2Y04A 1EX0A 2EZ0D 3NJFA 3RZCA 4MD2A 3ZYZA 2BSTA 5IFJB 3RWJA 3VU1A 4TM9A 5LCVL 4FFWD 4M62L 3O41B 4IEFA 4L8SA 4DGWC 1U92A 4E41D 3QULB 2ALAA 4TKWA 4WK0B 3WTVA 2MPAH 5G2AA 1FC1A 1NGZA 3OGCA 4DK5A 5DMGD 3JT2A 5DURD 4BELD 5SWSE 5IF0B 1DVZA 4KRMB 3S37L 1PD6A 5MEQA 5BZXA 4JO4H 3TJEL 1J8HE 2KZWA 4XBGB 3OF6D 3RVVC 4KNFA 3HC2A 5A2IH 1MDTA 3LMJL 2BNQD 4GRWH 1AG0A 1JI1A 5J9PB 2ID5A 4FFYH 4IDJL 1NLDH 4M1GH 2Q10A 2JKNA 4QCIA 4AM0Q 1YUHA 1IKOP 3SDAA 4DKLA 2DWDB 3Q2VA 3CZUB 1QZ1A 1MI5D 4N0CC 4UUJA 4BH7B 2QMKA 4AC2A 2YCZA 2OYMA 3MI6A 2HT3C 3WE6A 2V17L 3BQUB 1T0OA 3MV8A 2HRPL 1GAFH 1M0MA 2PCPA 4NBYB 4R0LB 4JFSA 4ZXBB 4MJ4A 3HC4L 2RFXA 5E94B 2YC1B 1E4XI 4KMTH 3T1FB 5JUEH 1Y0LB 1G7LB 2Y25A 2ICWI 3KPNB 4LLWB 5F7LB 4GBRA 3POCA 5D93C 2YFOA 5F9WB 2F58L 3Q48A 4A2LA 4L4TD 2C1OB 1BG9A 3UXFA 3MRIA 5BZDA 3ECUA 1CE6A 1OM3L 3L9BA 2Q87A 4J8RA 1LJMA 3BT2H 4HOZA 3UPRB 2A0LC 2R69A 3TTYA 1T2XA 4YBHA 1DVFB 3CVBA 4JZJC 2IH9A 1KB5A 3MJ9H 1G7QA 3N3EA 2YCWA 2BJMH 1I1FB 2A9DA 3GTTA 4NM4L 3BHBB 3BPLB 4NPKA 1HX0A 1H0DA 1BQKA 4G1MA 2GTQA 1DZ0A 1OAZH 1X3DA 4BVNA 4IBLT 3PGCB 4HP5A 3TIDA 4IKJA 3WDJA 1CT8A 3ZGHA 1G6RL 3ARGD 3NCEB 1Y1UA 3BAKA 3GDCA 3ULVH 4GI8A 3Q2CA 1NCOA 4IOIB 5F89B 5LBVA 2O5YH 2HKAA 3CG8A 3FCSA 2JTDA 4GRLA 3G9VA 4PJEB 4OLYH 2DLHA 2G4GA 4OCSL 4WTWA 4XCNB 3DDLA 1EIBA 4K3EH 3SD5A 3MCYA 2M1KA 5INDB 1UGNA 4OI8A 4V2BA 1A1NB 1AR1B 2EYSA 2CDFB 4TSCH 2R0KH 2WLNA 4L8DA 1YMMD 5MENA 4D8PB 5CEXB 5EUOE 2D7QA 1CLZL 3T8MA 2BY2A 1FZOB 3B2PA 4TF4A 4BWTA 2QVTA 2QHRL 5T1LA 2XV2A 3FO0H 3V4VA 4P2QD 3QS2A 3BQVA 4EKXA 4E68A 1SYVB 3Q1EA 4F8LA 1LLAA 4J6IA 3HNTL 2J1XA 1G9EA 1UB5A 4NAQA 1JK9B 1A7NL 4FQQB 4GBXB 4PREB 4QTHA 2F7OA 4I4WA 12E8L 4FYSA 3KDPB 4CILA 1TMQA 4BKSC 3GSUA 4G8GD 2WTOA 3RJDA 1M2OA 5I8CB 4JQIL 4GG6A 4OBRA 1ZHBA 4V2CB 3ZL1A 1X7TA 2Q8AL 1JNLH 2YLKA 1I9RL 2MNUA 3AREB 3I9GL 4LL9A 5D7LA 2FD6L 2JLPA 1XR9B 3TU6A 1YO4A 3UTYA 1GZQB 1ZIAA 3L54A 5IR1B 2BVEA 4XBPB 5G55A 4Y4KA 3T09A 1JCVA 2V2XB 4JG9A 2WJ7A 3I2CH 1J0YA 1OCRB 1KLFA 5HHVH 1IL1A 2VL5A 1N5AA 2CMRH 4TSAL 1EO8L 4M43H 4ODHH 3C6LC 3IEAA 4WY7H 5KAQG 2HFGH 4XC3H 3FTGB 5FLUA 1JYNA 4EBQL 5G2DA 3OMAB 5GGSB 2VIRA 4Z7WF 1EGJL 4KKCC 1CB4A 1I3GL 1M05B 2PP9A 1HZLA 5JXEC 4JS7A 4W9ZA 4I5BA 5T3XE 4YLCA 3VI3E 4EDWL 4PJXB 5FYLL 3BZEA 3BH8A 4ZD3L 1U8LA 35C8H 4GAGL 1OW0A 1R5WB 1WEJL 2LLNA 4HKZB 1IW9A 2I9LB 3V5HB 1PNDA 4UYPA 4NQEE 3FMGL 3CVCA 3PCYA 1W0VB 1LVEA 4J7RA 3Q43A 2EXYD 5DQDL 4QHUB 2D3VA 1Z9OA 3K8LA 2EI4A 3OLGA 4AK2A 2F53E 1G0YR 1YAZA 2QDWA 3WAKA 3UTZB 3MNZA 3VGDA 5TTRA 4ZMNA 5GZOA 3IJHA 1RU9L 1NAMA 1SQMA 2BWIA 2GABA 1MRDH 5F44A 3OC5A 3D07A 5DC0A 4HJ0C 4ZMXA 2A4EA 3EGXB 1BQUA 1DCEA 2YK1L 5CR8A 3GSNA 1HI6B 3CZLA 1MH5A 2W0LA 4PLKC 4FLQA 2R4RH 4XO5A 3QNZA 4JJHA 2VABB 1A14L 1BEYH 3GUTB 4P4RB 2NR6A 3X3FH 2ZSWA 4HXBL 4I0PC 3T2PA 1FZKA 4NB7A 3KWVA 4L4VB 3BO8A 3MV11 3L3GB 1RULH 2DDQH 4UTAA 4R7XA 3QEQB 1SZNA 5FA3A 2Y0SA 4QGYA 4J3UA 1FNFA 1BVLA 5DI8A 1CIDA 4JHWL 1RY7B 4XVJL 3S35L 3VB8A 1IMHC 4ZMTA 3TYGL 4RFOH 4GIAA 4K2UH 3IU3B 2XVGA 5BQDA 1VEOA 4X0NA 2A6DA 4X6BB 4ANXA 4X31A 4LARH 2LFGA 4PV9B 2DN7A 4O4YH 3RGHA 5DFWH 4Z7AA 2XI9A 3IFNH 5E8NB 4HOWA 5I74B 4IRZL 2JB5L 3X12A 5JIMA 4XMPH 1IZKA 2AK1L 3M17A 3IE9A 4Y2DB 4MCZB 1CDCA 5J89A 1KTLA 4QKTA 3WEBA 2OV0A 4FNSA 1V7NH 2G2RA 3HS8A 4MA8H 4R7DA 4ONHB 4O02B 4PJ8D 4L8CA 3FCTB 3MRRB 3LNIA 4K55A 1T21B 3EO0A 4KXAA 4POYA 3HFFA 4W81A 1CICA 5K39B 3IMTA 4N0UE 1CS6A 3RIAK 4IBTA 2YFNA 3ENEA 1I7UB 3QIBD 3D18B 5I6NA 4PRDB 2PUQT 3QCVL 3KJ6A 2NY3B 5FYJU 3OZLA 3SDCD 2Z31D 1YLBB 2DWEB 4MD5A 2A6JB 1X5ZA 3MLWL 3W5NA 2AV7A 1CFSA 5E2JA 2K7QA 2LAGB 1XV8A 4OFYA 5IVNA 1E50A 4N2NA 4FLHA 4APQC 4B3EA 4RGNE 4LSRH 3WAJA 3E3QE 1NEZA 4JGNA 3VG9B 4I8DA 2EIDA 3WJMB 3QZLA 3QDGD 3LKPB 4OV6F 3T1WA 5IJVB 3CMGA 1IEHA 3RKPA 2E4TA 2G75A 3BKCL 4XCFH 4GO9A 5EO1A 4W1TA 5IMMA 4XI5D 4PU2A 1I9JL 4WO4D 2MTAA 2VLMD 1K4DB 5T1KB 4NKOB 1DJIA 4H0GA 3T0WA 3CC1A 2J6EL 2R0LH 5JXAL 4GKSB 1R3KB 2X53A 1OEZW 5DJZB 1V55B 2RR3A 5D1XB 2O72A 1UTDA 4JRXE 1CYGA 1OE3A 4IQHA 2P5EE 2G9HA 4ODTL 3RPIB 3V6FB 3PQYA 4D9LL 4PJCB 5D9SA 1HEJC 2ZG1A 4WAVA 3BUYA 3QUML 3EDKA 2X4PB 3WJLC 3QH3A 4XNQA 2WBJD 3H9SB 5A2JH 5GS0H 1BJMA 4YSDA 3FU0A 2GFBB 4NSKA 3LQAC 3SKNA 1AGEB 5KBDA 4LGPB 2A99A 3ZU8A 1IFHH 3MREB 5HHOE 3N1GC 4ALAL 4QI1A 1A9BA 4FFVC 3ARTA 2OK0L 2LLLA 4JVWA 1SJVA 1LO3H 15C8L 2EZ0C 2PNDA 1MHCA 3UO1H 3DECA 3GMQB 1CVRA 4OBSA 3FU9A 4LT7A 4XTNA 2APBA 3MLVL 3IGUA 1O5DT 4FFWC 1B0RB 4XPGH 4DEPC 3CNKA 5FYJE 1DQIA 2B77A 1IE4A 1Y18B 1FG9C 3QG6A 2VXVH 4HQQH 4PGEB 1SLWA 4LL4A 5DMGC 2Z9TA 1FGVL 2EDKA 3UDWA 2R27A 4JE4B 1TVHB 4M9PA 1ZS8A 2MTPA 1AMXA 3TNMA 4HJEA 1HILA 4YL4A 5LQBH 3O6FC 4N86A 2A77H 5D7SL 1NFDB 4GYBA 2EUXA 1CTNA 1JPTL 1MCNA 3FONB 4ZFFA 4GUPB 3LPFA 2GT9A 4R84A 1KTCA 3WEOA 1IO4C 5DHXB 2XLLA 4FQLH 3EG9B 1DO5A 1ZE3C 1CN4A 4PRIE 2GITA 2EIMB 3HTLX 4GAYB 4XO9A 4A1RA 1NGWA 4Y16D 1S7RA 4XAWH 4DW2H 1OGAE 3IFLH 1XCXA 1LO0H 2WOBA 1S9WB 4UQCA 4WW1B 3WIFB 4H13C 4EVNB 1BYOA 1CPUA 2OMXB 2WZ5A 3TBCA 3UOAB 4U1SA 1UQSB 1QSZA 3VXOB 4OJYA 1FSKC 3FQYA 4LU5H 4HC1A 5F7EH 5KSVA 3V6OE 1L5GB 4UV4H 1QTPA 5HYSB 4NQDA 4TSBH 3FT3A 1KJMB 5LG1A 1LTXA 1UJ3B 1KNOA 1DSFL 5ADOL 5AENA 5HGBA 4UTBL 4K4KA 5HDLA 1D5ZB 1T22B 4Q6IB 3QUXB 4Z3GA 1ZHKB 4GLRH 1RZGB 3NZ8A 4YDKH 5EO0A 1AANA 4UF7C 5EBWA 5C0CB 4GG6F 1E2VA 1UD2A 4DOHB 4JRYE 4X50A 1FVDB 1IEBA 2MOQA 3L13A 5D96C 3A7KA 4BDVB 1H5BA 3V4PL 2UZYB 4PGDA 3B6SB 2W1NA 4P2YA 2SEBA 2Z0BA 1JTOA 3GSVA 3L5WB 1O6TA 2R51A 4AG4L 5A40E 3ARGC 1FHGA 3C09B 3MXWH 5GGRY 4KDTC 1MJJA 4WLCA 1KCRH 2Z7WA 4O9HL 4PJ9D 1RJLA 3PL6A 3PUCA 2XZZA 5EU3A 2I9TA 4QT5B 1OQOA 1SY6H 5IVZB 1ROCA 1GH7A 4G11A 4U1KA 3DTXB 1R75A 4J3OF 4Z7WE 1XF2B 3BP4A 4RESB 4YXHL 3UTPE 4URKA 5H4ZA 1RIVL 4MJIE 2HWZH 4IU2A 5MI0B 4B95C 2Z93A 1R0AH 3IBOA 4UT6A 2V2TB 1IGIH 3ZYOA 2JE8A 2JKSA 5EZLA 4A38A 4V11A 3CFBB 2HX9A 2AQ2A 2OPCA 4Z18A 5FOJA 3TBTB 3NT0A 1KC5L 3BD4A 4FXKC 4ADJA 5AVWB 4G6FD 2YKLL 4RWYH 3LY6A 4X8JA 4HUVA 4U1MB 5BRZD 3ZO9A 3GS0A 4G6KH 4ODWB 3MUGA 1OB1B 1XGPB 5I8EB 5IFAH 2CCVA 3DC0A 3MBVA 2IPUG 3H7BB 5A2AA 5C0IB 3MFFA 5F7HA 1BBJB 3BH9A 3DUUA 1X5MA 3K1KC 4XPFH 3IVKB 3RWCB 4NQXA 3MNWA 4UM8B 1JV2A 5C71A 1YEKH 4JR9H 1P7QB 2MJWA 4HJJL 4KO7A 4MMZA 1KG9A 5LBSL 1C5BH 1WUNT 1MFUA 3RWFA 3DX8B 5ES4B 4N2CA 4B53A 2MNJB 4M5TA 1VZIA 2QSQA 3F2LA 2C3WA 3KLAA 3P11H 4FF9A 4ZPVA 4G83A 3ATFA 3DHPA 1MFBH 3GPEA 4ZRGA 3MCKA 2PETA 3STBA 2UVFA 3D69B 3W57A 2B7DT 4WUUA 1ETZA 4MDRA 3DVGB 3DV4A 4M6MH 4IJ3B 1U8MB 2BSRA 1AE6H 4E36A 3CFJA 1TCRA 4OB5L 1PJ9A 4FTDA 2YGQA 1XZ0A 4GT0A 2A6KA 3HPJB 2OXHA 2DJ4A 2OFQA 3EYOB 2QGDA 2XTJE 1TN0A 1NTDA 4X7SH 3HZYA 2GKIA 5KJRL 3OG4B 4KPHL 4ORZC 1Q0YL 1VKXB 4X5PA 2WUBH 2BMKA 3AC0A 1WC7A 2EXYC 3TA3A 1D6VH 4DEUA 3QUKB 4DP0X 2VT0A 3VGGA 2E27H 2IANA 4HIPA 4XOBA 1A6UH 4NQTA 5E8EB 5JPMC 5IQLA 2V8MA 2ZXGA 3MR9A 1G0XA 3QAZC 1NGPL 3N06B 4YDNA 1KXQA 2ESVD 4RA0C 3VXMA 2G3NA 3ULUL 5CP7B 4WDIB 1QBML 3FOMA 3V6ZB 5D1QB 2UY7A 3N9GH 4PR5B 4TRPH 2WNKA 4XXDA 3OKDA 3U0TB 2X4TB 1EHNA 5E6ID 2E7BA 5DJYB 5B7MA 2DTML 4K73A 4CBZA 5FOBA 4N9OB 2CBPA 1P6AB 1FZJB 3QQDB 4NCDA 4U7SA 4LSUH 2CO3A 2OX5B 3A6CH 3LNFA 2IV9A 4QTIH 3X13B 4XCCL 3V0AC 2WLLB 1M2VA 3REYA 3FJTA 3GXUB 4LIQL 4GS7C 5CD3A 5AVRB 4KTYA 3WNOA 4TS6A 4LLYB 2B5IC 2KLRA 4HSAC 3BVTA 2VDQB 5JORA 2YAEA 2OSWA 2QSCH 4BK5A 5JIDA 2AABL 2CHDA 5CCKH 5E0FA 5AUMA 4LP4A 1DQMH 4XT1A 2WLMA 4MZRA 5TFSH 4Z7NF 4XNZB 3ARFA 1P5UC 1U8OB 2V7NB 3OR6B 3A47A 3CFDA 4OQTA 3TT3L 2F18A 4XPTL 5EUKA 3SGKC 4FXGA 3WS6A 1D2OA 3ARDA 4YSOA 3T5WA 4M3JA 4PJ8C 1NC2D 3U0WL 2CLZA 2XWEA 1OSZB 3MV8E 4CVWA 2FEEL 5ENWA 4KMQA 4LDEB 4BK4A 3GRWA 4GI9A 5C0BA 1J5CA 1QTSA 3QIBC 3CDGB 2WQSA 1SJHA 5DRXA 4JFXB 3N1FC 3VXSD 3SPJA 4ELMA 5DJ8B 3SDCC 4CU6A 2AFNA 5DO2D 1BGXL 2DQUL 1IB5A 2Z31C 43C9A 1JPFB 4BZ2A 3N44B 3UROR 4MYWB 2Z73A 1RD6A 2FJGA 4KROD 4TLKA 3NH7L 5HXMA 2AJVH 4JE0A 2A73A 1MF2L 1VDGA 1ADQH 1GYUA 4H1LG 5GJSL 5HDBB 3U30C 4A7GA 3HG0A 3MLZH 3V9EA 3WNJA 2KSAA 1UJTA 3PDDA 4X6DA 4DHLA 4U1GB 2BCMA 2CR6A 4F24A 4TLUA 5CINH 2F08A 4PG2A 3VAEA 1MJ8L 4XI5C 4EO5A 2E9GA 4WO4C 5C09B 2VN4A 1MUJA 1IAII 1IKNA 3B3IB 1RJYA 4YAQB 2JI2A 1WCBA 3U4EA 3WHXA 2VLJA 3GI8L 1DJYA 2EXWD 4OR1A 1BQLL 1YHPA 2WLKA 3QGVA 1U33A 5BW7A 4RMWA 5B38A 3BJLA 4GAAA 3ZHFA 3RRQA 5HD8D 5IV2B 1SMAA 4MDIB 1ITBB 4K7PH 4RZCA 4NQCB 5C08B 4HOXA 1UM4H 1AXTH 4QHPA 3MXVL 1DN0B 1CXKA 4WU7B 3LIUA 2WBJC 1X5LA 4OD2A 1NEPA 1J5HA 2APSA 3IDMA 4G6JL 3BESR 4PB9H 1EJ6A 5MENE 2XTSA 3GUFA 5TH2A 3ATDA 3OHXB 2FJFA 5J8OA 3PDOB 2VDOB 5KSBB 4NNYB 5SX4I 3ALXA 1CK0H 4O2FB 3SGJA 3SSGA 4ZMQA 4KUCF 4E41E 1IM3A 4MNQA 1P2CB 3BKJH 4K7PX 5IUSA 5I76B 5KN5A 3C9LA 4OZIB 3K2KA 2CHNA 3ESPA 1IIIA 2VAJA 5MERB 4MJJA 5TE4H 3GSQA 2VSDA 4HGWA 2CHZA 2MPAL 3MX0A 3WLWD 4NPYB 1MAJA 2ZWYA 2ZP0T 1KBPA 1YYCA 4JO4L 3DX9B 1PDKA 4ZQKA 5D7LE 2JAGA 5B1KA 5KBNC 3P2BA 4FFYL 1NLDL 1ZTMA 4M1GL 4W6WB 2XX0A 4WRLA 1IQDA 4ECNA 1C7TA 2AQTA 4ZMWA 2IBZX 4LEBA 3KPPB 2IWGA 1PQZA 1OSEA 1I53A 4ZMAT 3Q6FA 3DV6B 1BW8A 4OGQC 4G1EA 5AW4B 1N9PA 1EHLH 2X41A 4Y16C 3APMA 1JCKA 1GAFL 5G4OA 4PS8A 1TTUA 2ATKA 1A6ZB 1K8DA 4MS6A 3O3EB 4RFNB 2Z7UA 3HI5H 4KMTL 5JUEL 4MAZA 2WSDA 4IHOA 3N0AA 1JZ4A 3VFUB 4XVSH 2K9UA 3DX7B 4UQ2A 2VLRB 3GJEA 2YO3A 3ERXA 4AXWB 3EYUH 3B43A 3DUSA 4AC4A 1RIUH 4B5EA 4UZUA 2YXMA 3TH2T 2VN5A 3BT2L 5IFHH 5HGAB 1ZCRA 5J7AA 2D73A 5C0AB 3U0PB 1R3JB 4F7PA 5A6MA 1D5MB 5IVXA 4MWFA 3MJ9L 2YBGA 5GRJH 2BJML 1EANA 4DO4A 4XBEH 1A4JB 1V8HA 3HG2A 3HS9A 3R0NA 2CRIA 4G7YH 4X6CA 2ZAHA 4A2GA 5SWSB 3RWEB 4UOW0 1UH4A 4LPTA 4R2GC 1J8HB 3E38A 5I1KH 2ZYHA 3ULVL 4LOUC 5E9DA 2GY7B 4OKDA 2O5YL 1QKOA 2ZOKA 4F15B 3A23A 4OLYL 4GAFB 4PJ9C 3HMXH 1BXXA 5JA8B 3MROA 3S3DB 3WN6A 1PXRA 1E5ZA 4YDLC 3SKOA 4XMKH 1J10A 3MRHB 4I7ZC 2Q6WA 3B56A 3QCUH 3UERA 4TSCL 4OI7A 3T3PB 2R0KL 1QEXA 3ZKQD 4TL3A 1AGDB 1MCBA 5KVEE 3QJXA 4P2QE 1QASA 1NIEA 1A65A 4ZOBA 3QXVA 2OTUB 3FO0L 2AJUH 4IGBA 3KYOB 4Q14A 2GJJA 3ZTJH 2HLFD 3G5ZA 4XN7A 3D4SA 1B90A 3QXDB 1G84A 1RL1A 4JY5H 5K59F 1BIIA 1C5DB 4JFDB 1GCFA 4K23H 3WBDA 3UACA 2EKSB 3EFOB 2W65B 1OM9A 5I5IA 3IGFA 2BP8B 3C5ZD 4YZWA 4NDMA 3WIAA 1TQBC 2R2EA 2OLDA 1NL0H 1JNLL 2KUTA 4IRSD 4J1UB 5SX5H 4E5XA 2EVGA 1JGUH 1COBA 3N50A 3TIEB 4Z5RB 3SDDB 4N1EA 2EUWA 1M9WA 1I7ZB 2ZUYA 3OKOB 4FZEL 3VGBA 4LSQH 2HFFA 2Y02A 5BV7C 1D6EB 1MCDA 1F6LL 2ZX5A 3EAKA 3I2CL 4UT9H 2X4SA 1XGTA 3FT2B 4PRPD 5HHVL 2FJHB 4U6XB 4G42B 1YUKB 2CMRL 4M43L 2B3IA 4ODHL 4WY7L 2N1KA 5ALBH 4F7KA 2HFGL 1GS7A 2P26A 4XC3L 2CWRA 1HWGB 2UY6B 1EHAA 4N20A 4ZOCA 5SWZB 4YHNB 1TVDA 3MRLB 4FA7B 2AKRB 2IBGA 4P5RA 3EKCA 5IUCA 5DK0A 4BXSV 4WGKA 2AZUA 35C8L 4KUZH 1HCFX 4P4KA 3L81A 5GJTH 4TPRH 3EYFB 4YC2B 4BZ1H 3L6FB 4QHNB 1EPFA 3D34A 4PUBH 2F1AA 1KLGA 2Z92B 4D94A 1AXSA 1CGVA 2YPKB 3MRCA 4UU9A 4DGIH 3OXRB 1BZOA 1RUKH 1TZ8A 1NUNB 3DOSA 4M61B 1S9XB 1OHZA 3OJDB 2C5DC 3DX3A 1I8KA 2GQHA 2K78A 5I1HH 2ZOUA 2CPUA 5EORH 3PABA 3PQYE 2CH8A 1M71B 4JUTA 2EIZA 1MRDL 4FNTA 1UD3A 4RAVA 2GK0A 1VGOA 4LLMA 3WL9B 4ORGB 1OAQH 4PJGB 2OYPA 1XCQB 3IDYC 3X11B 2O6EA 2BY0A 2YAHA 2R4RL 2FEDD 3TN0A 3QA3B 1BEYL 1F3JB 1PAMA 1WTGT 1S2EA 5DFTA 5E6IC 5MEPA 4ELMF 5I17B 4HZLB 1RULL 2DDQL 4OLXH 3PJLA 2P45B 4L0ZA 3QZWA 4IMLB 3CN4A 1E5YA 3BEVA 2UZIH 3DOIA 4A7GF 3TO2A 1T5WA 1OP9A 3QEHA 3JTSB 5JDSB 4RFOL 1ZANH 4X6DF 3PJNA 1MWOA 1UCTA 2E7DA 5E4IA 2CIKB 3HBZA 5C07D 3T0BA 4LARL 3V8CA 4O4YL 1FZMA 1KT2B 3CHSA 5C86A 3IFNL 4PLOB 3TBVB 3JV5A 2FHCA 4XMPL 1KN4H 3LZLA 1HAWA 2CXGA 3QFJD 1VRSA 1FLRH 2F1BA 1BQHB 3FSZA 5H37A 5T5NG 4C83A 1V7NL 4MA8L 4U1LA 2R23A 3L3HB 3L3OB 6PCYA 3L08A 3AS1A 5I0DA 4O51A 2F53B 1WWCA 3FQ4A 1A3RH 1E4KC 5EOCJ 3OE0A 4MQ7A 3QDMD 1JUFB 1AZRA 2UXVA 3OZKA 4DVBA 4X4YB 4Q0XH 4I87A 4JM0A 4WHTA 1F6AB 5C2UB 3HG5A 1NCTA 4CC4A 2BZCA 3MCLH 1WJ3A 1FL6B 3GRGA 5K1JA 1RZ8B 3MV9D 5DO2C 1XIOA 1Y6NR 1G7MB 4LFHD 4NZTH 4RMVA 4KROC 4F7EA 25C8H 2QZ5A 2ZF8A 3ZE2F 4HSCX 4LSRL 5CMAB 5BS0D 5IEHB 3CN2A 5LUMA 3KPQB 1UOVA 4W6XB 4XO8A 4BUGA 3TCXA 4TUOB 4S0TD 4PD4K 4XCFL 1OK8A 3AT0A 4MJ2A 5J06A 4EJ4A 3FB8B 1OAUH 1YNLH 4JFZL 4AKQA 1L0QA 1NDMA 1VSCA 1E67A 2QEJA 3DLQR 5AVZB 3CVDA 2HUEA 2CJSA 4NNXA 3WXWH 2J88H 3VH8A 3CCHB 4YLQT 2R0LL 4F8QA 5BRPA 2EXWC 43CAA 4ZZFA 1A7BA 3VFWB 2YQ2A 2WY3B 4U7KA 4QAWA 3P4MA 1KIUB 5BR5A 3IFOB 4JANB 5HD8C 3PUUA 4YPGB 4PBDA 1PIGA 4WSJA 4FG6D 3ILPB 4KOBA 4QY8A 3SZ6A 1RK0A 5IESH 3AT9A 3AG3B 5SV3A 5GS0L 1JNJA 4F7TA 1U6AL 3MOAH 4G72B 2VN7A 4QRTA 2NT0A 3BGMA 4OZGA 3BDXA 2ICEC 2VW6A 7TAAA 5KBPA 3OSKA 1K8IB 1UWGH 4N0UB 1A66A 3V0FA 5DJXA 2OL3B 1NM4A 3O9WD 3CXDH 1LO3L 1P7KB 3UO1L 2FIRT 4OF6A 4ZUTA 4A2MA 5IY5B 1PXSA 1RUAH 1MFEH 4NRZA 2QLYA 2ADIA 2AK4D 1U8NB 4XPGL 3OKLA 3SPVB 3VVKA 1BLNB 3WLWC 2E0PA 1KIPA 3OAUH 1ZS2A 1CR9H 2VXVL 4HQQL 4HS3B 5MHSE 5IVXF 5DEZA 4K3GA 1OSPH 4AX3A 3CZFB 5C0FA 2A74B 2Q86A 5F3BA 4RAUB 1CO1A 5LQBL 2Z35B 3IJEB 5F1NB 2A77L 4O2CB 4X6CF 2X9XA 3ROLB 2NXZB 4XN2A 3UONA 3DUHA 2JKJA 5IGXH 1JXDA 4JN2A 3KL5A 4A6YA 4FE9A 4FQLL 2ZYSA 4HVBA 3F7YA 2E46A 3AY4A 5E00B 1BV8A 4EAEA 5HPMA 4N26A 3FB5B 2PKDA 4OD1L 1U3ZA 1S8DB 3O4OC 3QRGH 4F2MB 4XAWL 5AFAA 4GFTB 1DL7H 1WE5A 1OT4A 3KLDA 4DW2L 3X3GL 2CUMA 4K9EC 1LO0L 1MCOH 1OHQA 3KGSA 4NBZB 2QV2A 4ACTA 2P5EB 2AJZA 3FSWA 4X7TB 3N42F 4WUUE 3TVMD 5EEYA 3KPTA 3MLTB 1VFBB 5AZUA 1KCLA 4LU5L 2LVEA 2WXOA 4GB9A 3DHJA 4UV4L 4QRPB 5DJ0A 5AWZA 1T1WB 3D33A 4TSBL 1D9KB 1UXWB 3K4AA 4WFGE 4WF7A 2Y69B 3OXSB 5K59E 3ZZSA 1QLRB 5JJNA 2R29H 3VD9A 1BECA 2XN0A 3GMRB