4GP4B

Structure of recombinant cytochrome ba3 oxidase mutant y133f from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Access to the Active Site in Thermus thermophilusba(3) and Bovine Heart aa(3) Cytochrome Oxidases.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4gp4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4gp4B02
1X0K1 1GS7A 1W6WA 5F7AA 1XMEB 2EI4A 1J5DA 3G5WA 1PNDA 2BWDA 2YCYA 5KKHA 2BZCA 2MRYA 3ABLB 3CVCA 3FSAA 4YSPA 2FQEA 4GP8B 1YLBB 3KW7A 4GYCA 1AZBA 4YSCA 1JZHA 2BRDA 3FYEB 3QPKA 4PXFA 1GUEA 1ET8A 4HCIA 1TN5A 3EH4B 3QAPA 2Y01A 4A4MA 1KDJA 5LWEA 2YXWA 2HX7A 4G7QB 3AG1B 5B2NA 3NY8A 1N70A 1QHJA 4Q8BA 1S8LA 2E86A 3MX0B 4DP1X 2HZHA 4E9QA 4MD1A 2ZONA 2IDUA 5H2HA 2PPEA 2WJLA 4A2HA 1PF3A 3VG9A 2PCYA 4F7KA 4IARA 1S51A 4LDOA 4TL3A 2UXVA 3IE9A 2YCWA 1A65A 6PCYA 3T71A 4BWBA 2BP0A 3FS9A 2VW7A 1UATA 4DP9X 4XTLA 4XTNA 3HASA 3IN2A 2JAGA 4EF3A 2MTAA 4GXFA 3QBLA 4LDEA 5B6YA 5DYSA 3HAOA 1TEGA 1OOWA 4BVNA 3RZEA 1XB6A 1OE3A 1U19A 1V55B 1S8JA 2XV0A 3NJKA 1NPNA 1AANA 1F56A 4YSDA 4YSEA 5F8UA 3TBCA 1DYZA 1BRXA 4DP2X 2IDTA 5G53A 2YAOA 3EF4A 6PAZA 4E9WA 3FQYA 1BAWA 5G2AA 3S3CB 3BVDB 5B6VA 1FBBA 2DWTA 5AX1A 3PBLA 1IBYA 1GU8A 4DJHA 1JVLA 1SDDA 1ID2A 1KGYE 1PXSA 3FU7A 3T45A 2VW6A 3N55A 2YDVA 3V2YA 4QKTA 3ZPRA 1A4CA 2VN3A 2X88A 4NB7A 1A3ZA 1AZRA 4BEZA 1BM1A 2H5UA 4NC3A 3IEAA 2H3XC 1JZJA 4BV0A 1ZDSA 5B34A 2NTWA 4DAJA 4EIYA 1CYXA 1QHQA 2BO0A 1PLAA 1RCYA 1FA4A 4BDVA 1AOZA 2BW4A 4G7SB 4BWTA 2R4RA 3DTUB 4XXJA 1NIEA 3OAXA 1VLXA 4HHWA 1RZPA 2TSAA 4PAZA 4DPAX 2VSKB 3EH3B 2CAKA 4XT1A 1AIZA 2H47C 2IDFA 5H2IA 1BYOA 1X0I1 5G54A 2I35A 4CSZA 1JXDA 5B0WA 5AKRA 1MG3C 1ZIAA 2I21A 1AG0A 2OCCB 1JFPA 1X9UA 2KSBA 1QNIA 3WIAA 3PLYA 2WJKA 4WAVA 1PY6A 1MZYA 3PDSA 5ITCA 1R2NA 1OCCB 4UHRA 2HLEB 3RYMA 4FAAB 4GRVA 5B6XA 2AZUA 1NIDA 1J9RA 1C3WA 4KO5A 1URIA 3OE0A 3QBKA 2L6XA 2GC7C 1KGBA 3ABMB 1PLCA 1I53A 3NJMA 4KOCA 3X1BA 2VW4A 3EMLA 3ZEVA 5B6WA 4N4WA 1GY2A 3TBBA 1AT9A 1ADWA 3NJGA 4L0PB 3L45A 1TEFA 1H68A 1E0PA 1W8EA 5ANHA 3PCYA 2HX9A 1C8RA 1KG8A 4HCFA 4E9YA 1JV7A 1ZDQA 3NSDA 4HZ1A 5B35A 2BP8B 2BWIA 4HIPA 3C9LA 3REYA 3AG4B 3COCA 1V10A 1AACA 3NJFA 3ZX1A 4FPDA 3NP3A 2FJSA 4DPCX 2HRGA 5D4HA 4QLWA 2W88A 2XX0A 3GYRA 1E12A 4TXVB 1A8ZA 4KO6A 5B1JA 4PCYA 2Y69B 1BQ5A 3UGEA 4MBSA 1JGJA 4A2EA 2N0MA 3AYNA 2VM3A 1CC3A 2XUWA 3FYIB 2XX1A 2PPDA 1XIOA 2ZIYA 4DP8X 1JZIA 1SDDB 4K9JA 2DY2A 5H2JA 1PNCA 3H56A 2HX8A 4QIDA 5G2CA 4Q89A 5I6PA 3AW5A 2PP7A 3PWHA 2IDQA 2RACA 3U25A 4M3HA 3WKQA 1E65A 2FT6A 3TU6A 3NYAA 3VI0A 2VMJA 3CG8A 4DP5X 2UXTA 3DIVA 4BDVB 5PAZA 3X3BA 3UAAA 1OV8A 4KNSA 4AKOA 1GZMA 5PCYA 5TK4A 1NDTA 4G70B 4N6HA 1DZ0A 3CDZB 2RH1A 1UAZA 4AMJA 3AZUA 3OQRA 4A66A 2YXVA 2I1XA 1TN0A 1EZLA 3A7KA 3FU7B 4JHVA 2Y00A 4EJ4A 1FWXA 3DQBA 3OM3B 3QBIA 3FPYA 3S3BB 2BP0B 3WI9A 1AS7A 3FT0A 1EHKB 1L9PA 4YL4A 5B7MA 2I7SA 4HWLA 2CALA 3D12B 2X87A 5G28A 4DKLA 2VM4A 3PAZA 4E9VA 3S8GB 2JXMA 1KV7A 3DKHA 4KNUA 2P80D 3ODUA 1BQRA 2UXFA 1SFHA 1AZCA 4N8UA 1JZFA 3C9MA 5AZDA 5A44A 2XVBA 1JZGA 2OV0A 4KNTA 1AAJA 1UCQA 1J9QA 3UTYA 4J4QA 2PLTA 1MGYA 4DP0X 1QM8A 2YCXA 1PCSA 2FWLB 2J55A 2R7EB 4A2DA 2EIMB 2PEDA 5DHHA 5JJEA 1GSKA 5B6ZA 3PQRA 4XT3A 3OMNB 3FU8A 4YSTA 1WA1X 2WSDA 3HAQA 4NAJA 5B7EA 1BRRA 1GY1A 3HARA 4G72B 2KSYA 3NJHA 3T6XA 1JZEA 1ILSA 3CDZA 3X1FA 2FNWA 2TSBA 2YAPA 3GXUB 4YSSA 3P0GA 2PPFA 3WG7B 1ET5A 5I28A 1M0KA 2Y03A 1PZAA 5G36A 4AMIA 2BZ7A 3CVBA 2IWKA 4X4KA 2YAMA 4KLYA 1NTDA 2AFNA 1L0MA 4JR8A 2FQGA 3CVDA 1M0LA 1XJIA 3QJRB 1SF5A 2QDWA 2XV2A 1E5YA 3T6ZA 4DPBX 1XB3A 2DV6A 4KO7A 1R84A 1HFUA 3ABWA 4QRYA 2KSAA 5H2OA 1SHXA 5B3SB 2JAFA 2ZOOA 1F4ZA 3UTWA 5EN0A 4GP5B 1L9TA 3AY2A 4UF7C 3NJIA 2HXAA 1M9WA 2GC4C 3FSVA 4JKNA 4AZUA 1BQKA 2CJ3A 2UXGA 3UONA 1NZRA 2Q9OA 1JV6A 3VHZA 4YSQA 1QKPA 4F2FA 3FPXA 4LDLA 1HAWA 3WNJA 4YSRA 5FJGA 3WKPA 3AM6A 2ZXWB 2EINB 3OMIB 1GW0A 3PXLA 3ASOB 5AFAA 3UZAA 2BP8A 4GPOA 1AZNA 5I6LA 2AVFA 1Q5IA 1J9TA 3QJVB 1CURA 1IXFA 3GDCA 5B1JC 4JHUA 3NSBA 2HPYA 1X9RA 4DP6X 5EHFA 3OE9A 1PY0A 3OE6A 4WW3A 1L9OA 3PAUA 4BK5C 2BHFA 3EHBB 5I6KA 4MQTA 3IN0A 3OE8A 4AX3A 2YQBA 3QDCA 2DYSB 1BXUA 4UANA 4MFHA 2XXGA 7PCYA 1QKOA 1MG2C 4L6RA 3N2JA 4HAKA 2IWFA 1SF3A 1ZPUA 1CWQA 3T9WA 5H2NA 3ZIYA 1CUOA 1NPJA 2NRDA 3WQJA 3AG2B 2GB2A 1ASQA 4PXKA 2JFCA 3H4HA 4YVUA 3SBQA 5I5IA 4BEYA 2UX6A 1SJMA 2WO3B 2XU9A 3FU9A 4E9SA 1OCRB 1OE2A 2J56A 2PCFA 2EIKB 3VW7A 3NY9A 3UTVA 4HHGA 4W1TA 4DP4X 5B7FA 5H2KA 1M56B 4OV0A 4G7RB 1X0SA 2QPDB 1NWOA 4HCGA 3SBPA 4HYXA 4MD2A 3OMAB 4A2FA 2FQDA 4YSOA 2QDVA 2LNLA 8PAZA 1L9QA 1L9RA 4HALA 4A67A 1KCBA 1OCOB 1XB8A 3UZCA 2IDSA 3NYKA 4YVNA 1HZXA 3HAPA 1DZEA 3SQRA 2PP9A 3V2WA 4F2EA 4X31A 1SNRA 1AP9A 2Z55A 1WA2X 2YAQA 3S3DB 2Y02A 1PZBA 1FBKA 1MDAA 2PPAA 2JKWA 3FQ2A 2GBAA 2NTUA 4RH4A 4L35A 5TK2A 3TASA 4AKQA 3UACA 4IAQA 3OD3A 1NINA 3T6VA 4JQ6A 1QLEB 1BXAA 3FQ1A 1JOIA 4FA7B 3VGAA 1KDIA 3X1NA 3ABGA 5A7EA 2IAAC 5I5JA 2ZZLA 1RKRA 4YSAA 2AT9A 1GYCA 4BUOA 1KCWA 4M4RB 5AHZA 1AG6A 1A4AA 2W8CA 3NT0A 2KS9A 2QPEB 4K5YA 2F93A 3NSYA 3UADA 1KMEA 5JJNA 5D4IA 9PCYA 1FFTB 1ASPA 1W6LA 5A8EA 3CAPA 2M3GA 5AZUA 4KNFA 1TU2A 2J57A 4A68A 2GIMA 4E9RA 4ZK8A 2LLNA 2WO2B 2QT6A 1ET7A 1RZQA 5I26A 3BQVA 1L9HA 1B3IA 1JERA 1IBZA 5AX0A 1P8UA 3WNIA 4ENZA 2B3IA 3KJ6A 2FQFA 3JT2A 5F7BA 1VJMA 2J4YA 2DYRB 4GYBA 1PAZA 1R1CA 4W9ZA 1Q5JA 5H2LA 2PP8A 3QQXA 2I7OA 3SN6R 1CYWA 1NICA 1IW6A 4CSPA 3AG3B 2B08A 2I20A 3CZUB 3H4FA 3QJUB 5AWZA 3SBRA 1O0AA 4QI1A 1F50A 4AKPA 1IUZA 3X1EA 4UAHA 5D4JA 1BEXA 2AZAA 3NJJA 5I6NA 4P5RA 2PPCA 2XV3A 3JTBA 5E9NA 1E5ZA 1S54A 3ASNB 3FSZA 5I5MA 5DHGA 1E30A 2R7EA 3ERXA 2X72A 3UAEA 4WTQA 1PZCA 3VVKA 1BXVA 1VGOA 5I6MA 1ASOA 3QAKA 5JJJA 1KBVA 1WS7A 1AZUA 1V54B 2BW5A 3MBWB 2GSMB 5G2DA 4P5SA 5B1AB 1H2SA 3S8FB 2A3TA 2DWSA 1SFDA 2GI0A 3UG9A 1ETJA 1P8HA 1JVOA 2Y04A 4WKXA 3FSWA 3KW8A 1GS8A 1AQ8A 1PMYA 4EA3A 1F88A 1PLBA 3D4SA 1NIFA 3QJSB 1WAEA 3V9EA 3T6WA 4BWUA 2IWEA 1AR1B 4HYJA 1N68A 5BR2A 2EIJB 7PAZA 1E67A 4G71B 4JKVA 1A4BA 2FT8A 1LN6A 1BRDA 1IKOP 1ZV2A 2XWZA 1JXGA 3DDLA 2IH8A 1AS8A 2J5WA 3CODA 4NERA 2YAFA 3QJTB 2VSMB 3ZDWA 3TA4D 1OCZB 2FTAA 3C75A 1NWPA 1HAUA 4N4YB 1GS6X 3NS0A 5FC9A 3NSCA 2FT7A 2IH9A 3UABA 4FBZA 5H2PA 1GR7A 1SHWA 1WA0X 2GHZA 2OJ1A 2XXFA 3V9CA 3IBOA 4GY4A 1KG9A 4IB4A 5H2MA 1TKWA 3NP4A 4E9XA 4BXSV 3PXOA 3UTXA 3RFMA 3ZPQA 2AANA 2I85A 1M0MA 2Y1AA 4YSUA 1P8IA 1OE1A 2Z73A 3AYMA 1T5KA 3HEIB 5C1MA 5A45A 2VT4A 1NIBA 2HRHA 5LDUA 3X2QB 5AHYA 1C8SA 4X1HA 4MQSA 5ITEA 2YDOA 1IC0A 2CCWA 4GP4B 1PXRA 1MZZA 4BXVA 5I6OA 1M57B 3EH5B 4XTOA 1KBWA 2YARA 5BR5A 2P80A 4A2GA 2ZFEA 2CUAA 3X1GA 3NJNA 4Y9HA 1AS6A 3QJQB 2EILB 3MBVA 2UX7A 2R4SA 1J5CA 2F95A 1OF0A 3PAVA 3QBGA 1S52A 2XLLA 3HB3B 3HANA 4GBRA 1J9SA 2YCZA 4BWWA 2ZWNA 4KOBA 1L9SA 5IY5B 2G87A 3NSFA 3ABKB 3PPSA 4KO9A 2XYBA 4UG2A 1WS8A 4E9TA 4X32A 4AI7A 1IW9A 1KYAA 2YAEA 1ILUA 4DP7X 1NIAA 5TGZA 5B1BB 2CBPA 5B1KA 2Q5BA 1S53A 3X3CA 1JXFA 1BYPA 5J7AA 2YAHA 3ZBMA 3NJLA 1ZIBA 5ETZA
chains in the Genus database with same CATH superfamily
3F12B 4POZD 4O51B 1XMEB 5E08H 4KROC 2DTMH 3MROA 3FSOA 4X7TA 3QNXB 3SHSA 5F96H 4NNYA 2ZOUA 1WAAE 1YLBB 2EE3A 4F7PA 2ZXEB 2W9LA 1NC2D 4MA1C 2DWDB 1PSKL 2FEDC 3LPOA 5C0IA 1E4XL 2R29H 4X9IA 3RNKB 3CFJB 3LXBA 4B27A 2ZF8A 4PLKD 5I18H 1XCQA 3G3LA 3PWUA 1F6FB 3EYUL 3MLPA 3QA3A 3OG4B 2B4CL 1ZS8A 4FI8A 3REWB 3MBEC 3QDJD 4G8IB 3ALPA 3GZQA 3CVHH 1OHQA 4XTNA 1B0RA 3AAZB 4OZGE 4C4KT 4GLRH 4PJ8C 4JDVB 5AW7B 2FZ3B 1SYVB 1HWWA 1BAFH 3BUIA 8CGTA 2I60H 3L1OL 3T2NH 2O93L 4L4VE 3BQUA 4PRBB 1U19A 5EZLB 3VFRB 5BZWB 5KSAB 1OCWL 4Q2ZB 2OJZH 5GZNA 2EYSB 2YFOA 4KMTL 5GZOD 1KEMH 1X5HA 2W07A 2HKHH 5AOZA 1BVNP 4M7KH 3ZU8A 2CA3A 1TZHB 4MJ4A 3FO1B 1M1XB 1KFAH 5T5FA 3QR1A 3M17A 5D1XB 3V2YA 2SEBB 2KZBA 2VITA 5CAYB 3PHOB 4FXGC 3D06A 2Y5QA 5MEND 4L8CA 3V79C 5IUSA 5FGRA 1I1AD 3JTSB 2BX5A 3GMOA 3T2OA 2R29A 3F04A 4JN1H 5F7UA 4ANWA 3HFML 4AYDC 4PBVC 5CLWA 5DXWA 1OXYA 5HGHA 2G4GA 5KVMC 1D5MA 1PYWA 2JTYA 3LRSB 1AQKH 3GJEA 1HVXA 1UTDA 1VLXA 3CUPB 3SDAB 4AV5A 2ZYHA 2AEPH 3E9TA 1JZ7A 3NPZB 1KWGA 5SWSE 4C54A 4IKNA 3QEQE 1LO4L 3FQNA 1F5WA 4LE8A 1AIZA 3HE7B 1WCBB 2AJ3B 1UD3A 2OW7A 3MRMB 2VB5A 4JAMB 3U2JA 4B0MB 2NY0B 3BSGA 3CX5J 4P0DA 5CIPH 3PFUA 4WUUE 1QLFA 3EIFA 4HUCA 4KQ4L 2C7FA 3ALXA 3RIFF 1MLCA 4WAVA 2W9EH 2EH7H 2P45B 1INDH 1HS6A 3UGXA 4DKFH 2NX5B 2DQ6A 4G80A 3BP4A 3U4KA 4ELKA 2BCKA 3MTXA 2AEQH 2RTTA 3MRPA 5FUZL 1G7MA 5TGBA 5IUCA 3ULUL 2OULB 4I0PC 4JBSA 1VJSA 1G1CA 4ORGB 4F57H 4YR6B 4P5MA 1GY2A 1KJ3H 1C7SA 1RY7B 4YZFF 4L48A 3ZXAC 5J06A 3LB6D 1FAIL 1Q1JH 1FHNA 3MNVA 1N0XL 4ZFOB 4F3FB 3SDCD 2ZNXA 4JVPA 3D9AH 4LLQB 3MROB 3N04A 5E8NB 2VXSL 3T0DA 4I48A 4R9HA 4PU2A 5LBSA 4CMHC 2IXQA 4JFPB 3KLLA 4QTHB 2IQ9H 4ZUWA 5G5DA 4L3EA 3GYRA 2QHRH 2E75C 4L29A 5DHYB 2KBGA 3BUBA 2WCGA 4F7EA 2Q7NA 1NLDH 4WY7L 3VXUD 4EZMA 3UMNA 5I76A 2Z31B 3MRKA 3TA3A 3U6RB 2VR9A 3B9DA 2NY1C 3AXIA 1G7HA 5ADOH 4PWGA 5CIPA 1SDDB 1K2DB 3ETTA 2APVA 3SKMB 5I6PA 3T8XA 3FAXA 2BVQB 2WTPA 4HWZB 1DQML 3H7BA 3G08B 4J3VA 3ULSA 1SXSA 2RB8A 4XPAL 5AENA 4P46D 1W15A 1RSYA 3AXHA 3RFRA 4ZUSB 5ETUA 4KNSA 4XO4A 4X6CF 4JHWH 4LSSL 4MLIA 1CCZA 1A2YB 2ZUYA 4RISH 3QJFB 2E59A 3UJIL 4DEPB 3SE4C 3VXRA 2ZYRA 5JPNC 2BY3A 1G9MH 1IFHH 2F7PA 3I74A 1QFWL 4LARL 3GSQB 1EHKB 1G0DA 1KJVA 4LP4A 3FT4A 2VRQA 5ESAB 3RNQA 3P1VA 4NO0A 1JWUA 4OH2A 2WQ8A 4Y9FA 2K6YA 4N8UA 3ULVE 1PFCA 1BA9A 3C9MA 2NY3C 5KVEE 3MV11 4U1KA 4NQVA 4PGBB 4FMFA 4UM9A 4YZFE 3ZDYE 1TTAA 2MCAA 4Z7QF 2NXYB 4MCYB 1MFCH 1E5AA 2WTOA 1MGYA 3SB3A 1I1AB 4ELDA 3WN5A 4WI3A 1CIUA 3FU8A 2P8LA 2ID5A 6TAAA 4JFYB 1YNLH 4DN4L 2UZXA 1A5FH 2YR3A 4R5TA 1VSCA 1GC1H 4ZW6A 1QHPA 2KSYA 4OGXH 2EVIA 1QR1A 1H15B 4BYHA 5A2BA 2H9GA 4P2CG 1ZLUK 5L9DL 2R51A 4HOXA 1BD2B 3P0VH 4AQZA 3GXUB 1KG0A 4P9HL 5I66B 5LB1A 1M0KA 1AGEA 5FM5M 4DH2A 5G36A 1E28B 3DNKA 4YJZL 4KUZL 3QHZL 4X4KA 3DX8B 4ZJ9A 1U8KA 4KHTH 2XKNA 4TSBL 5A6LA 4PY8J 1E5YA 3RGHA 1S9XA 1JNNH 4GW5A 4Y2DA 4BZ2A 2GJPA 4L3AA 4QXUH 3LRHA 1MHPL 4DEUA 1OIOA 3SYQA 4HQQH 1UA3A 1JWMB 4PJHE 1ZTXL 1M3JA 2XIBA 4TQIA 4K73A 4DCQA 2BRQA 2CNYA 1EAQA 5DD1H 4WF7A 1QKZL 4ODSH 5L2KA 4KKRA 5AYUL 4WWKD 2IAND 1LO5B 4AGOA 4TUJA 5TDPA 4LFHG 5L4IA 3OMIB 1EO7A 1KIQA 1Q94B 3LZNA 2FWOB 3GDCA 5I8EB 3Q9QA 1H3GA 3PP4L 5CSBA 3DX9A 5D5MA 5CGMA 5FHAH 3KGUA 3EDDA 4MQTA 1PW3A 3KZ8A 1NC4A 4BGDA 5IQ7L 1SDYA 3CQFA 3FQNB 3OE8A 5TQ0L 4AX3A 4J2QA 1EFXB 1WDAA 3CDFA 4Q9CA 5I2IA 5F44A 2G3NA 2BMKB 3O3AB 4IIQC 4PREB 4P59L 1MWAH 3GSWA 3U48A 1GGTA 4ZD3H 3OKEB 3KDMA 1JF5A 4WEBH 1DSFH 2F8OA 2UY7A 3FFOA 2LAGB 4U0RB 2JJSA 4N25A 3IS1X 5LAXB 4PG9B 3EGDB 2CGRH 2D03H 3IDNB 3LIUA 4FTVE 4YQXL 3IS0X 4IOFD 1D9KD 4NQCE 4PJ7F 1C9SA 4AE1A 4XOEA 4OLZL 5FYJH 3HBZA 1MCPH 5IHZA 3LS5L 1CD1B 2RR3A 3KWWA 5BZXA 3DX9B 3SE9H 1OTUC 4N0YH 1KC5H 3F5WA 3P4NB 2P9RA 5JIHA 1RZKH 3GHBH 4OQTH 5I1IL 4I4WA 4PSPA 1TTGA 3T1WA 3HRZA 1QQDA 4TYUA 5DZOA 4GFXA 4B7LA 1PZBA 1MWAB 2CCLA 4JE4B 4WAFA 5HGGS 3ZKNC 4ANUA 2WHVA 2NTUA 2E4FA 2AK4E 3CSBA 2WQUA 3CU1A 2MQ3A 3T6VA 1OQOA 1IEAB 2HN7A 3GJFH 1KSRA 1CR9H 5FFLA 4JHZA 3LKRA 1RIVH 4QRPE 4FQ1L 4AC4A 1M9SA 2NCEA 2JKRM 3TF7C 1XXFC 1EH9A 3ZHNA 3VFTB 5MI0C 3DBXA 4NXSA 3I02B 3KPLA 2I26N 2AK1L 4YLBA 2ROYA 4P23C 3MLTA 3W9EA 1EBPA 1W6LA 5A8EA 3EOYG 2M3GA 2DL2A 2J57A 4JW3A 2QKIA 4GIOA 4NNYB 2HTKC 5DUJA 3T0EE 1QI5A 4HCRL 3EBIA 2F8IA 4KKBC 1HHJB 4QHMA 1S7QA 5EOCL 2LABA 3OC8A 5FO9A 3NZSA 3MV9D 5DMKB 3TN0A 2PP8A 3W5NA 4CU7A 3Q6GL 1CYWA 4O5LL 4N5UA 2VISA 4TPRL 1MAML 1J0HA 4MAYC 1N6UA 4UT7H 5B22A 3TH2T 1ZHNA 3VD4A 4G83A 2FLRT 2QJDA 3F7VB 1F50A 1IVTA 5D4JA 1WIUA 4FI7A 1T22B 1YY8A 3GUTB 2PPCA 5DS8B 2FX9H 3DX4A 4KUCD 3X3GL 2FEDD 5TJWK 3RWJA 3SGJC 5C71A 1A6AB 1A6UH 3OZKA 4Q7DA 3FH5A 3U4EB 5KVEL 1HEHC 3HNSL 4YDVB 3VVKA 3L9RB 2RGSA 4F33B 5EO0B 1XWVA 4JFXA 1A7RH 3N43B 1SJHB 4G6AD 2A3TA 4GSDH 3MOBH 3SJVB 1OB1B 4QYOB 1IFRA 4L8SC 2HN7B 3K4ZA 4JO4L 5CGBA 2WXRA 5I5RA 4M6AA 4FXKC 4B53A 3LKSB 3DIDA 2W65B 5GRUL 2VSCA 5F9WB 2IWEA 1ZOXA 1FFPA 1E27B 3GI8H 3QQ9D 4LCWE 5JQIB 5JW5B 3NQKA 5SX4I 2AKRA 1BRDA 4M3KB 4BINA 2VLRA 1INDL 1UXMA 3CLEH 4NERA 1TQSA 2IFFL 2Y1VA 2QQLL 4ZSOA 3NIDF 2QV4A 4AM0A 4Z5RA 4AG4L 1T83A 3VWKC 1NWPA 3AREA 4Q58C 2Z9TA 3P4NA 3TO4C 1WJ3A 5B21A 2ZWLT 3QHTC 1C7TA 3D30A 4HWNA 2VAAA 5EA0H 4IRSB 1VGKB 5L2JB 1EO5A 3GBLA 1TKWA 4KAQH 3R8QA 2XVLA 1PBYA 4I2XB 4HT1H 4TSCL 1U2CA 2P24A 4ZMQA 3ZTEA 3RU8H 2XTSA 4F1ZA 4TNVK 3MKKA 4M56A 5I6OA 1TJMA 1FBIL 3N9GL 4I48B 4JCWA 4PTTA 1NCBH 4U1NB 5DJ2B 3UYRH 3VA2C 4F7TA 4FFYH 1P1VA 5BR5A 4QRUA 4LLQA 4DESA 3QFGA 1PS3A 3OKDA 2F7OA 3MLZH 2OA9A 5I1HL 1MVFA 4HH9A 3WIHH 2FBJL 1E9QB 1F4AA 4D94A 1DUYA 2JK5A 5HHNB 4K3EH 3RAJH 4E42B 5J7CC 3S5LA 2F19L 3DROB 3FB8A 1A7NH 4M6OL 2F54B 4JPVH 1DVXA 4OBRA 1FNGB 3T0VA 4Y1AD 1AD0A 2OCJA 3O0RH 4WK2B 1MLCB 1YJDH 3QEQD 4FHBD 4CSSA 4PVBA 2APTA 4Z95H 5CEZH 5A43C 4XNZC 3GMRA 3JVGC 5C0AA 1IVLA 2L8AA 1ZIBA 5IVXA 5BXFA 1DQDH 3IJ9A 3FT2A 4A6YL 4Q6YA 1X5XA 4LT7A 1WD9A 3G5YA 4PI0A 3S34H 3WSQH 3RFZB 2BNRE 4JR9H 1JHLL 1EQWA 4GYCA 4QHUB 1MFBL 3MV9B 1ET8A 4KJQC 4XNUL 5CBAA 5B2NA 2AABH 3LQZA 1EO8L 5JXEA 1JYWA 3IMBA 2BNRA 3DX8A 3RUGF 2PPEA 3MOAL 2VITB 2RQEA 1BOGA 4IARA 1JJUA 3T0BA 4LDOA 2UXVA 4WW2B 4JY5L 1NM9A 1HQ4B 4MNQB 1A65A 2CCVA 1EJ8A 1UZ8A 2BP0A 4JM2C 5C0GA 5I19L 4DP9X 5CZKA 3TBTB 2LHAA 1GAFL 2IIJA 5K9OB 2DMHA 3G5VB 2YPVL 4KK8D 1TEGA 1FO0H 4Y1AB 4H0GA 5E24E 3KNBA 4PP2A 4POUB 2QSCL 4UIMA 4EDXB 1DYZA 2AK4D 4QHNB 3RQ3A 3VGAB 1WZMA 4QCIB 5T33L 4BE6A 5FLUA 4YX2L 5E23A 2IGFL 3VWKB 1S6NA 1UWGH 3LEVL 4E9WA 3S3CB 2O1AA 2Q7YA 3IJSA 3WFBL 4AQAB 3HUJB 3JVFC 4X6DA 1GU8A 3CV5A 5DC9B 5EZOL 5E8DL 4QKTA 5FF6B 2NY3D 4FEIA 1PQZB 1AZRA 4W9HC 4J12A 4L1HA 4MD4B 1R3LB 4KQ3H 1MI5E 2Q2EB 1WSST 2DQTL 2J1YA 2X7LA 4XAWL 4DERA 1WBYA 4EI5D 4TUOA 5DEFA 4Y2NA 1DQJA 5CJ5A 1NMAH 1AO7A 4NN5C 1QYGH 1LO3H 1D3CA 1Q9WA 5C86A 5J6HB 3CVHB 1MLBB 5DLMH 1BQHA 3ARDC 3CCHA 4A37A 3FU3A 4Y9CA 4GQRA 5BOZG 2ZICA 3N3EA 2AEOA 3OLEA 3ZRCC 2NNAA 1JPTL 2BS9A 3QI9B 3G04A 5I1CH 4ZSOE 2B2XH 4Y19B 4Q6IC 1G1YA 6CGTA 1EX0A 2KSBA 5AALA 3PLYA 2Q3XA 4CW1B 4HG4J 3P0YL 2EE0A 1R2NA 2HLEB 3LZFH 4QHKI 5AW8B 3MRKB 3U6RA 3QQ4A 3PDDA 5CN3A 1NIDA 5DMIL 4GI9A 4AT6A 3QIWA 3CFIC 1RUPH 2Z7YA 5EUKA 1YNKL 3IGUA 3PV7A 5IHWA 1RVFH 2NY5H 3RWIB 2VABB 4KOCA 4YDKL 3X1BA 5BQ7B 3BO8B 3HZKA 4N4WA 1XZWA 1IQWH 3OAWA 3TBBA 1E6OH 1O6SB 4L0PB 1HKLH 2CHZA 1UM4H 5DR5L 3ILEA 3BRFA 2Q86B 4ZUTA 1SN5A 1QPXA 1ZVHA 2WYZA 2X2YA 4MQ7B 3BZEB 2WLIA 5E8PA 3TT1H 4CKVX 1T2JA 1OM3H 5I1EL 1GGUA 2WCSA 5B39A 4J3UA 3S48A 3B2VH 2JB6B 3V6BR 4Z23A 3S4SB 2R4RH 5DZJA 4MKMA 3EO1B 4QRSB 2IGLA 35C8L 3JV6B 1PZ5A 4FFZL 5EU5A 4I0KA 3W0WE 2XN9A 1ZJBA 4UIKL 5HHPA 3ZHDA 1CLYL 3GHBL 4NQXA 2GT9B 4PCYA 5B1JA 3EUUA 5EBMB 3O9WD 3MRHB 3ILQC 4DHLA 4HD9A 3FHQA 1A47A 4OV5A 2RA1A 4PV9B 1O0VA 3PL6B 1IC7H 1HX0A 1MY5A 3GZOA 3TVMD 3BE1H 2QVKA 1N5AA 3BPCB 3U25A 1SEBB 2OMWB 4G3YH 1JPSL 1H0DA 1U8HB 1WCBA 4WI2A 2V17L 4EUPG 1NFAA 3IXTB 1UCBL 3D07A 1DCEA 1NGYB 4GUPA 4KNQA 3I6GA 3APNA 5EG6C 4MMYB 4AT6B 3OQRA 1JVKA 3EYQC 1F45A 3OPUA 4TNEA 4XRCA 3JYCA 3T4YB 1PLGL 4RX4D 2R0LH 2HKFH 3HLAB 4RDQF 1JXKA 1TEYA 1J8SA 3WGUB 2DLEA 2I7SA 3IFOB 5BRZD 3MACH 4YE4L 5IQLA 1M1XA 3O2VL 2UXFA 3U7YH 1TZHA 3UERA 5AZDA 5ENWB 2XVBA 1MCSA 2DBLL 3HJ0A 1JZGA 1IGTB 2B15A 4U05A 5C0JB 4P3DA 4OLVH 5I8KH 5JNYB 2L04A 3ZTJG 5JPMA 2J55A 3D08A 3VXMB 2CR6A 2WNWA 4QY8B 2YSTA 1KPVA 1J86A 3AB0B 5E7FA 2V6HA 4Q4EA 4G6KH 1QFUL 3O3DB 1XAKA 3FFCB 4NQCA 1A6UL 4OBSA 4BHUI 1BP3B 3UZVB 2AAAA 2EXSA 3NZ8B 5IHBA 3R19A 3LRGA 5GGSY 4PHZA 4P04A 2JQMA 4HPHA 1UB5B 4R97C 2OJEB 3ARVA 1J8HA 2JB5H 2OR8A 4IOIB 4WW2F 5HYFA 3ROLA 1ODUA 4S2SB 4AMIA 3CVBA 2ZCZA 3HG5A 2KLSA 3GDBA 4HC1A 1F86A 4HXAH 4PP2B 5GRUH 1PY4A 5F89B 1J5OL 5D5MF 3TBYA 2WVVA 3CN2A 3TN0D 2C3VB 4Y1AA 3U0TA 3WHXA 3ESVF 3BRDA 4K8RC 4U1SB 4V33A 3PNRB 4KH2A 1IKFH 4TM9A 4QXGL 2BFGA 2A9NH 4UQ9A 2A7BA 5MEOA 5CHNA 1BZQK 3ZTCC 4E2OA 1RJZB 2HXAA 3R18A 4ADGA 2CKBH 5IHHA 3QNXA 4OD2A 1ERNA 3UPCA 4F15B 1N67A 4XZUA 5IVXE 4K3GA 4ZMWA 5IW3A 5IR1B 3FPXA 4KAQL 2AXWA 4FZEH 3WKPA 2MNWA 3AM6A 3E80A 3O3EB 1Z5YD 1UWYA 1TQCC 1YQ2A 2EADA 1H6UA 1RHHB 1TVBA 1MFAL 3HAEH 1ZT4A 4JHUA 4W4OA 1EHLL 2P42B 2K6WA 3K8LA 3T3PE 3H3BC 5I17A 4WW3A 5AVZB 1F11A 1DQKA 2J5LC 4GO6B 4I13B 4PJIB 5G4NA 3UTSD 1CFTB 1RZ7H 3ESUF 3P02A 2ITDB 1I7RB 1BXUA 1CT8B 5DMGD 1IC4L 4X4YB 4OCXH 3STZB 2YOAA 1KJ2B 4RGNE 4FFZA 5F1NA 5DZAA 4YFLF 5F70A 4UTBH 1BCIA 1FZJA 5DTFB 2BNQA 5DD6B 4AJWA 4AIXA 4PXKA 2JFCA 2IPKB 4JJ5B 3RPBA 4W93A 1UWEL 1WP6A 2Y2TA 1G6RL 4BZYA 1TJXA 4OJFH 5FOBA 3PE9A 3SE4A 3NY9A 2MFNA 4KXDA 4PGZA 2AC0A 1S5HB 2J73A 1J0IA 1FL6A 3BQUD 2Z0BA 3DJ9A 4PB9L 1VADA 1DVQA 1GHFL 1U8CA 2OL3B 2WIMA 1OSZA 2HVKB 4NQSA 4UDTA 4JHAH 3AM8A 4Z7WB 1NDMA 1L9QA 1L9RA 4G11A 4MYWB 5HI3C 1KCBA 3WUZA 4A67A 4AMKL 2EDNA 2FYYA 1DZEA 1DQLL 3NAAL 3ZDXB 4CNIA 2ADYA 4F7TB 4F2EA 4JFQA 4MA3A 2BVPB 1INQB 3UXFA 2VUYA 4Z8FH 3DRTB 1EEUA 5C0EB 1HXYB 5D1ZD 1AQDB 2EACA 5FA4B 4OLUH 2VDKB 1ZT7A 1MAJA 2CZNA 3EZ8A 4KKAD 4PYGA 2CDEA 2VDPB 3P9MB 3ZUNC 3LPGA 1VGEL 5DQDL 5BV7C 5HSFA 4RWYL 1I9EA 1QLEB 4R4ND 1T6VN 1IQDB 4WJKB 3ABGA 5GJSL 4PYHA 2HJFB 1DZBA 4GKNB 4HHAA 5IJKC 3LN5A 4HJGB 5JHDB 4YSAA 5CEZE 2GAZB 1X4XA 3FQRA 1KCWA 1ACZA 3RVWC 5I18L 1S9YA 5IBTH 3PAYA 3IXTA 2F93A 3CSFA 5C08D 4KTGA 2FO1A 1OL0A 4WCYH 5EIIB 4RGNB 4S1SL 3VFUB 1EA9C 3BD3A 3KBEA 1TJGL 5JORB 3RPKA 4LLDB 2J4YA 2JI1A 3HC0B 1JFQH 3B2UC 4KFZC 1QSFB 5F8RC 1T1XA 1NICA 2JF1A 1FZMA 1L7TH 2Y1ZA 3BVNA 2AQPA 3DXAE 4XN2A 5E7BA 1DBAH 1OPOA 4U6HB 5BZZA 5EZOH 4U7MA 1UEMA 4HS3B 4G7VH 4KC3B 3FOLA 1HHKA 1QTPA 4JZOA 4GRWH 3DJRA 1BEXA 5KSBA 3LZPA 2X4SB 4OVUA 4C56B 3APMA 4PRHB 2EO1A 1E5ZA 5JHDA 4G6MH 3V55A 5I5MA 3N43F 4YGVB 4P5KA 3UBXA 2FX7H 3JWNE 2O72A 5GHWH 1HYSD 2J5LB 4X42A 1EHAA 2BNRD 3LY6A 4DAGL 2CKNA 5AVYB 5B1AB 1N2RB 4RMUA 1SFDA 4O9HH 4CSTA 4EI6A 1E2WA 1U2YA 4MAUH 2NY7L 3QQ4B 2X70A 4YWGH 2RIKA 5CXPA 1M05B 2GKIA 1JPFB 4IRSD 5D6CA 1R75A 2WIIA 1WBZB 4V2BA 2ZG3A 3C8HA 4YBQC 1T0MB 3CK0L 2F8XC 1GIGL 4G9FD 1P4LA 3D3VD 4GT0A 4X5RA 1CXKA 3ZL1A 5JIMA 1MFDH 4M8RA 5SV4A 4D9QE 1OCZB 4XGZA 3T3ME 1FL5B 1LJMA 2F18A 1IARB 4DFHA 1D6VL 3UABA 3EG9A 3FXIC 3VQ2C 2XBTA 3I50L 1SBSL 5DS1A 2R69A 4MVBC 1DUZB 3UTXA 3JV5A 3PL6D 4QOKB 5EO1A 5A2FA 4YIQB 3H3PH 3KJ6L 5GGTA 3WS6A 3HI1A 5D7IE 2VWEC 2HRHA 4W9LC 5LGYA 5LDUA 2XZZA 1MRDL 2QTEA 1Q1PA 2NDGA 4JJOA 5CJOL 3SPCA 3UL4A 2LFGA 2CLRB 4YEFA 35C8H 2Z7UA 3LZOA 4TNWK 4N0UE 2JQZA 3L1EA 4BFOA 1F3JB 5IVNA 3DO7A 2EICA 3GHPA 1CLYH 1GGBH 3CXDH 3II2A 4Q9BA 4QOKA 3S36X 3HKZA 2GBVA 3NZUA 1RJLB 4PJBF 1OP5K 5E5UB 1OF0A 5DJAB 3FONB 1OAZH 2IQ9L 1XGZA 2PXYB 4KOBA 4X4XB 1U8JB 3WKML 2G87A 5AKTA 3NSFA 1CD8A 5FCUH 1CICC 4YBHA 3HFMH 5H2BB 1VAHA 3B6SB 1SHSA 4CVXA 4NUQA 5GZOA 2ED7A 1MIML 1ILUA 3MGTB 1U8PA 4H26B 4G8FB 2HFTA 3KM1A 3QDGA 4BV1A 4Y1TA 5IJVB 2DQDH 3WTXA 4LVNB 1MRCL 3KL3A 4L1SA 4M6NH 1V05A 1TZAA 2J71A 4I77H 4CRPA 3VUAA 4QGTA 2AQQA 2R1XA 3BWUC 3OZLA 4I5BA 3WXWL 1UFUA 2FSEB 1XD0A 2HKFL 5BS0B 2RAMA 3CPLA 4CL7A 2ZWZA 2DQFB 3S88H 5IB2B 4ERSL 4NNPL 3VXUA 4S0HA 2NR6A 3QUXA 3AQZA 4PGEA 3F7LA 4AGLA 4YN3A 4PP1C 4BGLA 1J8HB 3BZFB 3CHSA 1ITBB 3NY8A 1IM9D 4KKPA 1CYGA 1QHJA 3BP7B 3QO0A 3TNMB 3O4LA 3P4LA 3VNZA 5LWYL 4Y2LA 3POHA 4FGMA 2C5DC 2D2CC 3MNWB 4Z7NF 2I25N 4U6XA 5HGDA 3K46A 1U2HA 3SZKC 1Q8MA 4TQPA 3F00A 3VRIA 3DV4A 1FYTA 5DD5L 1MPAL 5CP7A 5JORA 4XH2B 1OOWA 1S8DA 3FQ4A 3SJVD 5IROD 2H1PL 4P3DB 3ECWA 1FH5L 4XXWA 5DT1L 1YN7B 3TOPA 4LEBA 1F56A 5HHNA 2D3LA 4GSQA 1FF5A 2A9ML 3VXTA 1AZVA 2OXHA 2OYKA 3B56A 3HUJF 4KZ0A 2APFA 4WV1C 2YAOA 3VFWA 2D4FA 2XV6B 5AOKA 4GB9A 3LN4A 4PD4J 2VXQL 5B6VA 1BF5A 2ZNWA 4IS6B 1YEGH 3L7FB 5CEZD 5IQ9B 2AJYL 4U1NA 2FEEL 1X6NA 4IOSA 2VW6A 2D7QA 1ADQH 3QHZH 3ZYOA 5KANG 3ZT5A 4PJFB 1YQVL 2VIRA 2N59A 2P24B 2HJLA 1A7PH 1JV2B 5GRJL 4AJYV 1I8MA 3ZO9A 1T21B 3G5XA 1T7YA 2WV3A 4JHWL 1UJ3A 1KCUH 4LSSH 4XHJD 1TKWB 2W95A 2YXMA 1NMBH 1R5WA 4KZEL 5CWSA 5IV2A 2EUVA 5LQBL 3MCLH 4NQVB 4CUCA 4OCYH 1S3KL 1XV8A 2VLMD 5D1ZA 5FEBA 4RMWA 4CGUB 3QJHA 4LKXA 3UEQA 1DL7L 1NKOA 4TQEH 2I35A 4Z7WA 2HUEA 1QO3B 1MG3C 4HUWB 3TIDB 5BPPA 2WOYA 1XCXA 5JPNA 3ZZ1A 4K3JL 3PDSA 4OI7A 2AJSL 5FOBB 2FJUB 4HH8A 4FAAB 1LLAA 2AZUA 3RYMA 3BH9B 4HSCX 1C3WA 1H3PL 4WNSA 2VKWA 4P2QD 2L6XA 2GC7C 4RGOH 5IQ7H 3IJ7A 4B3EA 2BOBA 2MTPA 2Y07L 3FMGH 4HKXA 5JOPE 4FQJH 3VSTA 3BAEH 2EYTB 3U36A 4G6JL 3B1UA 2YMOA 2B5IB 3KAAA 4QRBA 2HX9A 1WFMA 2AV1B 3W39B 4P48A 2FX8L 2VUKA 4XP9H 3HPLA 3WN5C 1FSKB 3ZUCA 1Z9PA 1U3HA 3PGDA 3BZ4B 3K71B 2NNCA 4Y4FC 4JRFA 4KRLB 1WITA 1FNFA 4XN9A 4XN7A 3GD1C 4ODBD 2YC1B 2OPCA 3BLBA 3QUMB 3BDYL 2W88A 4HFWA 4LL4A 5DJ8B 2WWMC 4BBWA 4AOFA 3W2DH 2GSIB 4LGPB 3WN6A 4MS8D 1ZXQA 1PJ9A 3NFNA 2CKBA 5BV7L 1CF8L 4Z8FL 4HIHA 5HGAA 3AC0A 3Q13A 2OMVB 5JDSB 1OKEA 4MJ6A 5DMGC 1O7VA 3MX0A 2HX8A 2J12B 3GGWB 3NCYS 2E56A 2X6BA 3AFLA 3X13B 3KWUA 3NOIA 4HISA 3F2LA 5FS5A 2L0DA 4NQUA 3QVAA 1AO7B 4FZ8H 25C8H 4JFEB 4YDLC 3CG8A 4GJTB 4ZQKA 2IOMA 4IM8A 3ARXA 4HIQA 4BDVB 5HPMA 1KMGA 2J88L 2NNRA 1R3LA 1F90L 3GJFK 1BBJB 2VR3A 4K7PL 4LSTH 2BOCB 5E6ZA 5JA8B 3N85L 5ANMA 3K0WA 1SXBA 4IDJL 3FW6A 2EC9U 4KI5D 4ZFGL 2IDCA 2ICWA 4LSPH 3QFJE 1B9KA 2ZXBA 5EWIL 1YNTB 5I1KH 2JLLA 1UB5A 1VPOH 4ICWA 2DMKA 1NCCL 2BSEA 3FT0A 3WLBB 1CFVH 2FJHA 4XCEA 1TJGH 1SOXA 4DNLA 4Y89A 3ODUA 1M7XA 3ARUA 1GC1C 2WANA 4HK3J 1AQMA 1ZANH 5I1JL 4XMZA 3MLVH 1FE8L 1AAJA 4J4QA 3D87B 2YUXA 4QDGA 1A0QL 1RJCA 2BDNH 1YYMH 4GPVA 1DE4B 2JCWA 1XIWD 3MLXL 3CXHK 4HXBL 1WYJA 1D5RA 3JTSA 3NGBB 3JBG7 1BEYH 4C83A 1WEJL 4IKJA 4WSGA 4O00A 4U1LA 3GIVB 3FO1A 3GRWL 4HEPA 1FUNA 5I1GL 1QA9A 4PS3A 4XCFH 1E3FA 4Y5XA 4L9LA 2OMXA 3B5TA 1LE9A 2TAAA 3IU4H 2YD3A 3IPFA 4HK0A 4Z7VA 5MERA 1XF2A 1T7WA 3HI5H 2GEEA 1NBVH 1NTDA 2OZ4H 5LNEA 1QTYT 2X4PA 3MV9A 4NRYA 5CEXB 1EZVY 4POZC 3T3MB 3VW3L 2P5ED 3K8KA 3BKYH 3KLSA 2Q87A 4DPRA 3CK0H 4NHUB 5KSAC 3B2UD 3DHUA 2JAFA 2FO8A 2BSRA 3EUDA 4NHCL 1PIFA 2FHCA 1Q72L 4FLHA 3AVEA 3HE6D 3MRDB 1FQ9C 2ARJQ 3MV8E 1S7XA 3C8KA 3SJVE 3TJHD 3UONA 1AD0B 5CN2A 1M1SA 2IFFH 5EOQH 1HAWA 2HT2D 4L8BA 2ZXWB 4LAQL 3ASOB 3CZGA 2G75A 4GPOA 1NFDA 2CGYA 4BQ9A 3L2LA 3MBED 4H8WC 5B1JC 4ESKA 2Q10A 5JOFB 1M2VA 5FB8B 2XTJB 5D93B 1DVFA 3DGGA 3VFMA 3F85A 3N1FC 3R0NA 4Q56A 1QATA 4P23A 3OKDB 1E4WH 4Y7OC 2YQBA 4HT1L 1SOKA 4F8LA 3X17A 1YAZA 3MODL 4O02H 1U8KB 5IW6B 2VAJA 1G4MA 1WQVT 5I8CA 2FR4B 2PCPA 1JDDA 1ZLUH 4PV8B 1Z2KA 3ULUH 4NN6C 3PNWA 1IL1B 1CIDA 3KBHE 4J6IA 4PJ5E 3U4BH 3JQOB 5DZPA 3VD9A 2OMTA 3FU9A 2VLME 1KELH 1OAQH 5ESQA 4MAYA 2DJ4A 1VGKA 2R2BB 3K6SB 3QEUA 3HRPA 2JKSA 2E9JA 1H3XA 3UTTE 4IK6A 2DAVA 1LD9A 3I85A 2Y22A 2PCPB 2B16A 4MD2A 4A2FA 3QWRA 2J1ZA 2Q6WB 3WN5B 4M6NL 3MKGA 5EIVA 4NQDB 3QYMA 1C16A 4N5EC 5F72S 4TN9A 8PAZA 5LGJB 1JNJA 4JO4H 3FULA 4PJAF 5ITBL 3ARWA 4FERA 5FW6A 4NUGH 3IDJA 1EXUB 1THAA 1LL1A 2EDHA 2L7UA 2WQAA 2VDKH 3BWAB 3DVNA 1AD9A 5D6DC 3S3DB 3O6FC 4XPBL 4XVUC 1EAPB 3TZVD 3BAWA 5DSCB 2DEWX 2WZAA 1XCTA 3BN9D 4FX5A 3QIUB 2X4OB 4XAKE 3G7TA 1PQZA 3L3OC 5A6MA 3FQ1A 3GXDA 1R3HB 2CXKA 2DQJH 4XTRC 4OF6A 1OHZA 3AUVA 3KPQB 4P2OD 1SMDA 4MCNA 4UB0H 3VWKA 1WZ1L 1K9TA 3C5SA 2A6JB 1LWJA 4Z76B 3D85B 5BVPL 1E9PA 4QF1B 1SN0A 4WGKA 5EF2A 1Q9KA 3LB6C 4A68A 4ZK8A 2LLNA 1NCBL 1UH3A 2F58H 1L4IA 5CEXA 1QWUA 1F3DJ 4ZTOH 1XF2B 5AX0A 3EJRA 3RLSA 4PVNA 3QEUB 3KMDA 2Z31A 3TA3B 3A4EA 3T0EC 1WWWX 1TYEB 4XBMA 2HFGH 4U7KA 4FJYA 1C1EL 5F9AC 3QORA 2CRMA 3GMMA 3CZUB 1QEWA 2AJVL 2BVTA 1KT2A 4PJ7E 4QTHA 2QQQA 1FORH 1KY6A 3C2AH 3EJCA 3AWGA 3KYMB 5HYSB 1A66A 3U2IA 5DHVH 3O2DA 3I75A 3A47A 1M6UA 2A99A 4LEOB 3P69A 4NOBA 3MRBB 4HW6A 32C2A 1G9EA 2R2EA 2ZKYA 2VM9A 4LEEA 1ETA1 4N0CC 1I7TB 5IVOA 3STBA 4HGWB 2VSDA 3TNNA 1Y0LA 5IVXB 3QDMD 2AJUH 3NDYE 1GPOH 1JP5A 1QQDB 3VM7A 1J1PL 5BR2A 1QFWM 4TLUA 3ARFD 4XPFH 1TCMA 3TEUA 3GRGA 2F54D 5KW9L 2X89A 4HQQL 3BXNB 5ANMB 2VSMB 5AOJA 3S5LB 2FTAA 4NDMB 2B2XL 1XF4B 3BHBA 1H5BA 3FQUB 4KWUA 4L8DA 4FBZA 5H2PA 1SHWA 3IETB 5EFIA 4MHHG 2H6PB 1JF1B 2IOIA 4GT7A 3FKUS 3NJXA 3WJJC 3AM8C 5AW4B 3X13A 3BVTA 2ZOKA 4FG6C 3RTQD 3PJNA 1UGKA 5C1MA 1CLVA 5DJZA 3A23A 4L8CB 1AI1L 3L3JB 1OSEA 1E6OL 3UZEC 4XNQB 4Y4KA 5I82A 3FB7B 5JLZA 2YBRA 4ETQB 1BLNA 2DTSA 1BIIA 2N0KA 3E1F1 5TDOA 3CDGB 1MFEH 4DZ8B 2JI2A 1CFNB 5JZ7C 3H9SD 4JRXA 2VDQB 3ENEA 4MNGB 2ZOTA 3CFEB 2DD8L 3K71A 2JSFA 3O2DL 4YDNA 2C1PB 2QVIA 4R6UA 5IJKA 2DN7A 1AH1A 1IJNA 2GJRA 1AMXA 2X6UA 3WNOA 4FQIL 3OHXA 4PJCF 4Z5RB 1HCYA 5ERWA 2EIBA 3MO1B 4U3CA 3TP4A 3UG3A 4AI7A 4JMNA 3MRLB 2Y7LA 4HIXL 3B8SA 1NIAA 3O6KH 3C08H 4BFFA 4CJ1A 2EO7A 1T2QH 2ZAGA 3DDFA 2F7QA 3ESMA 2DLFL 4X99A 4P5TB 1XGYL 2IJ0C 5IJBC 1JWMA 4IDJH 1XF1A 3D5OF 2AXGB 3ULUD 5F0PB 3LYRA 5IROA 3SJVA 2EVHA 1XCQB 1ZAGA 3PWUB 4KJQD 3OAYK 1Z1WA 2X42A 3KW7A 4N87A 5C2BL 4JUSA 2BRDA 1L0PA 2XKNB 4RQQA 1QSFD 3KYMA 5HYSA 3QZOA 1RQ5A 3QEQB 3FQXB 4ATTA 5F7WC 1O5PA 2YXWA 3MA7B 4YDZA 5DA4A 2WWMD 3CHQA 1ETZB 2JIXD 3AG1B 3FCSA 2Y06L 3T04D 1P4IL 1VZIA 3DYOA 1BZEA 2UVFA 3NPSB 4JVUA 3Q2VA 1T66C 4AH2B 3MX0B 3W3BA 2J4WL 4O51A 2BDNL 1DVYA 1JFHA 3G5XB 3NRFA 1UM5H 5D55A 4U0QB 1CDJA 1TITA 2J8UE 2YLKA 2GSGB 3N1MC 3QPQD 5DGQA 5IOPB 2JAGA 1R17A 1E9PB 4RCAA 4YGVA 4OGAD 1D5BA 1VZGA 4XOCA 1KGIA 2JJTA 1EXGA 3PRZA 5H8DA 1ND0B 1OE3A 5T1LB 5I15H 2QLYA 4U1KB 2BNUA 2EABA 3ARPA 1UQSA 2AHIA 3KPQA 3TC9A 4DP2X 2WQXA 4YEEA 3RFZC 1PKQB 1S9WA 5KYXA 2VXQA 2X3BA 4PB0H 3ETBJ 1BAWA 5G2AA 5E00B 3I6SA 1MJ7H 1JGUL 4DJHA 2Y7SA 5EZJA 5A2KH 1GZPB 2VDPL 1E3ZA 1IEAA 2IF7A 3DSFL 4NRZA 1J8HD 2V7HB 4A6YA 2KPNA 4AGMA 3MBWA 1YEKH 3QXVA 2DI7A 4NC1E 4X4MA 3FTYA 3IDJB 3NACL 3O45A 2G9KA 3L16A 4G7SB 2WXIA 1XR8A 4EN3D 3DTUB 1U91A 1WLHA 4HWZA 4L4JA 4BD4A 2FYVA 1LD9B 3DGCR 2C1PA 4H13C 4HWEL 4X8XA 5HVHC 3O9WB 5L8LB 3WDIA 1RZJC 3QUXB 1Q9OB 2H3NA 5I9QB 4AQ8A 3ZQWA 4RFOH 4ZUUA 5C3LD 4ZAKB 3SDAC 2IVFC 4JFFB 1G7PB 2HH0H 3Q2WA 5BV7B 4GMSH 5JLZB 1X4YA 1XTLA 4D0CB 3SDCA 1WWCA 3DRTA 2CHNA 3OGOE 4AM0Q 5ACLA 5GS1A 2WYTA 3GHEH 5I8KL 4N0FB 4Z3FA 3HR6A 4MA3B 3ALWA 3ECUA 2VC2H 1HHHB 2UVEA 4MMXB 4B41A 1SY6L 1W0VB 2J6WA 4XWOC 5LGKA 5HYSG 2VLKD 5GSRB 4L0ZA 3BKCL 3LH2L 3PCYA 3UBXG 4E9YA 2WLKA 1NGPL 2W60A 3PF2A 1SLXA 1TSRA 2CO6B 4JO5A 1XCWA 3COCA 2WXPA 4WENB 2B1AH 3V4VH 3K6FA 2ORBL 2GYSA 2EIZA 5AW1B 4MQXD 4QLWA 5GRWA 1PX3A 4IBWA 4J5VA 1KLGB 2P5EE 1F4YH 1RSFA 3C8KB 4KO6A 4R3SA 2VDKL 4LSQH 1X6LA 4UM8B 3BT0A 3UTZB 1NCJA 3HN8A 4WI8A 4D7BA 3QO1B 1JGEA 3IBEA 3VXRE 1CMOA 1QLEH 1T1ZB 4LHUG 4K5OA 1JI1A 3MV8D 4NRXB 3IDGA 3BP7A 1WFIA 3KS0H 2ADJA 5MENA 2XRAH 5FM8A 4PGEB 1JCVA 3GBMH 3WLWC 1S9XB 2EE2A 4GW5B 2OMXB 4EIGB 4EZKA 5MENE 4L4TD 4AKOA 4XI5D 5IIEB 5C0CB 5A2AA 1RZKC 1UAZA 3DUSB 3KGRA 3LMJH 3MMEA 4EJ1C 3GMMB 1O6VA 3KWVA 4PJCB 5DJXA 4EXKA 1YSOA 3QJZA 3ULAB 5T3XH 5IW1B 5GXBB 3JTTB 1U8QB 1FDLH 3RZCD 2X70B 4OIBA 5E94A 5B7MA 5IBTL 2CALA 3PAZA 2XWBA 1OSYA 3VWJC 2JXMA 1UT1A 3HMWH 3WHXB 1N2RA 4KJPD 1ECYA 2VDOL 3HG1A 4PJ5D 3FTSA 3TBSA 3RDTB 4D0DA 2YFNA 3IFPA 5DUML 4HU2A 4QF1A 4KQ0A 4XNYH 4D8PB 1TTRA 4S2SA 1SYVA 1XH2A 3MQIA 2FL5B 4N90E 4X8CA 3Q8EA 2C9VA 4OCRL 4PRHA 2BJMH 4YPGB 1B2WH 5EZIL 2NDFA 5FYKE 3OR7A 3HAQA 3HW7A 4PGCB 4Y9BA 3UO1L 3DO7B 4Q6KA 1S46A 3IKCB 3FOMA 1RUAH 3M07A 1ES0A 4BELD 2XVGA 3BVNB 2X4OA 4HKZB 3P0GA 2CPCA 3O6FB 2WB7A 2A74A 2YN5A 2ATKB 1MCEA 1NLBH 1T1WB 4X8JB 5AW5B 5LG6A 4G82A 4BQ6A 1SUJA 3ARGD 3CVDA 4OF3A 4FFTA 3HN5A 1SF5A 5LAPA 2HRPL 3IMWA 3BH8B 2JE8A 4DUXA 3T6ZA 5JUEL 5J9PA 2WB1A 4XMPL 3QZWG 3EGXA 3HTLX 4UNUA 3W9DA 5IK3A 1SHXA 3VXUE 3VD0A 1Y7VA 4HIHB 1Y18B 1S9YB 4NGHL 1WV7T 5EN0A 1HCZA 1RZIA 4TRPL 1LP9B 4UF7C 3SPVB 3T8XB 3EO0B 3NJIA 5HDBE 3LN5B 4HJGA 1FZOA 5IQMA 2UXGA 1C8QA 1NZRA 1XBDA 2FGWH 3CZFA 4Q74A 4WHYG 3FUHA 4PVLA 4B96A 1NMAL 4PJCE 1QYGL 3WFHA 4MBRA 4ADJA 5DDHA 5AZ2H 3L3HA 3PXLA 1ZGLA 3EOBB 2PETA 2AVFA 5A16B 1CI3M 2P48B 2YEZB 4J1UA 5C0EA 1JD7A 4ZMZA 5C0RH 3DOSB 3OE9A 3PAUA 3UJTL 4H1LG 2BVOA 2VDNH 5HI4D 5C0BE 4H8WL 1EZVX 2G2PA 2XXGA 3D8MA 1Q0YL 5ESVA 3KPNA 4OV5B 4XNMA 1LK2B 4AMWA 1A6VL 1EVTC 4QOKE 2H4EA 4DKEH 2VWEE 5JOFA 1MW1A 2CDGB 4U6HA 3VXOA 1J05B 1M6OA 3QNYB 4L5FH 2K7QA 4FG0A 3BZDA 2XU9A 4FE9A 2BCKB 5E2TL 3QUYD 1GGCH 1VB9A 3VTTA 1QZNA 4ZX4A 5D96B 3RWHA 1S7RA 3Q1SL 4PRAA 2C26A 1QSED 4DO5A 3C08L 5CEYB 5INCA 4OY9A 4HSAC 1KJ2A 1UUNA 4X7SH 1K5WA 4RGNC 3DOSA 2DIBA 1OGAA 5T3XE 2NY7H 1HZXA 1H3VA 1IB5A 3QW9A 1FFOA 1A64A 1D5MB 3LRSA 1B9ZA 4JQIH 3WFHB 5MERB 5AVQB 2UUDH 4OZGF 1OAYH 2GBAA 4QMEA 2VZ3A 3GXPA 4L35A 3LVTA 1YN6B 4F9LA 3BE1L 1WHPA 2Z8RA 1GXEA 3MJ8A 5EOCJ 1YJDC 3G04B 3C5ZB 5LBVA 1F13A 2OFQA 1A6ZA 2ZZLA 2DWEB 3PABA 4ZS6D 3KH3A 3LPFA 1B4JH 4OCWL 5BJTB 1PL3A 3V6ZA 1P84J 4BUOA 3L48A 1NGWA 4LLYA 1NANI 2DEXX 3CN3A 3Q6FA 3HRZC 1GGIH 3VCLA 3HHSB 3SYAA 4OZIE 1U8CB 3OJDB 4LCUB 4OGZA 4RFNC 3VXRD 3ZKND 3BQUB 4PRBA 1T3FB 3NA9H 4JFFE 4WNQA 3GNML 5DU7A 2BP5M 3UC0H 2B3IA 2FVNA 2X4UA 4FABL 2NSXA 4KKZA 3H42L 1QTSA 3DXAA 1KIUA 3F6JA 4EOWL 1XXDC 2H1PH 1A21A 1BHGA 1Q5JA 3DO3A 4JZJA 2EO9A 1ACYH 4QRQB 4YHPA 5DT1H 5FR3A 5ID0A 2Z8WC 4F58H 5KSVB 2FL5A 3CX2A 1U92A 1MQKH 3WJLA 1D5IL 3N1GC 1MVUB 3UTQA 1BM3H 4UAHA 4WNQB 2B59B 1L3NA 1CDCA 3NJJA 3U0WL 2J6EA 3OKLB 5DHGA 4JREC 4WFED 3K4DA 5GGRA 5DJCA 1LO0H 3ZOAA 4MMZA 1BW8A 2UWEF 2X53A 2CJUL 4IGBB 5C07A 3QPQC 3D4CA 2R0WH 3NCJH 5GGVL 1VFAB 3K1DA 1TVBB 2GSMB 5AG8A 3QDGB 4XP6H 2PF6A 3L3KB 1K3ZA 1T6WA 3JSSA 4QHPA 4MXVF 5F0LB 5H35A 3UG9A 3G6JA 1P8HA 1XF3A 4A7SA 2WXFA 1D9KC 5TE4L 3TYFB 2VMCA 5AW2B 4NNPH 4M7JL 2BSTA 4FNTA 5IBLD 5ICUA 3OAUL 4AZ8A 3OZ9L 4IRJC 3LQZB 3ARRA 4WHDA 2J1XA 3AS2A 4EIBA 3GINA 2PXYA 3QUMA 1YEHL 2OBGA 1IKFL 1FPTH 1X5IA 1G94A 1UA6H 1TLKA 3MRJB 1OGTB 3BUTA 1L0QA 4QHUA 1ZA6B 5KAQF 1X5FA 4HV8B 3V5KB 4CADB 1EMTL 4PS4H 3IU3B 5LGHH 1Z5HA 4X6EB 3RURA 1OAKH 2F2HA 3B3IA 4QXTA 2I27N 4XBGA 1LM8V 1LE5A 5FYLD 4GMTL 4OIFA 5CEYA 4WI7A 4MZ3A 2M26A 4QRPD 5HGBB 5HYIA 3BUPA 1UXLA 5C0FA 1U0QA 1SLVA 2X4RA 1J5HA 2P49B 1WIPA 3A67H 1C8SA 2HVJA 2HFFB 2YD5A 5D6DA 1DVUA 4XZ4A 4QHKJ 3KLQA 3HNVL 2YKKA 4ACPA 4QTIL 2O5YH 3ZMEA 2ZFEA 3X1GA 3BN9C 4K2UL 4EN3A 1OP4A 1WFJA 2UX7A 2GABA 3AREC 2FBRA 1BX2A 4U49A 2APSA 1S9VB 4OZHE 3L9EA 2VDRB 2JKNA 3PS6A 4O4YL 3W2DL 1E40A 2B9AA 1BVOA 5CKGA 5HDLA 2VDLH 4E9TA 1P9MA 1GOHA 3IE4A 5BS0D 1KB5L 4WU5B 2GW5A 1A3RH 1NDGA 2VABA 2YAEA 3ZKXB 5JXAL 4XWOD 1PDKB 3E6FA 1NAKL 3SDXA 5LQBH 5EUKB 3VG9C 1TTFA 5E6IC 1CDGA 1NOLA 1QX1A 4M61B 3ZBMA 5E9DD 1OWWA 5IGXH 1QRNE 2VAAB 2O6CA 5IB1A 1XZ0B 1GSMA 2BZCA 3ARDB 1X4ZA 1WFNA 3S35H 2D7MA 4C58B 2FQEA 2HUHA 1LTXA 3I6LD 5T3XL 5AOIA 4C56A 1AZBA 1RU9L 3WGVB 4CMHB 5DI8A 2F8VA 4IMLB 4RAUB 2NNAB 4PJIE 4L05A 2ZPKH 2GFBA 1N64H 1IC1A 5GISH 1ID5I 5I16B 4AJVA 4LRNH 5ILTH 2E86A 2V7HA 3UDWC 2KDGA 1KGCE 4LO9A 5EU3B 4NYLB 3NTCL 1MNUH 4F7KA 5L8KB 4IJ3B 4KJYA 2MOQA 3P0GB 1FVDB 5CCKL 5D9SB 3CFNA 4MZ2A 3I9PA 1UATA 3QIBD 5E8OA 3HASA 1NEPA 2MHAB 1JMXA 2ZCLH 4Z7QE 4YXLL 2P4AB 2ZXQA 3RZEA 3BGMB 3IJSB 3RWEA 3SN6N 2WQRA 4AQAA 3C5JB 1DVSA 5EF1A 2UYLA 4NN7C 3ZE2B 1KIPB 2ADIA 1WCQA 4YSDA 5F8UA 4G43A 4HOWA 5JW4M 1BRXA 3RZCA 4JY4B 1B6UA 4Y4FA 2J72A 1HZHH 1CE6A 1I8IB 3N1PC 6PAZA 2VISB 4OCMC 1IGCL 2A6DA 2ENQA 4JPIA 3NFPA 1ZLVK 4GH7B 3EW3B 3DRQB 1CLZL 3RZCC 3T45A 5T1LD 4DGIL 3I9AA 2ED9A 3RVVD 1U8QA 4MA7L 5IB5B 3V4UH 4JFQB 1MFNA 1HQ4A 4MNQA 4NEHB 5EN2B 3U7WH 2XTLA 1G6VK 5HDQL 3MLSL 3M8OH 1NIEA 4Z7WF 3SY0A 1CICB 2QVTA 1QNZH 3B2MA 4M8VA 1TMCB 1HU8A 2RALA 2B4CH 4PJHF 5E1AB 1DJIA 2B59A 1LQSR 2HPTA 5G54A 12E8H 1QACA 3SCMA 4O2CB 5C3TA 3QE5A 1FZKA 1ZIAA 4PJ6A 3AY4A 8FABA 1X9UA 4EI5B 4GUQA 1NC2A 1HEZB 3IFNL 1JAEA 3DV6B 1T1ZA 4NZTH 2Z0UA 2OJZL 4P07A 4M7LL 5BVJB 4N90D 3AY4C 3CIAA 5CZXC 1HIMH 4N8VG 2HLFD 3LQAL 3QUML 1DDTA 2C9RA 4X9GA 4GS7C 3KR3L 3EMLA 4ZO9A 4FQXC 5FM5O 4AV4A 1HINH 3HE6B 1OP3K 1H68A 1E0PA 5TFSH 4LXFA 5IHZB 1WEJH 1KG8A 4LIQL 3ZE2E 3QUZA 4LLMA 4GQQA 1TYRA 4LLAA 3QIUD 4NO5A 1XGPB 2OR9H 4L4TA 1ZRUA 4CC0A 4Z3TA 3C9LA 4JM2B 2I9LA 3U46A 3C5ZD 3EGDA 4DSYA 4HOZA 3M1BB 5D2LE 3APDA 1U3ZA 2LU7A 3D39A 3L5XL 3FHAA 3I9GL 5DVMA 1HYSC 1RJZA 1T0OA 4Y5XC 2NNXA 3VXSA 2W38A 2R29L 4LGSB 5HI4C 3DUUA 5DFAA 3U9PL 1UD6A 3ZKMD 4WV1B 1JPGA 3SQBA 5IBLC 4J4PA 2BC4B 3NRQA 3SKOB 4N2GA 4NDMA 2VN5A 4PJAA 3TU6A 2FT6A 5CN1A 4X6CE 3UTQB 3O9WA 4YXHH 3OPZH 5CO1A 3MV7A 1KIPA 4GG6B 2YBGA 4WI4A 5AZEH 4MD5B 4WJ5B 1RPQA 2CRIA 1NDTA 3BOVA 2X1PA 5TQ2H 3FTGA 2WXQA 3ESPA 3RIFK 3RVXC 5I0XA 4ZSOB 4AMJA 4R7DA 5EU7C 2K9UA 2WMPB 3AT0A 4H8VA 4AV0A 3FU7B 1K5NB 3NSJA 3QNYA 2GUOA 1M6OB 3OM3B 4Z0XB 5MP6L 2OI9C 1GGYA 1T3FA 4CBZA 1AS7A 1KWKA 2DRUA 3CMOH 3OJDA 4IKIA 4QY8A 4OZ4B 1S7WA 1KB5B 3QZBA 2OSLB 5EU3A 3DKHA 3KL0A 3MRBA 1KN4H 3GMNA 3NIGF 4AEHH 1DVFC 4FQCH 3TCLB 3ATAA 1VZHA 3QUKB 3PV6A 1BMZA 3WMQA 2BNQD 2FWLB 3SE8L 3IDIA 1S7TA 2CHDA 2F74B 3QYCA 5E9DE 1NFIB 1RZJL 2O6DA 5A16A 3BT2L 2HCZX 2Q8AL 5I66A 1FV1B 3PY9A 1AKJD 4KKAC 4NAJA 5I24A 1EDQA 1JUFA 1AQKL 1BLIA 3I6LE 1FORL 3C2AL 4BZ2H 5AW9B 2CJUH 2DWYA 3FO2B 3V0VB 5F7YC 4ODXB 1DANU 1O9VA 4R0LB 1JD9A 1RL1A 2H0FA 4XPAH 2ZAHA 4ONFH 4YSSA 3X12B 1ZT7B 1J0ZA 1YEEH 4IBYA 1OZTG 4DN3L 3GS0A 1KGCD 4HSQA 4PCKA 2Y7QB 3OAUH 4Z7WE 1ZK9A 1QASA 4BRVA 3GKWL 3QDJE 3A0OA 1UKQA 2DV6A 3H6AA 4X7FC 1KY7A 5DD1L 3TTSA 4DPBX 5T3ZD 3ZDXE 3L3GA 5F9DC 3TBVB 1ADQL 3WFEL 2YD0A 4BEIA 1ZVNA 4JLRA 3O6FA 4NI3A 4GP5B 4AYFB 2X44D 2Y6TE 3MUGB 1WFUA 4P46A 1JHKL 3RPIA 2NTFA 4LHUD 5M95B 2D8KA 4AITA 1J05A 3MRFA 3V5DB 1G7LA 5C0AE 3LIZA 1AQHA 4F2FA 4Z3IA 2WKGA 5FJGA 3ARFA 2OMUA 43CAB 1BG9A 4QYOA 5I6LA 1AHMA 2GJ6A 3QJVB 3GI9L 5FYKL 3MYJA 5DA0B 4U6VL 5ELIA 1ZY9A 4GAAA 4WFFE 4MA1B 5D2LF 3U4EA 4D3CH 4RA3A 2VDRL 3S2AA 3I9IA 5GPRA 4Y5VB 3RWJB 3TYGL 1S2EA 3GSOB 1MCOL 2GTZB 4YLCA 3AS0A 4WK0B 2MQGA 3E0GA 4TL4A 4HS6A 3ZE2F 1ZPUA 2ODIA 4ZUVB 3PP3H 1TQWA 1RHHA 5FHBH 1C5DA 2MWCA 1ED3A 1DQQB 2OTPA 3PWPA 3SBQA 1P5UA 3U9UA 3QORC 5I5IA 3OQ3B 4JPKH 1SJMA 1X9QA 4IRZL 4Z7UE 5D7EA 1MWOA 3VI3A 5IIEA 1UYWH 1C12A 5F7LB 1L5GA 2DEYX 3LAFA 3VH8A 2G3XA 4K8RL 2YPLD 4N5ED 4G7RB 2KERA 1MLBA 4DWHA 5IT2L 4PJFF 1P5UC 5EU6D 4FQIH 2XWEA 4Y16A 4Y4HD 4N8PA 3L5WB 4UINL 2HP4A 5IGXL 1IFHL 1J8KA 2VZVA 3I6KA 3GWJA 1A9BB 1CB4A 3L4YA 1BGXH 3HAPA 4JZNB 4PY8I 4Q0XH 5CINL 1F4HA 5IQOA 1F6AB 1BV8A 3MLRL 4WFGE 4X4ME 1IIKA 4OCLC 3O6LL 3V6OC 3VD2A 1EHNA 1R19A 1L9MA 4PS8A 4AW7A 4B5ZA 2OM5A 1GJUA 2YGQA 3ME0A 3CC5B 3NG5A 3QH3A 3IKCA 4FQ1H 4RH4A 5TK2A 1YDPA 1QABA 3QBTB 3IXAA 5E4OA 1TZOA 3ES6B 4P2OC 5F1OB 4DEPC 1BYNA 1BXAA 4KUCF 4TOYL 2CO1A 1PZUB 5FYLE 2AQTA 4UBDC 4RDBA 1A6TB 1FN4A 3IFPB 1A1NA 5L88L 5CZXD 4LCVA 2Y7NA 4I3SH 3SQOH 4BRJA 3FQTA 2NT1A 4AIZA 3MUHL 5C0JA 4UTBA 5T1KD 2YGNA 4KNFA 1JYVA 1I9RL 4X0NA 5ENWA 5C0GB 4MMXA 1SVZA 2H8PA 2WO2B 4GAYB 4PCTA 2DWEA 1KFGA 2GBTA 3JT2A 4MXWH 5C3IA 1J87A 5SX4H 2E76C 3GM0A 3QWOA 1WUZA 4IRZA 3L4WA 3UTSE 1DBJL 3SN6R 2PW1A 3VU1A 5I15L 3FRPG 1CFQA 2ZCKL 5FUOL 1UOVA 1R6VA 4FNRA 3WS3A 2WBJA 2VE6B 3DBSA 1FLTX 2W07B 1YYML 4QJ4B 1P7QA 3IJYB 2AXFA 3C5XA 1ORQA 2EC8A 4JG1L 5E9NA 1XDTT 1E6JH 2D7TL 3FO0H 1U91B 3UAEA 1NC4B 4UT6H 3M45A 1JWSA 1HJCA 4HFUH 4CBPA 4GI8A 3L5IA 1QNZL 3C5SB 2ZCHL 2BW5A 5IB3A 3HPJA 1CGSL 4QRPA 1QI4A 1HH9B 3DUHA 3DJTA 3INUH 4G42B 4UV4L 5I71C 1NCAH 3IU4L 1ZS8B 5C2BH 3ZRSA 2MNJB 3BEWA 2H6UA 3UC2A 3GMLA 3V9EA 3QIUA 1AR1B 1ZTXE 7PAZA 1E67A 2YO3A 2F5AL 1LN6A 3UG4A 1HNGA 1YYLH 2DWDA 4UT9H 1G7QB 2GG1A 2IH8A 2J5WA 4PMFA 2IFGA 4H0HB 5JHDE 3C09B 1K4CB 2NYYD 2BNUB 2G0LA 3HBGA 4NWTL 2EDYA 2FT7A 5J5EA 1D2PA 3W37A 4ZMPA 1C12B 2VT0A 5H2MA 5KWYC 4WO4C 3O6MH 1TQCB 4FKHA 2C1OA 3AYMA 2E8ZA 3VSVA 4FTVA 5KG9B 4KVCH 5IFHH 3X2QB 4FJ6A 2HT3D 1IGJB 3A6OA 2WAQA 1PXRA 2BSBA 2H3NB 4GXVL 5IG7B 5DVLA 2GTZA 2FE0A 1AJ7H 2O6FA 3D9AL 3NJNA 2P8LB 5FDWA 2X4QA 1KN2H 4UNTA 2VZTA 2FD6L 1CQYA 1JCKA 3TV3L 4AM0B 5I9QC 5J4MA 1E3XA 1T0PB 1ZVSA 4KHXL 5F7DB 3U9PH 1L9SA 2V7NB 3DMMB 1BQHB 3CH8A 4PGBA 4XXCC 4UM9B 4PY7B 3QHFL 4A6YB 1KELL 1OAQL 4UT9A 3PJSA 3T3MF 2WQVA 3UIYA 4QJ3B 1M2OA 3KXFE 2P7TA 3S36H 4Z3EA 1LNUB 1NCGA 2A74B 3B43A 1JE6A 1LDSA 4JFDE 4XC1L 1KJVB 1I1CA 2AEWA 4HETA 1U9KA 4JQVC 4ZMNA 5C9KA 2PR9A 4UOJA 3ARBB 4HUWA 1JDAA 4G80B 4ELKB 2YQ3A 4KPHL 5KYYA 1PKQA 1S9WB 3VXRB 2DM7A 1GS7A 5K1VA 3TBVA 1QRKA 2YD4A 4Z7OB 5EO9A 5MP6H 5IMKB 3KL5A 2VZ1A 4MXVE 4AUJA 4GP8B 2H2SC 2V3DA 1KCVH 3NMEA 1LXMA 4BCZA 5K9KB 4D9LL 4PXFA 1DJYA 4PPTA 5KVDE 4G2AA 4QCIA 3EH4B 4YHMH 1II4E 3QIBB 1D5BB 1U95A 4BQBA 1B2YA 2WKOA 4I3RH 1U8NA 3CZLA 4IIZA 1VIWA 3SDAA 4NI6A 1F58L 4Q8BA 5DD3H 2XNAA 3VI3E 4MD1A 3OAYH 2B8OT 4M03A 2EC9T 3CFKB 4U1MB 4PG2C 1MHHB 2DIJA 5AEAA 1F18A 4HK0B 4J3OH 4Z7VB 1H6FA 3HMWL 4F20A 1QFWI 3RTLA 4F7EB 2EVJA 2W9DH 2QKIB 1FV1A 2NLJB 4HX1B 3MLTB 1JF1A 3HAOA 1D9KA 2VXSH 2XZCH 3WO3B 4LSDA 3T6QC 2CK0L 3QUXC 4RQQB 4JPVL 3MGOB 3RVXD 1E4XI 1YEEL 4NJ9H 1BVNT 1TZIA 3ZE0B 1NLDL 1OP9A 2GJ6E 1V3MA 1S7WB 1Z7JA 3TGXA 1KTBA 4KMLB 5AB1A 1NKRA 1ACCA 3O81A 2X4NA 4YR6A 5L9DH 1A6PA 3IDGB 2WLHA 1I3RA 2Q8BL 3HHRB 4FYTA 4JO3L 3L4XA 4JFUA 3NZHH 5CR1A 3VQ1C 4W70A 3DTDA 3FT2B 3FU7A 4DJMA 4YHLL 4Q9QL 3MRPB 1BFTA 1MFBH 2M2DA 3O4LB 1DLHB 4AQ1A 2NZIA 1Z9MA 2HRPH 1B0IA 3HC3H 5B34A 2NTWA 3VXMD 4P57B 3SDDC 1MCHA 4B7IA 3LKOB 4UQAA 1JK9B 2CM5A 3L95A 2CH8A 4PH8A 3BH4A 5FKAB 5MEPB 5DQ9A 1PG7X 3HFFA 4XTRD 3TF4A 4TMPA 2CAKA 2DQEL 4WV1A 1FBIH 1KPRB 3UYRL 5H2IA 1BYOA 1EZSA 4HP5A 1ZV5A 2PWGA 2I21A 2OCCB 4TTGA 2I69A 3WIAA 3H9SB 2Y0SA 5CJQL 3MRRA 2J8OA 4G8FA 2ZOLA 3KM2A 5FV2A 3O3UN 5EU6A 1L5GB 3T0XA 5BUPA 4XMWA 2QSCH 4QNPF 5BO1L 3FRPB 3VWJA 5CFAA 1KULA 4LBEB 1ED3B 1KJ2L 2XWDA 1EFXA 2L7QA 4APXB 1OM3L 1T4WA 1B6DA 4NM8L 2GTQA 2NY2C 4YDJA 5ANHA 1ZLWH 1SJEA 3ULUF 4HULB 4JL2A 5CGYD 2H6OA 5E1GA 4Q2ZA 5H4ZA 4KH9A 2VXVL 3F65A 3REYA 4JB9H 1IGYA 5KBKA 2O5ZH 1SDAB 4Z77B 4HGWA 2QADC 2BOBB 7FABL 4PR5B 3LEXB 3PGCA 2EEFA 2EZ0C 2MIZA 3T65B 3ULVH 1KJMB 2A83B 4G3YL 4PJFE 2R2EB 5FIEA 5A2CA 2EYRA 4XX1G 3PWNA 2MQ0A 2DD8H 3SE9L 5EF0A 4ELMA 1JZIA 2WVSA 5IVXF 5AB2A 1HOEA 3MV7E 4ZXBB 4URTB 1BZOA 3CFJA 4OQTL 3EXJA 4JFZL 3FJTA 3PDGA 4U6YA 3PWHA 3VD3A 3DMMC 4TLSA 3RVTD 1NCIA 3HBQA 1E65A 3J2PA 1YUKB 3VRLF 3QWNA 1KTLA 1S78D 1V3LA 2R56L 4F7CA 5EN2A 2KI6A 3O8XD 3QORB 2NYYC 5IV2B 5K69A 2H9GB 4AUUA 3RL2A 2RH1A 3V5HA 3KGTA 1F00I 1H15A 4FKEA 1A4KB 1IQWL 2Y00A 2WY3B 4JPIB 2P1YA 3DJSA 3L9BA 4GEIA 3J07A 3TN0B 4PJXA 3ARZA 43C9A 1CZ8L 2WVTA 3LEVH 4P3WA 4XP1L 1ZK5A 4XMXA 4A38A 2ZYSA 2E0PA 3RL2B 5EEVA 1A6VH 5IHLB 4P23B 3SKNA 2F7IA 2A9BA 1X5LA 3I2CL 5ID1A 1UCQA 3W9EB 3RA7L 1S7TB 3GS4A 4F2MA 4FTVD 1C5CL 4PRNA 1EWHA 4OKVB 1R3HA 5DMJB 4Y2DC 1LMKA 4NQCD 4R4BA 4KXZI 4MZIA 3L81A 5E99H 4XVSH 1KPUB 4S0TD 3RVUD 1COBA 2A0LD 1GY1A 4GAJL 3CH1B 5D2NB 4PJ5B 1MQKL 2HT4C 1G6RA 4NCDA 3NJHA 1OT4A 4KI1A 4P5TA 4N6RA 5AUMA 4MVBD 1O7SA 3PWJB 3B7SA 2X2IA 2X9ZA 2XWCA 1OTSD 3UTTB 1PZAA 2PW2B 1I9IL 2G2RA 1MW0A 3FUKA 3D50A 1C16B 1YMMB 4G9DA 1A02N 3FN0H 3HRZB 1X5ZA 3WTVA 1XJIA 2HB0A 2I5YH 4JKWA 3BZFA 4MKTA 4ZPVA 1ZSDB 5FYJD 5GRXG 2VDPH 3HAEG 4WHYH 4FQXA 4EN2A 2W0FA 2XZAL 2OSXA 3AABA 3WS3B 1RUKL 3RWGA 5F6IB 4P3CH 5BS0A 2RJMA 4APXA 3OZ9H 2GC4C 3BWZA 3JWOH 5BQDA 2BINA 3ZTDC 5KBMA 5EUOF 3CZJA 4KK8C 4AQEA 1EHLH 3VHZA 2W94A 4YSQA 2KT6A 2AITA 2Q1EA 5MEQB 3QRFM 5FLVA 4GKOA 2YZ8A 3BUDA 2AK1H 4WK4B 4S10A 1RIHL 1SEQL 3GSUA 1GW0A 2WKLA 5GGTH 4ZX3A 5JQ6L 1KB3A 2YRBA 3R4RA 3JZ7A 3T0ED 4F8PA 3GXFA 4R2GC 5L4FA 3MFFB 3SGKA 3TPUB 1IAKA 3OE6A 2HYMA 4DVBA 4BK5C 4L3ED 3U46B 3EOTH 3P9LB 3WNKA 1NGZA 4NP4L 3VI4E 3SYCA 1IBHA 4FNLH 4MFHA 4BKSC 5AD0A 4C8XA 4PW9A 3N2JA 1G7JA 1WGVA 4UOW1 3ES6A 3O9WC 3IJEB 1HE8A 4MJID 4M9PA 1CUOA 4JZJC 5ABZA 1PU0A 3MRDA 5DTFA 4B0MM 4PGDA 3EJTA 4BSVA 1J1XL 2NY6D 2RFXA 4G8EB 3LS4H 2IALB 3D18A 3BCFA 1MEXL 4YUEL 5KVEH 3QUYA 4HHGA 3WJLC 1FLRH 2DKMA 4DP4X 1CL7H 1UM6L 4PJDF 5CS7A 1AGCA 4O2EA 2X4NB 1MRFL 3JV4A 2X0VA 4L3CB 5AKVA 2FQDA 3CUPA 2WTRA 4KPHH 2P47B 3VFGH 2WZPD 5JW3H 1K8IA 4LCWD 1DBMH 3SDYL 1YJDL 5AB9A 5HJBA 4ENED 3SGDH 1HL9A 1JRHL 1SNRA 4R26H 2Z55A 3I3EA 1WA2X 3B9AA 3GI8L 3GTNA 4LCCB 4OB5L 5HGAB 3A4FA 2EVGA 5DEGA 1N4XH 3MJ6A 3TYFA 4U1LB 2QKIC 1QLEL 3MUZ1 5AL0A 1KG0B 1TQBC 5LBGA 3S34L 4HUVA 1K3IA 3QCVL 4JR9L 5IJDC 3UAJA 5T1KB 2UZYB 3DOHA 4OT1L 2CWRA 2C9AA 4PWKA 4WTZA 5ES4B 5A7EA 3CFKA 4U1MA 2XPZA 1O9ZA 3AADB 4X80L 5GGRB 3TT3H 3TONA 1HCVA 1OAKL 3CFQA 2XY1A 3V0WL 2E3VA 1X5GA 1XT5A 2VC2B 4LEXL 3NT0A 1JL8A 1RJYB 1AGBB 2XOTA 4Z76A 1P0SE 2NY2D 4ZOBA 1AZZC 1EDYA 5L0QB 2CK0H 2UYLB 2VRKA 3WLBA 3FUMA 1T0NB 3HNVH 4Z78B 1ET7A 1RK0B 3CHRA 1NGQH 4HPOL 1AR1C 1GAFH 3AQDA 3REVA 1INEH 4ALAC 1X7QA 1F41A 1SYSA 5D7KD 3O4LE 1R1CA 2XJLA 4P46B 3RIAK 3IJHA 4L8SA 1B4LA 5DK2A 1WBXB 3OB0K 3FCGA 4G6FB 4X2UA 5CILL 2X6CA 2FWSA 3KXFD 2WGNB 4AVKA 4PRDB 3ROOB 2ZUQC 4G5AA 1CVRA 4QT5A 1U30A 3AXLB 4DGYH 3F58H 3VFUA 5HHOD 4NPKA 4MNGE 1BF2A 5DRXA 1XAUA 1E4KA 1SM3H 2BY2A 3H55A 3JTBA 5IQNA 5B39G 3SIKA 4F7PB 2IANA 4ECNA 5C9JB 1VEPA 2CBMA 2UZPA 2R4SH 3ECVA 3KPRE 4WTQA 4U1IB 1ZVYA 2G5BB 3C5ZA 2JKTM 4NAMA 3LSOB 4G1MA 4OCSL 2XIIA 1VEMA 4HEPG 1K2DA 2QBWA 2DQEH 5JHLH 3THMH 1FNEA 1BVZA 2Y04A 4IOFC 2DKUA 3GM8A 1XIWB 4OGAC 4FQQB 4RGMC 1SQMA 2R8SH 1AXSB 4LDCA 4FLQA 1NEZA 3DYPA 4EE2A 2C1OB