4GP4B

Structure of recombinant cytochrome ba3 oxidase mutant y133f from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Ligand Access to the Active Site in Thermus thermophilusba(3) and Bovine Heart aa(3) Cytochrome Oxidases.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4gp4B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4gp4B02
2G87A 1AANA 5ETZA 5F7BA 5E9NA 2DY2A 1ZDSA 1PLBA 2YAFA 1E5ZA 2TSBA 4G71B 1CURA 2X87A 3QBLA 1IBYA 4Q89A 1SDDA 1MZZA 5B35A 4G70B 1GS8A 3NYAA 3UTVA 1BRDA 4GBRA 2HZHA 2I85A 2ZXWB 3SBPA 1P8IA 1BXVA 1F4ZA 2OCCB 2H47C 3N2JA 3CAPA 5ITEA 3MBWB 1A4CA 2YAOA 2Y1AA 1PCSA 4YSOA 5AX0A 2WO3B 3QJRB 1NPNA 1QM8A 5B6YA 1IUZA 2N0MA 2YAMA 1FA4A 3SBQA 1TEFA 2H3XC 2FT6A 3PQRA 3AYNA 4A2FA 1V55B 1BRRA 5B2NA 3FPXA 5LDUA 3PWHA 2IDFA 4BK5C 4G72B 4MD2A 1ASPA 3HB3B 1NDTA 1W6LA 2UXGA 4GYCA 4DKLA 3OAXA 4KOCA 1NIDA 1AZBA 1MG3C 4MFHA 3TBBA 4WKXA 3IBOA 1QKOA 4GP5B 1A4AA 3ABLB 3FSWA 2VM4A 4L6RA 1AZCA 4JKNA 1S54A 2I35A 2ZIYA 2FNWA 1JZHA 2IWEA 1JZJA 1N70A 2EILB 4A2EA 4AMIA 4LDOA 1J9TA 1KCBA 5AWZA 5H2KA 1MG2C 1SHWA 4HAKA 4W1TA 4W9ZA 3KJ6A 4GPOA 5TGZA 4IARA 3REYA 1DZ0A 3UAAA 5J7AA 3L45A 3UG9A 3ABMB 2VMJA 2B3IA 2RH1A 4KO9A 4KNTA 2YCXA 2AANA 3X1EA 2JAFA 2Y00A 1AS7A 1R2NA 1SF3A 4DP5X 1QLEB 5D4IA 3FYIB 1IW9A 3NP3A 2PP8A 2HRGA 2BW4A 2Y01A 1KGBA 3C9LA 2HXAA 1OCCB 1CUOA 4DP9X 2BP8B 5AZDA 2W88A 2R4RA 4MQTA 5TK4A 4EF3A 2AZAA 3IN0A 3IE9A 3G5WA 5B1JA 3S3DB 3ABWA 2BO0A 1CYWA 2PEDA 1NIFA 2IDQA 4DP0X 4BWUA 3MBVA 1HZXA 1SNRA 7PAZA 2BW5A 5DYSA 2R7EA 3KW7A 1KBVA 1E12A 1L9SA 4BWWA 1F88A 1T5KA 4DP2X 1A65A 2Q5BA 5H2NA 3PCYA 1JV6A 4J4QA 2UXVA 4FA7B 3QBIA 3KW8A 2UXTA 3AG3B 5G2AA 1GYCA 3TU6A 1NINA 1ZPUA 2NTWA 2DYSB 1AR1B 1AIZA 3T45A 5I6OA 2HLEB 1BQRA 4PAZA 3QPKA 1VJMA 4YSTA 4BEYA 4AMJA 2YQBA 2ZONA 1PZAA 4A4MA 4BEZA 1PLCA 1ZDQA 3FS9A 2KSAA 1AZUA 3FU7A 3PBLA 1H68A 3QBGA 3VVKA 1H2SA 4K5YA 1A3ZA 1AS8A 1M0MA 1KG9A 1M0KA 4FAAB 5B6WA 3ABKB 4ENZA 1QHJA 3EH5B 4KNSA 1GUEA 3EH3B 1E65A 1NIEA 5AZUA 3X1NA 2QPEB 3WQJA 1AAJA 1ILUA 4HZ1A 3AW5A 4E9XA 4IAQA 3MX0B 4JR8A 4E9QA 1JXFA 5I5MA 5G28A 3CDZA 1L9HA 5BR2A 2BZ7A 2PCFA 3QJVB 3HAQA 1KGYE 2CUAA 1F56A 1KCWA 1NWOA 2RACA 3OE6A 1PAZA 3GXUB 3V2YA 1X0I1 2H5UA 3WKQA 1OE3A 4GP8B 3PPSA 4GY4A 2GC4C 3FSVA 1M56B 1X9UA 3BVDB 1KBWA 1GY1A 1JVOA 4RH4A 3UONA 1NZRA 2P80D 2DYRB 3OE8A 1JV7A 3OE9A 1NTDA 2A3TA 3NJFA 4PXKA 1ADWA 2EIJB 3T6WA 3HEIB 5H2MA 4E9SA 1VLXA 2LNLA 5B1BB 5B1AB 2EIMB 2CBPA 4DP7X 1BAWA 2Y69B 1S51A 2UXFA 3AZUA 5FC9A 1R84A 4BXVA 2FTAA 1YLBB 1RKRA 1OCRB 3NT0A 1UCQA 1OCOB 1GY2A 2WJKA 2AT9A 2Z73A 2WO2B 3ABGA 2GIMA 3CVDA 3OMAB 3T9WA 5AFAA 2Y04A 1BXUA 5H2HA 1TEGA 1OV8A 3NS0A 1NIBA 1ZIBA 2XV0A 4BDVA 1HAUA 3V2WA 5JJJA 1MZYA 2AVFA 3X1GA 4X4KA 3PAZA 1AT9A 4XT1A 2KSYA 3QDCA 1KV7A 4WTQA 1GR7A 1JFPA 1JZIA 1ET7A 4DAJA 4BV0A 1W6WA 3FQYA 5H2JA 2PLTA 1C8SA 1GS7A 1XIOA 4F7KA 5I5JA 2BP0A 3EMLA 3N55A 1S8LA 1PZBA 2YARA 3QJUB 4A68A 3ZPQA 3FQ1A 5D4HA 1BYOA 4KLYA 1QHQA 1DYZA 4WW3A 5I26A 4DJHA 1PXRA 2M3GA 1L9QA 3RYMA 5B6XA 2X72A 1KDIA 2I1XA 1IC0A 8PAZA 3FYEB 4HYXA 1C3WA 2EI4A 1OF0A 1U19A 4OV0A 5KKHA 1JZFA 3VG9A 5H2OA 3AG4B 4M4RB 3HANA 4DP8X 1AQ8A 3H4HA 3QBKA 3DKHA 3ERXA 3FU8A 2PP7A 2R4SA 1OOWA 3COCA 4QRYA 2GC7C 5B7FA 2HX8A 4LDEA 1PLAA 3S3BB 4EA3A 3NJLA 4CSZA 3NJJA 2FQEA 3T6XA 5H2PA 2VW7A 2FQDA 3SBRA 2GHZA 3V9CA 3OQRA 1KMEA 5PCYA 2HX9A 1IW6A 3JT2A 3D4SA 5I6NA 1NIAA 2VW4A 4CSPA 1SDDB 2J55A 5G2DA 3WI9A 2XV2A 4HYJA 1GU8A 4TXVB 4MD1A 1TKWA 1AACA 1ASOA 1GSKA 3PAUA 1ID2A 2XWZA 2E86A 2QDWA 4HIPA 1J5CA 3NSBA 4YSEA 3NJMA 1SJMA 1TU2A 3ZDWA 1NPJA 2IDSA 4DPAX 3BQVA 1QKPA 4E9YA 2IDUA 4YSSA 1J5DA 1BRXA 4BVNA 4BUOA 2JAGA 3WIAA 1PY0A 3NP4A 5I6MA 5A44A 1WS7A 2YAQA 1AS6A 4JKVA 5FJGA 2BZCA 4NAJA 3EH4B 5D4JA 2FT7A 1SFDA 1NICA 2BHFA 1V54B 2PPAA 2W8CA 4YSRA 3QQXA 1KG8A 3T6ZA 3T71A 3WG7B 4G7RB 2XV3A 4E9WA 4AX3A 1TN5A 3ZX1A 3RFMA 4DP4X 1IKOP 1BEXA 5A8EA 3QJQB 1EHKB 2XUWA 3FT0A 2WSDA 1L9RA 3TASA 2I7SA 3AG1B 2I20A 3PAVA 3X3BA 4YSCA 5AHZA 1RZQA 1O0AA 1WA0X 1FBBA 1N68A 2VM3A 1SFHA 5I28A 2F95A 3NSYA 4A2HA 2BWIA 2ZOOA 1UAZA 3UABA 4A2GA 5G54A 1P8UA 3CG8A 4A2DA 3WNIA 2I7OA 1Q5JA 1XB6A 5B1JC 4YSQA 4F2FA 6PCYA 2LLNA 3ZEVA 3FPYA 4QLWA 4G7SB 3OD3A 4UANA 2B08A 4NC3A 5IY5B 3FU9A 1EZLA 3S3CB 4Q8BA 2GSMB 1L9TA 2JFCA 5I6LA 1X9RA 2FQFA 4KO5A 1P8HA 3ASOB 2IWFA 2R7EB 1W8EA 5F8UA 3FSZA 2HX7A 2UX6A 3VW7A 2JKWA 1PNDA 1BM1A 5B6VA 1ET5A 4E9VA 1FFTB 5F7AA 4YSUA 5A7EA 4A66A 4HHGA 5B3SB 1WS8A 5JJNA 4N6HA 2IH9A 2ZFEA 1MDAA 4AI7A 3PDSA 4GYBA 4XTOA 3NSFA 2ZWNA 3HAOA 1OCZB 2OV0A 2XXFA 2YXWA 1B3IA 3NJNA 1URIA 4E9TA 3C75A 4AKQA 3FU7B 3WKPA 1TN0A 4KNFA 3CVCA 5AKRA 3V9EA 4M3HA 4HCFA 1AZRA 1E5YA 1J9SA 1JGJA 1WAEA 4JHVA 4DPCX 4WAVA 4Y9HA 3GYRA 2HRHA 7PCYA 1UATA 1JERA 5A45A 1FBKA 1HAWA 4YSPA 5B6ZA 5G2CA 2QPDB 3HASA 4G7QB 4GRVA 1S52A 1E0PA 3IEAA 4XTLA 1GS6X 4HCGA 2VT4A 2F93A 5TK2A 2OJ1A 3CZUB 3X3CA 3CDZB 1JXGA 2XLLA 1JXDA 3EHBB 1PNCA 1L0MA 2QDVA 4BWTA 1AG0A 2BP8A 1FWXA 4HALA 2CAKA 1JZGA 3OM3B 5C1MA 4KO6A 2J57A 5I5IA 4QIDA 2KS9A 2IH8A 1IBZA 1ET8A 2PPDA 2CALA 2XVBA 2XX0A 4KO7A 3NJKA 4AKPA 2IAAC 4YSAA 2NTUA 5PAZA 4JQ6A 4L0PB 5I6KA 2Z55A 3DDLA 3NJGA 5ITCA 1XMEB 2BRDA 2XYBA 4N4YB 1HFUA 2DWTA 2CJ3A 2GB2A 3PXLA 2UX7A 3QAKA 1S8JA 5B7MA 4N4WA 4GXFA 3UTYA 2YDVA 4DPBX 4NB7A 4MBSA 5B0WA 3NSCA 4NERA 2IWKA 3NYKA 3UADA 2PP9A 3HARA 2MRYA 1AG6A 3PLYA 5DHHA 1E30A 2VSMB 4QI1A 5B34A 3OMIB 2DV6A 4K9JA 4BWBA 3S8GB 2AFNA 5ANHA 2P80A 3X1FA 4BDVB 3AY2A 3IN2A 1X0K1 1MGYA 2I21A 3AM6A 3NJHA 3UAEA 1XJIA 3UZCA 1CWQA 3NY9A 1ZIAA 2AZUA 3DTUB 5EN0A 2YDOA 3P0GA 4HWLA 4KNUA 1JVLA 1BQKA 1RCYA 1KDJA 1SF5A 3H56A 4PXFA 3NSDA 2JXMA 3UGEA 2GI0A 2XXGA 3SQRA 5I6PA 3HAPA 3VHZA 4UHRA 4PCYA 2YCWA 1CC3A 3U25A 2BP0B 2YAPA 3TBCA 3GDCA 3UTXA 3QJTB 2DWSA 2Y03A 4P5RA 3AG2B 4UAHA 1C8RA 3H4FA 1BQ5A 4YVUA 1AZNA 3UZAA 5LWEA 2TSAA 3DIVA 3ZBMA 1OE1A 4FPDA 2NRDA 4UF7C 4YL4A 2YCYA 2PPEA 4L35A 4X32A 3VI0A 2VW6A 4P5SA 3X2QB 9PCYA 5JJEA 1J9RA 2J56A 2MTAA 2XU9A 3WNJA 2J4YA 1R1CA 4AKOA 4TL3A 1CYXA 1M9WA 3ODUA 4X1HA 2EINB 2KSBA 4JHUA 2VSKB 3ZIYA 4DP1X 1V10A 3FQ2A 3AYMA 1M0LA 4FBZA 4AZUA 1AP9A 2PPFA 1XB3A 4F2EA 1ASQA 3NY8A 1BXAA 2IDTA 5EHFA 1PXSA 3CVBA 2ZZLA 1ILSA 2YAEA 2PPCA 1XB8A 2HPYA 1QNIA 2Y02A 2BWDA 1KYAA 1A4BA 1NWPA 5B1KA 1LN6A 1S53A 1AOZA 1JOIA 2VN3A 4XXJA 3OMNB 4HHWA 3T6VA 4HCIA 1IXFA 2J5WA 2YXVA 3D12B 3FSAA 2FJSA 5BR5A 5G36A 2GBAA 1X0SA 2L6XA 3A7KA 4X31A 1A8ZA 2FT8A 5AHYA 1L9PA 1WA2X 1BYPA 1F50A 2WJLA 3ZPRA 3EF4A 3X1BA 2XX1A 1OE2A 1RZPA 5H2LA 4YSDA 4A67A 4EIYA 2QT6A 1PMYA 2PCYA 3QAPA 4GP4B 5DHGA 4QKTA 1WA1X 1I53A 4BXSV 1J9QA 4IB4A 5B7EA 3C9MA 5AX1A 3VGAA 1JZEA 1SHXA 2EIKB 2FWLB 5H2IA 2Q9OA 3ASNB 3JTBA 4ZK8A 2CCWA 3CODA 1GW0A 2YAHA 3UTWA 3SN6R 2YCZA 4EJ4A 2FQGA 1Q5IA 1PY6A 3QJSB 3S8FB 3PXOA 4E9RA 4XTNA 4MQSA 6PAZA 2X88A 1PZCA 3DQBA 1ZV2A 3TA4D 5G53A 3OE0A 4KOBA 3NJIA 1GZMA 3UACA 4DP6X 4XT3A 1VGOA 4UG2A 1DZEA 4YVNA 4N8UA 1PF3A 1L9OA 3RZEA 1M57B 1ETJA 4LDLA 1E67A
chains in the Genus database with same CATH superfamily
4YDIL 5D1XA 4QMEA 1IGMH 1CI3M 3SO3C 3VSVA 4AZ8A 1I7TB 4X7EC 4UB0H 3RDJA 5HHQB 1OP5H 4M43L 2YAFA 2VN4A 4I3RL 2Q8AL 3ZTEA 3PIQA 1NGYB 5FUOL 5D70H 3U46B 2CM5A 1UGKA 1CICA 2VLKA 3L3JA 4YPGB 4LCWA 2AJZA 3PGFH 4DO6A 4TTDC 3CAPA 4JFDA 1R5WB 4PB0L 5IB4A 4HVBA 2ADJB 3P77B 4UM9B 3FJTA 1GJUA 2CKBB 2E56A 1IVLA 3OPUA 3NSXA 4K3GA 1CLYH 3LQAH 3ZHDA 1OTTD 3J27A 3M8OL 5GRJH 3IGKA 2W9EH 4JZOB 1H3VA 3LJ3A 4X9GA 3BPCB 3F62A 1HWGB 3EYUH 4K5NA 1N5AA 3UTPD 3G08A 4AW4A 1DJYA 1IM9D 4UZSA 4UBDC 3Q2NA 3TBBA 4WKXA 3CQPA 3O4LB 5TF1H 5AVXB 2XVLA 4L6RA 1YHPA 3VD7A 1T2JA 3NPSC 3H42H 1S9YB 1U8PB 4CDHA 4IBVA 5E4IA 3RJOA 1LQSR 4HC1H 3LDBB 4ZAKB 5H2KA 2I32A 4N2CA 2DBJA 5GS1A 1ZHNA 3DUSA 3DJSA 4JL1A 4Y16C 5JORA 1JK9A 1VFAB 2MQ3A 4L05A 4JHWH 2JAFA 4M48L 5FKPA 1A22B 2PP8A 3RVXD 2ZCKL 5DRZA 4ADGA 1XCXA 3P4OB 5CGMA 5J1SC 4FP8L 5DJ0B 1KLUB 4NHUB 5AZ2L 3VWKA 4PS4H 4RX4D 5EZLA 3ABWA 4NQXB 4YLQT 2OJZL 2O30A 2I60H 1XDTT 5DUMH 3PL6C 5F8RC 4NQCB 3H9SD 4IJ3C 1XCQB 4NQSB 5BZWB 4PGCB 4NN6C 2EQDA 2A6KB 4X7SL 5CP7A 2K4AA 4OZIF 3TT3L 1MI5B 3VW3H 4LLVA 1GYCA 2K4WA 1NINA 5ANME 1BBJA 2EVJA 2NY4C 4ZMXA 2Y6SD 2OXHB 3RAJH 3V7MA 4URKA 1LLAA 1SY6H 3NK4A 2X6UA 1UA7A 2YQBA 3BQUA 4KKCC 4PU2A 4H26B 5DZNA 4BEZA 1ZDQA 5EU4B 2KSAA 2K45A 3UC2A 2NUPA 4ZFFB 4DN4L 1HL9A 2G9HA 5HHMB 1NGZB 1FLTX 2UWEB 3W11C 1QX1A 5B6WA 1I85A 3L3IA 4HGMA 4MCYB 4MAYC 5KSAC 2BS9A 5HDWA 3QAZB 3CFBB 3LN5B 2FEEL 3AW5A 4AM0B 1B2WH 3ABZA 2EZ0D 5AZEH 5TD4A 3FCGA 3HG2A 4LCCA 4F57L 4JDZA 3HNSH 5IVZB 4DVRH 3VFOB 2WP3O 4AUYA 4H1LH 5FGBA 1NWOA 1UWGL 2RACA 4R4FL 2CRMA 2B39A 4HG4K 4HEPA 4HQQL 4L1SA 4NNYB 4DIXA 3MV7D 3IDGB 5K9KB 2IQAB 3BZ4A 5IEKA 1CDCA 1S7UB 2Q0ZX 3DGGB 2MHAB 1KC5L 3QRLA 3V6OA 3AWGA 4K7FA 4WHCA 2EIJB 1D6EB 4GSXA 2Z8VC 2QZ5A 1ZWIA 5C3LD 2P48B 5EPMB 2DIJA 3G04A 2FYVA 1S51A 1NGPL 2UXFA 3AZUA 2WO4A 4PJBF 3QUKB 1YLBB 2ZOWA 3C60A 5IESH 2AT9A 5AFAA 2NTFB 1UACH 3T9WA 4X99A 2VQ1B 2WLIB 4NQEA 4Y1AB 1ACYH 4M7ZC 4P8QA 5I8EB 1DVFB 3FO1A 4BDVA 5D72H 3ESOA 4P06A 1S6NA 3T09A 2CBOA 3N1FC 3V2WA 3CHXA 5F1NB 3X1GA 4R84A 4XI5C 3EDFA 1WD9A 2VLME 1E5UI 3TX4A 4FG6D 4J3WA 3CFEB 2NY2B 3F7VB 2QQQA 4NENB 2IFGA 4G42B 3GZKA 4KI5F 1OSZA 4JDTL 2VXTL 3CXHJ 4I18A 1NGQL 1A9EB 1QHQA 2WN3A 3NCEB 4NBYB 4OIAA 1RZ7H 2X10A 2QHRL 1ZLUK 4HJUA 1UZGA 3K6DA 4QXTA 4QRRD 1MIMH 5F71A 1F3RB 3HHRB 4I7ZC 1IEBA 5HGBA 1M2OA 4ZMNA 3TCLA 3R7RA 4UI2A 2D73A 4U6HB 4DP8X 4XCYA 4U2YA 3QBKA 2Y0SA 4H0IA 3FT9A 4HEPG 2IGTA 1ZLSL 3VXMD 3DV4A 3NPSB 1COBA 2R83A 1P5VB 5F0MB 3VXUA 4YDLC 4U1HA 1C8PA 4Q2ZA 2FQDA 3ROOA 5ITBL 3IU3A 3OQRA 3U9PL 3ETTA 2PR4H 2VDQB 4EUPH 3DYMA 3I02B 1DQTA 1NIAA 2APWA 2D31A 3BPLB 4JQIL 2J55A 1KELH 3WI9A 5IOPB 4P5TC 1A4KA 5IF0B 4FDWA 3BUYB 1TKWA 4D8PB 2IIJA 4PY7B 4U1NA 1SXNA 1K4CB 1A64A 1LEGB 3EG9B 3JV4A 3FH5A 3ETBF 3GLZA 3VFWA 4PJDB 4QWWD 4G1EA 4BZ1A 2IMNA 5I71C 4UQ3A 2WB1A 4F2MA 4IJ3B 4P4KA 2X4PB 1J5DA 5AVUB 4NN6B 5ICYA 3KPLA 4JW3A 4WWPA 5LUMA 1J0YA 5KTEL 4KBPA 1NGXB 2V9TA 2ZOLB 1KIUB 1HE8A 2BZCA 3WTUA 3BKJH 1W72B 4YSRA 3ZU8A 3TESA 1KG8A 5LBSH 2V3DA 3V55A 5IB2B 2Y22A 4YHML 5BOJA 3FT0A 3H0TA 1ZTXH 1DBKL 7FABL 5C3TA 1JWSA 5AHZA 4FG0A 1OGSA 4H44C 2A9ML 1KYOJ 1N68A 4PP2B 3NA4A 2VJ8A 4BZ2L 5DI8B 1W8NA 1I8IB 2BWIA 1DP0A 2DI7A 2I7OA 1A4JA 4HWZA 4NKOA 2Z9TA 1MH5A 2ZXBA 3H8NA 4LIQE 4WSKA 3OD3A 4L4TE 4PJXB 2OTUA 2TRHA 4K73A 3SKJL 4G6ML 2FQFA 3DXAB 1AHMA 1O7DC 3IETA 2QQNH 4FYSA 4K23H 4O2FA 2UX6A 4NM8L 2F7QA 5G55A 5JW4R 4HWBL 2QGDA 2VM9A 4ACTA 5B39B 1QSFD 2P7TA 2B1OA 4KFMA 2V9UA 1NCCL 3DDGA 3U83A 3QSKB 1JSYA 3KPMB 4GYBA 4FQJL 4R5TA 4J39A 4E9TA 5BJTA 1X5LA 4PJ5D 2WCGA 3FU7B 2DICA 5EZJA 1JGLL 1E90A 1H5BC 1E5YA 3SKMA 1ZHLB 3VFUB 4M7ZB 3WO4C 1BFSA 5DYFA 1Z7JA 1QZNA 2CGZA 15C8H 2QQKL 4IRJD 4OZGA 5CZRA 3AGWA 3QGVA 3ZHLA 2FYYB 1IAMA 2F93A 3EHBC 3JTTA 1KTKE 2BX5A 5M95B 5FO7B 1Z0MA 4NJ9H 5L9DL 4LHUA 3UAJA 1Q94A 5DMKB 3I3BA 4QHUB 2YWYA 2QTVA 2YD0A 5I1EH 4J27A 3NJKA 4YSAA 4G9DB 3O4OC 1Z0NA 2QR0A 5DFTA 4LASH 3GEWB 1I7RA 1J5HA 2DPKA 5GZOC 2F7RA 2EXWC 3ZOAA 1C7SA 1E9QB 4C4KT 2G5RA 4F3FA 3PXLA 1BVLB 3N40P 4K07A 1MRCH 4YX2L 4GXFA 5CLWA 3NEOA 2JCCA 1EVUA 1NL0L 3IXAA 5LO7A 2DD8H 4IHBA 3EJZC 4DN3L 2J6EH 3KH3A 4KJQD 1T22A 4J4PA 4ODTL 1JPEA 4CVXA 5J13C 1U8QB 4OJFL 1LEIB 1SBSH 3QUZA 4M1DL 3IN2A 2ENQA 5I16A 4B3EA 4AYID 3T3PB 4NDMB 1ZIAA 2AZUA 4Y2NA 4ZUWA 2R4SH 3MXWL 4OGZA 1B90A 1ZMYA 1Z5LA 3OWRA 1JVLA 3P9MB 4OZ4B 3RG1C 2AAAA 4UINL 1IZJA 1WC7B 3GTVA 4Q56A 2WAQA 2F9BT 4S1QH 4N6QA 4PJIF 3MLSH 5E6IB 4MVBD 4NPYA 4O02A 3QJTB 5I71B 1ZE3C 2YQ3A 3AG2B 1C8RA 3MN8A 3ZXAC 3RI5K 1DVZA 2VZVA 5DRNB 4AITA 3GMLA 4HKBB 4UTBH 2WGXA 1QSEE 2Y24A 1KB9J 2HJFB 5EA0H 5IIEA 2XZCH 2C34A 2H1XA 1EQWA 3V7AG 5DHEA 2YMTA 1HHGA 4LHUG 4Z3JA 4ATWA 3OAUL 2X9XA 4U1JA 1KGUA 4FBZA 1AP9A 3TBYA 3C2SA 2R9HC 4X8JB 4LDOB 4O5LL 1HHJA 2Y5QA 2R1WA 1ILSA 3W9EB 1RZKL 3BPNC 1A4BA 3VYOA 4JLRB 3L54A 3AC0A 3SYQA 3MLUH 4LLWA 2VN3A 4LF3B 4LSSL 1YN6B 3FW6A 3SJVA 4UT6L 1IXFA 2Y06L 3BP5B 3MV8B 4WFGD 4KUZL 1EDQA 5EFIB 2EDNA 2FE0A 2IPTH 4U4BA 1EAJA 5IB3A 3RA7H 1IIIA 1MJ8L 2ZWSA 4FCAA 1F50A 1RQ5A 4PBXA 5MEOA 3QC5X 1K2DA 1UUSA 2C1OA 2X4QA 4PJHB 3LS4L 3M86A 3W37A 3BI9X 5EO1A 4KJYB 4S1RH 3VWJB 4A63A 4KGLA 3VRLE 4JRYA 4NO5A 4NQDA 4ZDHB 3A0OA 1ZT1B 4MD4A 2GT9A 4HT1L 3S8FB 1CXIA 2IH1A 1MEXH 2FWOA 3LXAA 4ZMWA 4KY1L 1QKZL 3OXRA 4OQ1A 1NCBL 4XAKE 5I1AB 3CIQA 4KOBA 3OKYA 4QHMA 4B9JA 1E6JL 2O6EA 2YZ1A 4M7KL 5DVKA 3MSPA 4P59L 4N8UA 1Q9LA 3SYAA 2VC2B 4NO0D 5CLZA 4P2OD 4KZCA 1ZTXE 4YMPA 2AJYH 5F0LB 2EH8L 2YPLE 4DW2L 2YPKA 3KVPA 4K8RH 3OHXA 5DVPA 4PRNB 2QLYA 1P7KB 4KMQA 2DWEA 3G6JF 1U91B 3SBPA 3E1ZA 5IWLA 1D2PA 3QG7H 4U3SA 1H3TA 1QHPA 1F4ZA 2CIKB 1VCBC 4XPGL 3THMH 1UZ8B 3OGCB 3CVHA 3DSFL 4JPKL 3P73B 1PCSA 4P0DA 4U6YB 5J6GA 4AUJA 2F1AA 2GITB 1NPNA 3CPLA 5IMLA 5K69A 2VLMD 2N0MA 5E6RB 4I48A 4ODWB 1N6QH 5C0AB 2WUCH 1IBDA 1MCNA 1MFMA 4Z0BH 1BRRA 3UC0H 1IC1A 4HS8H 1T3FA 1BFVL 1G7PB 4FTDA 4RWHA 4PHZA 4QTIH 1ZVSB 1F45A 4RSYA 2DYPD 4IDLA 2ZWKA 3N9GL 4B5ZA 1AKJA 4GT7A 1E4WL 3RL1A 4QRPA 2PYFA 2EDRA 4C54A 3WIFB 3ABLB 2N1TE 4N0FB 4FQLH 5KYXB 1M4KA 2F53E 1GIGH 1JP5A 3B1TA 3LPWA 2XZAH 5J13B 1N70A 3EJCA 4A2EA 2VDNB 1MFUA 5JR1H 2D7TL 3MROA 3RL2B 2RQ8A 5TGZA 4S1SH 2W38A 1J8RA 2QTEA 4LEXL 4YN3A 4KX9A 3NDYE 4ELMB 4G2AA 1N6VA 1KCLA 3K6SB 1UASA 3DTXB 4BFGA 3H1ZA 3VE0B 4GXVL 3CH1A 4C4BA 4XWOC 5L2KA 2HRPH 1M7UA 5BQ7B 2DWDB 4WFEE 1AH1A 3QNYB 2CK2A 4PYGA 3UG3A 1U93B 1VFBB 1HZXA 1P5UA 4WI5A 2AEIT 4RA3A 5DYSA 2J88H 1F4AA 3KW7A 1SMDA 3A4DA 2D7NA 5AVSB 5T33H 5DJCA 4DCQB 3PCYA 4LVNB 1I31A 2UXTA 4KTYA 5DEJA 3TNMA 1KEGL 2OSLB 3HBZA 3BT2L 4PIRF 3T45A 5JHDE 3WN5A 1B6UA 3KPQA 4BEYA 2OL3B 2XYCA 2PUQT 3FFDA 1DCLA 2DTMH 4OY9A 4QJ4B 1E3ZA 4YIQA 4JM2A 1ROCA 3SY0A 3PDOB 4RSVA 1HNYA 1WZMA 1MAML 3EH5B 4QYOB 4G6AD 3DX3A 4WY7L 1M71B 3MXVL 2BINA 3VAEA 1OW0C 3II2A 4ZOCA 1OSPL 4AVIA 4B7LA 2X44D 4IAQA 2XIDA 2HVKB 4IBTA 5I5MA 2F58L 1FGNL 1CLZL 2CDGA 1BD2A 5AAMA 1RHHA 4GKSB 3ZMNA 3QUML 1XCTA 2GTZB 4ZTOL 1WICA 2VUYA 2ENPA 1DBJL 5DJZA 3ZTDC 3FB8B 2UY6A 4KKAC 4NNXA 3CZJA 3UERA 4HK0B 4XP1L 5SWZB 1J0IA 2BIMA 1NC2A 4KK8D 3EIFA 4IGBA 3ZHKA 4L4TD 4IU3B 1ANUA 3ARPA 3PGCB 2HT2C 4YEEA 3LHAA 4OLVL 2Z91B 3K2UH 4C8XA 3SGDI 1ACCA 1R84A 4BFIA 4NUQA 3MNVB 2X3BA 4RAUB 3SE9H 5GRUH 4YFLF 4JE4B 3EYSL 4B9GA 3QEGH 4PTTB 1IAOB 1NIBA 4QRTA 3Q6GL 1LP9E 1M05A 4RISL 3KPSE 4BUGA 2ITDB 1SOQA 3HMXL 4V1DE 4TRPL 2NNRA 5FXCH 5L4FA 4M5ZL 1WHOA 5H2JA 2E74C 1A7QH 1HNGA 3BKMH 1XQ4A 4OI8A 5E00B 2G4EA 3VUAA 1PD0A 1UEYA 2NX5D 3PABB 5I17B 3QRFM 1CB4A 5CIPB 4WENB 5IQLA 1LO2L 1D5MA 4Q9RH 3T6QC 1F18A 3F3HA 4MXQD 2OR9L 3ARDA 3L3GA 5ICXA 1CR9H 1IC0A 4LKCA 3IFNL 5CSGA 3UZQB 5KKHA 3H2PA 5IFAL 2O5XL 3DKHA 1TQVA 1YQVL 2KLSA 4MS6A 3RIFF 4UQAA 4HXBH 4LP4A 3RBGA 5EORL 3FTGB 3Q6FB 3VGBA 4M93C 1BLNA 4UZGA 4X6CF 2OKMA 4YHYB 4K9EC 3GF8A 4KTDH 3JT2A 3C6LD 2WVUA 4L8SC 1SDDB 2H32A 1G6RH 3GZQA 1UXSA 2NY6C 4JCWA 3QWNA 1TTCA 1MLCB 3OKKB 1CTOA 4X6DE 5I5IA 3FO2B 4HSAC 5EOTB 2CK0H 5FM4A 2VWEC 5I66B 5DLMH 4HOWA 1ONQB 3WNMA 1KCKA 4AGOA 4BJLA 1ZXQA 5HHPB 1FBIH 3PREA 2E86A 4PJEB 5LCVH 5CFHA 1NBVL 4F7EB 2OLDA 3NJMA 4I89A 4ANWA 2FSEB 1QMUA 5DJ8B 4NN7B 1YEHL 3SCMA 4LQFL 4R83A 3TBSA 4O02H 3VRIB 2BSTB 4Q6KA 4CMMB 3ME0B 5A44A 2L04A 4FXKC 3QEQE 3ECBA 3INUH 5DC4B 4DZ8B 2NR6D 5CUSL 4K3JH 3U7WL 2BNRE 5J0BA 2P26A 4RFNC 4JRXD 5D1QC 2YGVA 4M8QB 4CRPA 3OJDA 1XF2A 1EXHA 1QSED 3WG7B 1DQVA 4I77L 4IIQA 1H6UA 3T65B 4GW1B 2D7OA 5DTFA 3ZL4H 2CWRA 2OX5B 2RALA 4EBQH 2OMNA 2X0VA 1CFVH 4Z7QB 2EYRB 3TASA 2AV1A 4J28A 4GG6B 3ELAT 5EZIH 3PAVA 4LPUA 1O0AA 3VFMA 3US9A 4WUKH 4HWNA 3C08H 2J2ZA 2ZNWA 3W9DB 4OLEA 1WWBX 3GKWH 3MBEC 1FO0B 1CF1A 1SJHB 4HCRH 5I1LA 2UY7A 2JMRA 2YQ2A 2WQAA 3KGUA 3MJ8B 5IHBA 2EUZA 1E28B 4G7SB 3OQ3B 4PJDF 2AF2A 3FU9A 4M8VA 3VI3E 1X5XA 4NO3A 2VO8A 1VADA 2C9QA 4AQEA 1EZVY 4KXZI 5DHDA 3QULB 3MRIA 2ZYHA 2ED9A 2VLJA 1TJHH 2ZX6A 3IAPA 4JEGB 1NCDH 2A38A 4XVUD 1IFGA 4Y4FD 1G4RA 3UBXG 2BDNH 4LESA 1GC1L 2FHBA 3BH9B 4BKLA 4DGIL 3F58L 4LFHD 3L4ZA 1E6OH 2EDHA 2XBZA 2ZWNA 4JG1H 1BVNT 2H9GA 3KWTA 5I0VA 1X4XA 3IRCA 3QPXL 1TN0A 4HHAB 5FO8B 2QPUA 2YBRB 4CU6A 2WYZA 1NEZB 1R3LA 1Z5HA 4ZXBB 3WGVB 1FIGL 1YNKH 2A77L 3ARQA 1EK3A 1KCUL 4XAKD 4M61B 4CKQA 2FHFA 2X1PA 4Z7VF 3DSNB 4U6VH 1FFOA 4TUKH 5C6TH 3U9UA 4HCGA 4OCWH 3WJJC 3X3CA 4WW2C 2K8MA 1GYWA 1BW8A 3HRZA 5ANMA 1M6OA 3RZCB 3TM6A 1B4JH 1NLBH 3N0AA 2YFNA 2YPLD 2AJ3A 1GGUA 4PJXF 1T5XA 4AV4A 4WW1B 3TZVA 4ELKA 1SM3L 4NQVA 1CWVA 3OM3B 1A14L 2BVYA 2XX0A 3CC5B 3U6XS 2B15A 2MCMA 1URLA 4ODUB 4OCNC 1E7UA 3VTMA 5EOCL 3SE4A 1QFWH 2WC7A 3BSZL 3V52L 5E1HB 5D7KD 1XMEB 5GGVL 5E9DB 3QUXA 1MQKH 4B9ZA 2W65A 5FYKH 2VRQA 4EIBA 1JPFA 2Y36L 1YY8B 2UX7A 3MRHB 1S8JA 2F0CA 3MOAL 3MOBL 4NRYA 3RVWD 5FYJE 4YHKH 5D7LE 1G7JB 2LAGB 3L9BA 3E7JA 5LVEA 1AFVL 3UXFA 5KJRH 2BSED 5DK0A 3NYKA 1RIVH 4M93B 3LKPB 4JJ5A 3KAAA 3PLYA 1KPUA 1BOGA 3VXPB 1BZQK 3DC0A 2DV6A 5J12B 3KNBB 5I30L 5ANHA 5K33A 2ARWA 4Y2DB 1CXFA 1XIWB 5AKVA 2WVVB 4UT7L 4WV1C 4X4ME 1U3HA 3APDA 1SXSA 4IOSA 2BVPA 2VCOA 2FJGA 4R8WH 1CG9B 1A6UH 2F53D 4P3WA 4XZUB 4HPYL 2I9TB 2EVGA 4P2OA 3OX8B 3KGSA 2BLFA 5JHLL 2WV3A 3DVNA 1GMIA 4QPEA 1WAAE 1NLDL 2DLFL 1QBML 2GI0A 3GGWB 4BFBD 4ZTPL 5L6YH 3VHZA 3ARBD 1YECH 3B9KA 3RTQA 4PWFA 4W6YB 5I82A 4JO5A 3B7SA 4ENED 3LZPA 1AVAA 2H26A 2IADA 5B3JE 4XMVA 3KE0A 1RK7A 3LZRA 4RRPA 2VW6A 1QZ1A 2WLYA 5HGAB 3LQZB 5AEAA 2BJMH 4NKDA 5GGRA 3VSUA 3L9EA 1R1CA 4WFED 4NZFA 4ZPVB 1MNUL 2NY1D 5D1QB 3UTQB 4HS6B 3W56A 4YWGL 3SDAB 1NUGA 2XACC 3KS0H 2Y1YA 4HJJL 1UA3A 1S5HA 1CF8L 2IDTA 1PX4A 3RWJA 5A43C 4RZKA 1BVKA 4FLOA 1YDPA 4ORGA 1MRFL 1BJ1J 2QVTA 3B2DC 4DK5A 3IJSB 3W38A 8FABB 5JHDD 1A1OB 5A3ID 4JFEA 4J3UA 3T3PF 1CGWA 1RFDH 3CLEH 2OCFD 4PTUB 2JKSA 5BR5A 3OJVC 1IFRA 3OKNB 5CGYD 2GCYB 3QUYD 5K39B 1KIRB 1CGVA 5DWUH 4JY4B 4WI6A 1GL4B 1KJ2B 3NAAL 3D0LB 4ZW3A 1AGFA 4QOKB 2FO1A 1U33A 3HS0A 2F18A 3O8XC 1MJUL 5EUOB 1JHTA 1I53A 3VQ1C 1KB5A 2R2EA 1FYTE 4TUOB 3ZUCA 1PZ2A 2X53A 2QADB 4GAGL 5FECA 2E46A 3QIWB 4GBXB 3AU1A 2P5PA 4QF1A 2VNCA 3MJ9L 4LT7A 1XH2A 2VIRB 3BDXA 3ESMA 4N9GA 1LO5A 3QT2A 2XTLA 3QJSB 1P9MC 1ZV2A 3HVNA 1OOAA 1G7MA 2NW3A 3VQMA 1R3KB 3FO0L 4XT3A 4OGYH 1XBRA 4YVNA 4P99A 2PTVA 4U1KA 3EYVA 1ES0B 1MIEL 5C92A 4AC2A 4JKMA 2G3NA 3D50A 4TLTA 1NAMA 1CJYA 4YDJA 5FW6A 5IMOB 1R0AH 2XKSA 3DA0A 1CVSC 3KPTA 4R7XA 2EUWA 4WW2B 2R0LL 5HVHC 4JO4H 4GSQA 2RCSL 1EDYA 2WXRA 1P8IA 1TNNA 3EJYD 2DLIA 5DQ9B 3ZHFA 4PJHF 3P0VH 4R3SB 3FFCE 4PJ9C 3S35X 2WO3B 3KPSD 4GUQA 4OVVA 2E8YA 2FJHA 2Z35B 4V1DD 3FBQA 3RURA 4WWOA 4N2MA 1I3GH 3IM1A 5KYWA 3GSRB 3L3DB 2IBBA 1D7FA 4NZDA 4G3YL 1SEQH 2LU7A 1J1PL 1CU4H 3WEXB 5FF6A 4P3CH 25C8H 4ZBJA 5C6WH 1KCVL 1T83C 1KGCE 2Z7YA 3CFCL 3VD4A 4PJCE 3CFQA 2VM4A 4MDJB 4TQEH 5KSUA 5T3XL 5EB9A 5DC2A 3Q06A 2OMVB 3WL9A 1FYHB 4WV1B 2LU3A 1VZHA 4JZJA 1LQBC 3VFRB 2WZ5A 4APQD 2CLRA 5I1HL 3ATFA 1MLBB 4KNTA 4LSRL 3X1EA 4JGNA 2WKOA 1LWJA 4XZ4A 3C5ZB 3ZE0F 2JIXD 4UMGA 2HRGA 2K1MA 3ELQA 1WCBA 5DMGD 1D9KB 4K8RD 4BRVA 3IN0A 4GI8A 4PGEB 2X89D 4APXA 4OJCA 4UTAL 1SDAB 5E1AA 4R90H 4Z7NE 2IDQA 5ILTL 3G9AB 4LLDA 5ALBL 4PREB 3B5HA 4AVKA 2UVFA 1F88A 2G30A 2YR3A 5DJ2B 3GFUA 3Q0HA 3ZE0B 5GGTH 2C7UB 1A9VA 1AR1C 1SVZA 4U49A 1N0XL 5FYKE 1N4XH 1S9WB 4IBWA 1HH9A 1DL7L 1I9RL 3ULSA 7TAAA 1C16B 2AEPL 2IJ0C 3ALWA 3F65A 3GD1C 4NP4L 3ULVC 4G6FD 3FUKA 4PEEA 4LNRA 1JHKH 1DLFL 3US1A 3QEQD 1YNTB 3MYZA 4KZDL 2W1NA 2RR3A 2BNRD 1H2SA 1AS8A 1M0MA 5KWYC 1I7UB 1HL8A 4I0PC 2WLMA 5G4MA 1JZ6A 5KSVB 5KEZA 5B8CB 3K4AA 4FI8A 2D4DA 3ALPA 2VDOB 3EF7A 3GM0A 1FAKT 3HG1A 4D8OA 1DQQA 1TU2B 3MODH 4JO3H 4JK0D 1S7XA 4G8IB 1U6AL 3O8XB 5SWSB 4KKQA 3OE6A 5A7BA 2ZJSH 2CUHA 3HMWL 2Q2LA 3WKQA 2NXYB 1KIPB 1A2YA 4MGXA 2WLZA 1P4LB 5DVMA 3QZWA 2H1LM 4RMRA 1T0OA 3TL5A 4F1SA 3UTZA 3MZTA 2A3TA 1OPOA 1WYJA 3IMRA 1A5FL 3K91A 2PO6D 2XKNA 3WUWA 2KZ1B 2HFTA 3CWGA 1KACB 1U2CA 4MA1B 1D5XB 3RWHA 1G1CA 4OT1L 4H8WL 3QARA 5JOEA 3BO8A 4NWTL 1I3VA 4AEEA 1AC6A 4E5XB 3F12A 3AUVA 1CL7I 4QNPF 8CGTA 1K6QL 5EN2B 4GW5A 1A0QL 2QKIC 4LBEB 1JGUL 1FNGB 4EI0A 5HVHB 2ED7A 2A5UA 2Y1ZA 3HCVA 4J3VA 5CAYB 1AT9A 1HOCA 2EXYC 2R29L 4FQHA 5ADOH 1S2EA 3X3FL 4H1LG 4PLNC 2LTQC 4QCIA 4QLRA 4MNQB 4N6RB 1PCXA 1C8SA 3H3PL 2JKTM 4G80B 4FFWC 3BD4A 4XAWH 4JUTA 5CKAA 2NNFA 2KH2B 3W2DL 1UVQA 3F7YB 3GSNB 1AGDA 4RDQF 3JWDH 3U82B 4F7TA 4KVPA 3KLHD 4MQSB 2XWTB 1C3WA 2EI4A 3QFDA 3R8BB 4N8PA 4POZD 1QABA 3G5ZA 2VDLH 3NIDE 5IM7A 2YWZA 3RHWK 2ZUQC 3H4HA 3E80A 1RU9L 4X6FB 5HGDB 1NJ9A 2HX8A 5LBVA 3FBKA 4Y4FA 3RFZA 5H2PA 3QHFH 4M00A 3BZEA 5C0EB 5FYJD 5D7LD 2DMGA 4DVBA 4PJBA 2Y07L 1KENL 3WUWG 5FUZH 3V4PA 4Q9CA 3N41B 4N5UA 3TEYA 3WAJA 4WVRA 3HE6B 5D7IF 3ARYA 4Z7UB 2DQCH 1MFEH 4OAWA 5H2BB 4IMKA 1XMWA 2DTSA 3ARRA 1OGAE 5F0JB 2J44A 3UTSE 4OGQC 3MX0A 4LOUD 1T7WA 4RMVA 1NPJA 5DHXB 1I8KA 3UAFA 2J8OA 1UB6B 2QVIA 2YPLA 4FTVE 4X50A 4HV8B 4MQ7B 5IB1A 2IALB 4DNLA 2DIAA 2GK0B 3NA9L 4M6NH 5F21B 4AXWB 3OXSA 3B7TA 3HAEB 1MHHA 2AGJH 4Y4HB 1QPKA 3WIHA 3RFMA 1IKOP 1BEXA 3QJQB 1C1EH 4EUPG 5JPNA 3X17A 3BAWA 1SN5A 1VFMA 4I0PB 4KK9D 4XMLL 1AXTL 2PYEE 3H7LA 2EACA 4PIBA 2V5RA 4P2QB 4H25A 1GMEA 4XO4A 1WEJL 4ZS7L 3CXDH 4G9FB 4R5XA 1RK1A 1TXKA 2E9IA 4GMSL 2CJUL 3NDZE 2BCMA 3QS3A 4OF0A 3QQDA 4Y5VC 3VFNB 3MLWH 1MF2H 4PJEF 2WLLA 4UV7L 1UWEH 5TTRA 2OJEB 4FRWA 2IV8A 3QWRD 1FVCA 4GH7B 5DUJA 4X2UA 1CGSL 1L9TA 3AS2A 5DGQA 3UPRA 2CIIB 2IWFA 3K4DA 5CZVL 1A1NA 1FAIH 4N2EA 3ZGHA 3LEVL 2Y2TA 3ARBA 3DTDA 4IKNA 4WWKC 5IVXE 2EO9A 2ZKHH 3V0JA 2CNZA 3ARWA 4E9VA 2OMUB 5I6XB 4E0RA 4UZUA 5K9OA 3K7UA 2R0WL 3VRJB 3SE8H 2AQ3A 1IGYB 1TETH 4XXDA 1DQIA 3LXCA 2ESVE 4X7TB 5F70A 4BCZA 2VLLB 3C8KB 3QI9D 3CVCA 1XGYL 1CTNA 1EJOL 4UWQB 4Z7QF 4DO5A 1F4YH 4X5XB 3FQXB 1PX3A 1V8HA 4GMTL 5ESAA 3BESR 3L2LA 4L2YA 1BVNP 4G7QB 2D8KA 5AUMA 3M7OA 3NTCH 2XJKA 1O7DE 1FFPB 4NC1C 1GS6X 3Q8FA 3WTXA 2LTQB 4WEBH 3CZUB 4R5VA 2PCFB 2VR6A 4LOEA 4AG4H 2DQTH 2FIKA 5JHDA 4U1SA 2YBGA 3L9YA 5D55A 4XODA 3WCYA 5TE4H 3VD2A 1P7QA 3M1BB 1NCAH 1KUMA 2KC0A 2ZPKL 4AKPA 2EVHA 1TTBA 1DFXA 4JQ6A 4RBPK 1X5MA 2B1HL 1JPST 3NZHH 4PS7A 3VI4E 1IL1A 5F7EL 2WKGA 2NPLX 3FFCD 3TVMC 3WEOA 2J8UB 1BAFH 4KRNA 1MPAL 2GJ6E 2HFFA 3CBJB 4NWUL 3D0VB 2ZUQB 3P40A 1MW3A 3UTYA 2W0PA 3N85H 4I3SL 3VXSB 4F8NA 4XVJL 4OZFA 4PJ7B 4P23B 2CO4A 4YL9A 3VCLB 1AG6A 5DHHA 5DD5H 5KVDL 2NY3D 2AJXH 2XQYK 2OQJA 1EEQA 2X2YA 1WFOA 5ESQB 2OSYA 4OZHB 4JFQA 4ETQA 4CVWA 4PRBA 3TEWA 2WM0A 4D3CH 4M29A 1U92B 1KGCD 3FTZA 1AMYA 3OAYH 2E7LC 4F15B 4MJHA 1KCSL 1CWQA 5EN0A 4HWLA 1UFUA 4RGMC 2UZIH 4O2CA 1ZHBA 3BH8A 3PQYA 3NSDA 4S0HA 5TDOA 1INEL 2WINA 1GXEA 5I6PA 2NMSA 2SEBA 5DJXB 3PUUA 4JG0H 2QHLA 2R0ZH 3ZDZE 1F4XL 4A7UA 5D9SA 2Y03A 3B6SB 4Z7WE 4CC1A 4RMUA 4KQ0A 3WKYA 4YL4A 3CFKA 2YCYA 3SDCA 3X2QB 3BUTA 2HTKD 4OCYH 3O3DB 4BUQA 2J56A 1LP9A 3MO1A 3ZKND 2IG2L 3AQZA 4OLXL 4YPJA 3ZUNC 4AKOA 4F33B 5I1GH 1CYXA 1M9WA 3IBEA 4X1HA 2VABB 3NVQA 2EINB 3FZUC 4DP1X 1GA2A 1SYVB 1CL7L 4ZNEA 3LZOA 1KT2A 2EDWA 5DRWB 4NZUH 4QRQB 1EANA 4OTXH 3FULA 4WZ9A 1X4YA 1BXAA 2JKNA 2K78A 1YMME 3AFLA 1CE1L 2C26A 3DRQB 3LKRA 4JANB 1PXSA 1MCWM 4LO9A 5EHFA 2JLPA 2VERA 4L48A 1BJ8A 5FYKD 5I18L 1SEBA 2Y02A 1BPVA 3U2IA 4X4XB 4YNYA 5B1KA 5MEPB 3A4FA 4GKNB 5DJDA 4DT2A 5C2BH 3HUJE 4KXCA 2I25N 3V6FA 2X4TA 3KPNB 2XFXB 3K8MA 1PEZA 1QUPA 1DR9A 3H9ZA 4Y5VB 1ODAA 4JS7A 1S8DA 4F93B 1A7PL 5I24A 3X1BA 2YXFA 4EOWL 2IAMD 2R23B 4G7VH 5T1MB 2QT6A 2R1XA 4XVOA 4B27A 4M7LL 1JZ5A 2D0HA 4JPSA 4PN6A 4WUUA 1J9QA 5DZLA 5AX1A 1E9PB 5T1KB 2GFBA 2JIXA 5H2IA 5DJYA 4Y9GA 5KYUA 4L5FL 4KRPC 1TZGH 4JREC 3CUPB 1BZ9B 3LNEA 5KVEH 1I82A 5KYNA 3MRQA 4WO4B 1MFAL 5L8KB 3DO7A 1KGWA 4XTNA 1J1OH 3X3GL 3EXJA 4J2QA 1MREL 1PZCA 4JN1H 5D6CA 2ZAGA 4BSVA 4N8VA 1FDLH 4F7PB 4YDKH 3OE0A 4M4RA 4JPVL 4NN5C 1IGJA 3GB7B 2VYRE 5I9QC 3HRPA 2Q7YA 3JV0A 4GAAA 1AQKL 1TT6A 3T0BA 4ZMTA 2AS5M 3MGTB 1N8ZB 3VMOA 4TL4A 1D7BA 2NNXA 5FB8B 1FFNB 5IROD 1A6WH 2AJSH 4LU5L 3DMMD 5EIVA 2ITCA 1MFCH 4LCYA 3QBLA 2EDXA 5EF3A 1OB1A 4WGVB 5C0BE 3MV9D 4LDCA 5ERWA 3D2UB 3H6JA 1NMBL 4UOQA 3V4VA 2GJZA 3DRTA 1BZOA 3LVTA 5FR3A 4M8UA 2P44B 5EUOF 1NC4D 4TMPA 1IBBA 1KBGL 3R06A 3Q9PA 1SQMA 5EIIA 1IGTB 1IJ9A 4JPQA 1FA4A 3QQ4B 4OBSA 5J9PB 2DQHH 3CFTA 3O3EA 2Z65C 2FT6A 3AYNA 2A4CA 1IC7H 1X6LA 4WCYH 3DX8A 5IQOA 2JE8A 1KY7A 5AVRB 2W0LA 3HFFA 3GRWA 3T0EA 3B2UC 2CUIA 4H8QA 3TJHD 4DWHA 5DFVD 1DQMH 2AK1L 4Y2LA 5HI4C 2ICWJ 5GIRB 1NIDA 1IKFH 4Q6IB 2A9CA 1YEIH 4HGWA 4NQTA 4QXGL 3G5VA 1INDH 2R2CA 2VDRH 3KBPA 2X4RA 4NCC2 3KLKA 4TQ8A 4ZMYA 3VI3A 2JJWA 3QORD 4PUBL 4L8BB 3RWCB 1MG2C 3BE1L 4I4WA 1S5IL 3SBWC 4MJJA 2ZG1A 3LV3B 2JJUA 4MSWA 4IARA 4A39A 1IEAB 1YYLL 3ABMB 4V33A 4WW2F 3OPZL 2RH1A 4HIEB 3ZMRA 2H1PL 4A2MA 2VXVL 2MWCA 4ZYKB 4DKFL 4DP5X 1CICC 3RDTB 4PJ8B 3PS6A 2AP2A 4DTGH 3QIBC 1RUAH 2PTTA 4U3HA 3X12A 5C1MB 4JPIA 4TSCL 5FLVA 1PQZA 5FFOA 2W80C 2DS4A 3CZFA 1F1DA 4YR6B 5CSZA 1U36A 3I75A 1UQSB 1X5KA 3T3ME 2BW5A 1ETB1 1NH6A 2EXTA 1AJ7L 2F5AH 1T5KA 2J3SA 4MJIE 4NKIH 1A65A 5F9OL 4AL8L 1KN2H 4OB5H 5JW4N 2NLJA 3QK0A 1T80A 5HGHA 2J1YA 2OYLA 1EEYA 3HZKA 1BXXA 1QUNB 1CFQA 1A6VL 3HZYA 1BQHA 4IRSD 5DHYA 3OLDA 1FL5B 4FTVD 4ZSOB 3HG4A 4F9LC 2H3NB 3ARTA 3F05A 3UYRH 4O9HL 3LN9A 3ZKMD 1NFAA 3D07A 3IWVA 3O6ML 4FQXD 1JXJA 3WAKA 5I23A 5EU3A 5J4MA 3SGJA 1OGTA 2I69A 2QV4A 3CBRA 1JGEA 2BS71 4GRMA 3L7EB 4BE5A 3EOAB 3NIGF 3X1NA 1PG7H 3NG5A 4JRWA 4XCNA 1MW1A 1GSMA 2AQRA 3FUFA 3ESNA 4WU7B 3CDZA 2A74C 5CD5C 5K1VA 2XXMB 2DQUL 2PYED 3EZJB 2ZP9A 1NGYA 3N04A 2H5UA 1W0WB 5L2JB 3SDDC 5BRZD 1B0RB 1HXYB 4UUJB 4GY4A 4KRPB 3ZY7A 2D2CC 4YDIH 2HJLB 4KKNA 4WI0B 1KJ3H 1U58B 1GC1C 3C5JA 3QEHB 4GRWH 4M43H 2O6FA 5J1TC 1JV7A 4Y4KA 2AEQH 3T6WA 1Q0YL 5DT1H 4PJAB 4FXGA 4JG5A 4OLYH 1WAAA 4N90E 4DP7X 4JZOA 2J43A 5BMFL 1UOLA 2XN9E 2Y69B 4PB0H 3BPCA 4QTHB 3BQUC 3MRMA 2VITB 1YNTF 4NZTH 2VR4A 3V0FA 2WO2B 4HUKB 4MTMA 5IGXL 2O6DA 4FD0A 3O4LA 5C8JA 2DMHA 1I85C 3KR3H 4HUCA 2ESVD 1PAMA 1SLVA 2HPTA 4ZFGL 1HAUA 2AXWA 5E2VH 2EKSB 5IMMB 2GY7B 4HP5A 2J71A 4HZAA 4AIOA 3TYFB 2FX7L 4MAZA 4WQOA 4FQIH 4WTQA 4XCEA 3UIZA 1XH3A 4QR7A 2VUOA 1B0GA 3B4NA 4KTEL 2D3LA 1KTCA 3T4AC 3MRNA 3QISA 1V7MH 2VE6B 4Z7AA 1P0SE 1TZHB 1FH2A 3X13A 3SKNB 1RZJC 2CGRL 2BWQA 4KKLC 4XCFH 4YHPB 3S36L 1CYGA 2DM4A 3V4LA 2RJMA 3IDYB 3P4OA 4X5PA 2B1AH 5I26A 3U4EA 4AEHH 5BO0D 3P1VA 4MHHI 5KS9E 5B6XA 4R7DA 3RVUC 1U8LA 4M48H 1AQDA 2F5BH 2X6MA 4P46C 1OF0A 1IGML 5JIKA 3FMGH 4UB0L 4CJ0A 5AW2B 3HANA 2PW2A 4R0LA 4ZRGA 5TE6H 1HHKB 3QHZH 2XC8A 3GHPA 5IBUB 2O5YL 5D70L 5AVQB 2YS4A 5AZ2H 1AI1H 1MWAB 2Z0UA 4PV8B 1GJWA 2AV7A 3B3IB 4XBPA 3PGFL 1FYTA 4CNIA 2J21A 2LFGA 1A47A 3UX9B 2ODHA 1FORL 1IC4L 5D1XB 4AZ8B 3QXTA 4LLYA 1OQXA 1CDGA 1KOAA 3LS5H 1YZZA 1CLYL 3LQAL 2A4ZA 4QXUH 2VLKB 5GRJL 1CICB 3L3JB 2W9EL 3ARZA 2AJZB 4LCWB 2YQGA 3FT4A 1T66D 4MXVE 4WJ5A 1U8NA 3TCXA 4JFDB 1ASOA 2WXGA 2KS0A 1YUKB 5IB4B 4XR8C 3VXNA 4N0CC 4RWYH 1UH4A 3D4YA 1ID2A 3EYUL 4OSUH 3RVTD 3W82A 1KMGA 1FE8H 3AT0A 2O93L 5IVZA 3K1DA 4I18C 5TF1L 3BQVA 1ZLDA 3D4GA 2AMUA 1Q0XH 4NUPA 4X5WA 4ODVH 4NNYA 4E41E 2FO4A 3H42L 1J87A 4FNQA 3SOBH 1OAQL 1N5AB 3DURA 1NCUA 3EH4B 1DJHA 2XA8H 3G08B 1E8ZA 3SDYH 4KDTC 2BHFA 4Y9EA 4GRLD 3FHQA 4E9WA 3BX7C 3OL2A 3TN0A 2B59A 2WXQA 3ZX1A 3LRSB 4H8UA 5CMAA 2VWEE 3HG0A 1X5GA 3TWCL 3VB8A 2VERN 2WWKT 3LIZL 4DFHA 2TAAA 5GS1B 3QUKA 1ZHNB 4JFYA 2QQLH 3OLEA 1BVOA 4PS4L 5JORB 1NOFA 1JK9B 1YMMD 3N41F 4LPVA 2I60L 2F95A 5K5YA 5FKPB 1MXDA 3U4AA 5DUML 4X6CA 4Z7UF 4EAEA 2AJVH 2GTWA 1XVSA 4OFVA 5DRZB 4OIFA 1TFHA 3JZYA 3NCWA 1GTNA 4PJCA 3VW3L 1ZVYA 3VWKB 3DHPA 5EZLB 4B5EA 5JW5A 3QJXA 3O2DA 1RL1A 2OS7A 3RAJL 1X9RA 3WN6A 4I2XE 1SY6L 2CLZA 4G42A 5I2IB 1ML0A 1D2OA 3WNKA 4G5ZH 1PNDA 3V5HA 5CP7B 1NANH 3ECUA 4Y5XC 4LLVB 5C08D 5BW7C 3EYQC 4MDIA 2DJ4A 1WBXA 1BBJB 4HHGA 4XRCA 3S35H 5LXVA 3ULVF 3ZE1E 2CHDA 2CNYA 4L1DA 2ZFEA 3BQUB 2BOCA 2YXWA 1B2WL 1HCFX 4NZJA 2NUPB 1JFQH 2NT0A 5KUKA 1F2QA 2G9HB 4M3HA 1XGPA 3HNSL 1WAEA 4HCFA 4DVRL 3S2AA 5LQBH 4PRPA 1NGQH 4ZMPA 3L3IB 4WAVA 2H2SD 4OQTA 3UYOD 3O6FC 1KB3A 1P5VA 4G11A 3IEAA 1TMQA 4PJGB 4XB3A 2A6DA 3D9AH 4JDZB 2G3MA 4HEME 4MXWL 1L9MA 2GJPA 4Y16A 2GSGA 3T4AB 4CU7A 4YE4L 5AOZA 5GSRA 2WB7A 4KDWA 1DBMH 4CDGC 1TUPA 5E8PA 4GO9A 3QDHA 5IV2A 3BZ4B 4XNMA 5IEKB 5C0BD 2PPDA 5JHMA 4FMKA 4LVEA 1CFMA 5EBLA 1Z2KA 1UTDA 2FIRT 2IAMA 4GRWE 4UQCA 4K7FB 3ULUC 5IESL 4ZOBA 5F6HI 4G82A 3PL6A 1ZWIB 5MP6H 1ACYL 2X1WL 2XRAH 4BKSC 5D72L 4MD5A 3G04B 3PFQA 3L4CA 3WJMA 1AC0A 5DDHA 4JM4L 1XGZA 3ARUA 3QZPA 3C60B 2WOBA 4RCAA 5B34A 5E8DH 4X99B 4UT9A 4NQEB 2AFNA 4JFZH 2E9JA 4BDVB 3N44B 3I9IA 4EN3D 4M56A 4TL5A 1R34A 3C12A 5CD3B 1LD9A 5HJ3A 1QW9A 3FQTA 3WFZA 1JGIA 5AVTB 4QJ3B 1D3CA 1RZ7L 4MAYA 5BZZA 5KSAA 3P4LA 3H56A 3KGRA 3N1MC 1WTLA 3K80A 1MIML 3HBPA 3PWNA 2DWXA 3IGAA 4JY5H 4Z7VA 3OG6B 1OSZB 3MQIA 3GDCA 2HLAA 5AOLA 5GISL 4UAHA 3HI1A 4I18B 1G7LA 1DBKH 4DK3A 3UDWA 3W3BA 3NFSL 4QXTB 2VRKA 2ICES 1KIQB 4LGRB 1IEBB 2J8UF 4ZMVA 1TO5A 1F3DH 1NC4A 1S7QA 1I9JH 3SGKC 3DXAA 3FN9A 4UQ9A 3T0DA 5CU9A 3UZEC 2VXQH 4BFJA 3ZIYA 1MVUA 4XCYB 3AYMA 3BEVA 2P8LA 1KELL 4MJID 1XB3A 1OD7A 4ZZFA 3BGFC 3VXUB 1YEFH 4U1HB 3ROOB 3SKJH 3IU3B 3D4CA 1KYAA 1MJJA 1LO3H 1S53A 3CX5K 4NM8H 4H2AA 2D31B 1HL4A 5L8LB 4QXVA 4HCIA 3ESPA 1A4KB 5F9AC 1MFBL 1TKWB 4U1NB 2FDBP 2M1KA 4FNLL 4JFFA 5EF0A 3AACA 2BFGA 4XHJD 5T5FH 4YQXL 3JV4B 1I1AD 2ZOUA 3D2TA 4LP8A 2XX1A 5EC2B 3VFWB 2PWGA 3BKJL 4G1EB 4QKTA 4UQ3B 5FO7A 4F2MB 4QRBA 4BXSV 3VGAA 1SHXA 4P4KB 5DD0L 1UD3A 1AIFA 3QZNA 4QIRA 5ICYB 1YYML 4M03A 4Y5XB 4YUEH 4IRZH 1ZTXL 4H8WC 3V0DA 4E9RA 3TXAA 3W0WE 1OTTC 5G53A 1OZUA 2CKBH 4FQ2H 3VFGH 1OGAA 1FNLA 1BSIA 3UTSA 4OCRL 4BBWA 3H0TB 4CL7A 5JQHC 1L9OA 1M57B 4W93A 5FDYA 2MCAA 4ZO9A 3WO3B 4N90D 5EEXA 5D2NE 2CDEB 3K2MC 3NGBC 2YD6A 4GSDL 1SN2A 1LDSA 1PLBA 3D34A 4UCFA 2PKDA 4JFWA 3I6KB 4HDIA 4YGVA 4V11A 3Q2LA 2QQNL 5E0QA 3PPEA 1EZUA 2HZHA 1A4JB 4HWZB 1BXVA 1QASA 2NY5H 1MH5B 4NKOB 1LE5A 2G2PA 1NL0H 4N24A 4P5TA 2OTUB 2R39A 2G5BA 1J10A 3LAFA 4YOKA 1BVZA 4X9IA 3MKKA 4EZLA 3EFFA 4ODTH 3IETB 4O2FB 2H3XC 4NYLA 5I1KH 3RVXC 1V55B 1ADQA 1UB5A 3FPXA 3OB8A 1IM3D 2P7TB 4AUUA 3DUHA 3TURA 1G9MC 2PXYD 3HB3B 1Z9SA 2MFNA 1H19A 3WHXA 1F1AA 2M83A 3U2JA 4P49A 4QKXB 3WDIA 4C59B 2HJFA 1MWAL 4N0UA 3U1PA 5BJTB 5EU7E 3FSWA 4HKZB 5EZJB 2C3HA 1UYWH 3O9WD 3SKMB 3H6AA 1OM3H 1J1XH 2VAJA 4RAVA 4LSDA 4OZGB 4LDOA 4W1TA 1SHWA 2Y6SC 5IJDC 1K8DA 3KJ6A 3GJFK 4GFTB 3STZA 3R1GH 5I1EL 2D03L 3P2BA 3D5OF 2YCXA 3JTTB 5EULV 1P1VA 4BIKA 2OYPA 4LASL 1R2NA 3OAUH 2E9BA 1NDGA 3UBFA 1RSFA 3ZKSD 1KNOA 4LHUB 1G0DA 2P8MA 1Q94B 1RH8A 4JO2H 3S96A 4MQTA 1MRCL 1KGJA 4EZMA 3FOLA 5AALA 1RZKH 2EZ0C 5HYJA 2DD8L 3UMNA 1I7RB 5CEYA 1QFWM 2Y06H 3ILDA 4F3FB 1DO6A 1M6UA 2HFGH 4HBCH 1VACA 4ERSL 5ALCH 5JDSA 3ZDYE 1SBSL 2QGEA 1I1FA 3E8VA 1GOGA 4AIEA 1VEMA 2JCCB 4ANKA 1UWYA 3IXAB 4HUUA 2GYSA 4AMJA 2R4SL 5C7XL 3BGFB 1PLCA 1DSFL 1XHHA 4XNZB 5T8IA 1OO2A 2E59A 2FHCA 3B5GA 1T22B 1WWCA 4OGAD 2DMKA 4S1QL 4CVXB 1AY1H 4K5YA 1XF4A 2FEJA 1M0KA 3QUZB 4DGVH 5K59F 1LK3H 3LKNA 1H5BA 3VI4A 1X9QA 5I16B 3P11L 5AZUA 5C09E 4ZUWB 3S3SA 2G0KA 5F3FA 1Z5LB 5K9JH 3ZZSA 3S8WA 3TC9A 2GJ6A 2E5EA 3NEEA 4PHXA 4UTBL 3POCA 3VM5A 4WI3A 2XZCL 2BZ7A 3U0TA 2C3GA 4MWFB 4K3HA 2CUAA 4NPYB 2P46B 1PAZA 2EVIA 3GEFA 5E5MA 5CJ8A 1RUMH 5D7JD 1ORQB 3GMLB 5GRYA 4FG6C 5E7BA 2O26U 2WN2A 1FQ9C 4GFXA 2NTSP 2WWNA 4AQ1A 3BVNA 2R59A 4P2RA 3KYAA 4GG8A 1HHGB 4RZCA 3MLUL 4A55A 2K7PA 3AMLA 3TBYB 2UVEA 1MCEA 4IKJA 1JXKA 3BPOC 4LCVA 1HHJB 3RX5A 1JPSH 4WNQA 1HOEA 2R1WB 4RGNB 4HXAH 4Y7OC 2IPTL 3NT0A 4M1CD 1QA9A 4PJFE 3SKOA 3L1OH 1H8LA 3ZE2F 3RA7L 1MCHA 1IM9B 2HN7A 3NGBB 3SPHA 1AO7E 4N0FA 4HG4J 2XIBA 3BW9A 1YPZB 2WXIA 1EWHA 4OJYA 4S1RL 5JJJA 4J3BA 5CLTA 4R2GB 3PAZA 1TVHB 4LRNH 4QRFA 4W9EC 1E8WA 5IB3B 1E4WH 1WZ1H 3RL2A 1EEUA 4DO4A 4JE0A 5HYIA 4OH2A 3WS6A 1BX2A 1JZIA 5D71H 1K2DB 2C1OB 3F5WA 2B0SH 2W0KA 2BSDA 3O3BB 3AADB 4PS8A 1XIOA 1XF5A 4QDGA 3DIFA 4L4VE 3N55A 2VDQH 5EO1B 1S8LA 1A3QA 4M3JA 4JRYB 1HYSD 1ZJBA 4PWEA 3KDPB 4NO5B 2D7TH 2QLVB 2WTOA 3DARA 4NQDB 5F6IB 1CMOA 1DZBA 4Z0XA 4MD4B 1L9QA 2GT9B 4PJAF 3CFJA 1I8LA 2IH1B 1RK0B 2FWOB 2AJYL 4QWWC 3UP1A 3OXRB 5K1JA 2DOCA 4BHUI 3VG9A 4QHMB 1EV2E 1NCHA 1XO8A 3FU8A 5HBBA 3MAWA 4G5AA 1QRNA 1URZA 1Q9LB 5J11C 5HI5D 3QG7L 4HU2A 4EA3A 4A38A 3THML 1UFGA 1PDKA 2ROXA 1HSBA 5DS1A 2W07A 1FHGA 5FGCE 5FOBA 2YPKB 2C9XA 3OHXB 1ZLVH 1W72H 5DUPL 2DWEB 4JGUA 3KYNA 2VLRE 4U3SB 4RMQA 4Z0BL 3UC0L 1XF3A 4HS8L 3CVHB 4ZZKA 1U8HA 4W9DC 2Z1PA 4QTIL 5J6GB 5CR1A 2GBVA 3CPLB 5IMLB 1J5CA 2CMRH 1XAKA 3AU0A 4I48B 3DX7A 2WP3T 4XNUL 2D7QA 1MAMH 3EGXA 4FQLL 1VGEH 1FNEA 1SMAA 1T3FB 1GIGL 4PYHA 3BFOA 2XZAL 1P6AB 3ATAA 3MV7B 5D7SH 4MA7L 5JR1L 4HK0A 2R4RH 1AKJB 4DH2A 1TOXA 2Z4QA 1HS6A 4S1SL 3RL1B 4QRPB 5D1ZD 2HKAA 3T71A 3AGVA 3FTXA 4NIYE 2DB8A 2WJ5A 1WTGT 32C2A 4L2LA 6TAAA 2HJKA 4DP4X 1NMCB 1GPOH 2VMCA 4U7KA 1DBJH 1HKFA 4UYPA 3UEZA 1IU1A 1O75A 3MRDA 5KOVC 1XZ0A 1VB9A 1TZIA 3MROB 2HRPL 5SX4I 3FRUB 1RZQA 2P45B 5GSVA 4ZG1A 1F2XK 3O0LA 1SFHA 1IKNC 4TSAH 5I28A 4J5VA 5EWIH 1OARH 2J88L 5CU5A 1Q4NX 3CG8A 5T33L 1BBDL 3FT3A 4KKBD 3WNIA 1Q5JA 4RFEA 4BFNA 4BZ1L 5B1JC 5GGVY 1NCJA 1IGCH 3FPYA 4IRJC 5L2KB 2BC4B 2ZWZA 2UWEE 3RGVD 1CLOH 5IY5B 1W91A 4HIJA 2GSMB 3K8KA 1J88A 3Q48A 5D7IA 3CZEA 4FNSA 5HDBB 3OC8A 4KO5A 1P5UB 2OMZA 1O9VA 2ATPA 2NXZB 3NCBB 5JA9A 2DTML 5DK3A 5DJCB 2JKWA 3B37A 5B6VA 4GXUN 5T3ZH 1N9PA 5F7AA 4W9KC 5BOZG 3RY4A 2HCZX 3TNMB 3L4UA 3PABA 3STLA 2W60A 3QCVH 4HLZG 1CDYA 3WN5B 2VMEA 4EXPX 3KPQB 4XTOA 3FFDB 2WD0A 1TVDA 2KQMA 4YIQB 5ITFA 1E4KC 2WANA 3WKPA 4DGYL 3SY0B 5EN3A 3VXOA 1JGJA 5EH1A 1JYWA 3LKQA 1NDMA 3W0WD 1CQYA 4QD2E 5G5DA 3ILEA 3FTGA 3BUDA 3V10A 2B77A 3IFNH 3D85D 3FSOA 1E0OB 3ARFA 2B5IB 3UTTE 4AGMA 3TBTA 4YXKH 4KJQC 1KCRH 2XLLA 4RDQG 3EDEA 5IFAH 2O5XH 1YQVH 3JWNH 3ZZLA 2CDGB 4BWTA 1BD2B 1RHHB 1S7SA 2BP8A 3VSQA 4CC0A 1XCTB 4DOHE 5DJZB 4NNXB 2UY6B 1IBZA 3K2UL 4JKKA 1J05A 1NC2B 3DETD 3MJGX 2O6PA 4BFEA 4IGBB 4PJEA 2AABH 2VT0A 3I6LE 3SE9L 4MVBC 1GOHA 1I3UA 2H0JA 5GRUL 1FH5H 3CQQA 3QEGL 3ILQD 1PKOA 3VX0A 2YUZA 3J8F7 1A02N 3MREA 4NERA 4WWID 4BFIB 1E5CA 5FYJU 1NBVH 2WMPA 4JVUA 4QI1A 3PP3H 2A2QT 2BIPA 3FF8A 1VEPA 3CFMA 1A7QL 3BKML 4QRTB 1M05B 3CZGA 3QH3A 4F9PA 4N0RA 3UAEA 1XJIA 4PJGF 3WXWH 1YEJH 1WBZA 1R24A 4XMTA 3TP4A 2CRYA 3G7TA 2BH0A 4Q9RL 1RAMA 2D2OA 4LP5A 4TNVF 3LY6A 3O81A 1OW0A 3HAPA 1CR9L 1OGPA 4KV5E 2XN9A 2YAPA 1Z9PA 1WO2A 5EU6E 1ZY9A 5LNGA 5GHWH 1BQ5A 1FO0A 3CNKA 1X5IA 4FL4B 3RBSA 3MRPA 3FRPA 3IFLH 3MJ8A 4GIOA 1D5MB 1U4FA 4X32A 3ET9F 3ARDB 2VXUL 5JQ6L 3L3GB 5ICXB 2BNUB 4LKCB 4NO2A 4ETYA 3ZJAA 1PJWA 3QULA 4BELD 4B60A 2RHEA 2OSXA 4PJDE 4KKZA 2QJDA 1G6RL 2OR8A 3Q01A 4ZUUA 2Z93A 1QSFB 3EYOB 4XO3A 4DGUA 2CK0L 2YAEA 4TNWK 1JPGA 5C97A 3MV11 1PEWA 5DLML 4H0HB 3CSTA 3N44F 4HA1A 2XPZA 5LCVL 1FBIL 2H32B 1WK0A 3QZMA 5KS9A 1UXSB 3IJYB 1SLXA 5AYTA 4X9HA 3FB7A 4H88L 4GUOA 2F74A 4P2OC 5JOPE 4O02L 4OV5A 4X31A 2CR0A 2WZ0A 2VC2H 3GXIA 3WE1A 3INUL 1K5WA 5IHUH 4K3JL 5C09D 5KYYA 5KANI 4DERA 3C9MA 2N59A 3QXAA 1FIGH 2A77H 4RDBA 3SCMB 1KCUH 3TA3D 3TBSB 4DKAA 4J1UA 2EYTB 2CBMA 3ZL4L 4EBQL 5FHAH 3FCUB 3MYJA 3ECBB 1XTLA 3HC3H 3K5SA 3T1WA 2NY7H 1IQDB 5EZIL 1KLGA 1M9SA 2WYTA 3PRZA 4WUKL 4Z3IA 3OJDB 2AQSA 4KI1A 1XF2B 3NCYP 4N28A 3C08L 4IIQB 5DTFB 3QDGD 3FRPG 5CCGE 2NYYD 2P5EE 2KBGA 2KZKA 4G59C 4HCRL 3RZEA 3HBGA 1HC1A 2AV1B 4RMBA 1UOKA 3VFMB 3V52H 2P5WE 5ETZA 2Z92A 4UNUA 4IBLT 2J2ZB 2ALWA 4E41A 3F85A 5C0CA 2ZF8A 4TLUA 3MCLL 3ILPA 1H6FA 5T5NG 3VXRA 5I74C 4OM0H 5I1LB 1TJHL 4L8SA 2ERJC 4NQQA 1AO7D 1NCDL 2UYLA 2XY2A 2VH5H 2DQGH 2BDNL 5E2WH 2VDNH 4XVSH 3HS0C 3QJRB 4NO3B 4AQEB 1VADB 1T20A 1N2RB 1E6OL 2BXYA 4IBSA 3MRIB 2XBTA 1E7VA 2VLJB 5GS2H 3QRGH 2VKWA 3OR6B 3MR9A 2IDFA 3JV6A 3HG3A 5T3ZE 2HUEA 1I8AA 2AK4E 1YNKL 4HPYH 4W9LC 1NDTA 3BP4A 5D7JA 4BKLB 4GYCA 4JQXC 1NLDH 1QBMH 2Y2YA 3CGTA 4TNEA 4FXKA 2WWOA 4TUKL 5INCA 5C6TL 3IBOA 1SPDA 2WBKA 2YEZA 1M2VA 4TUUA 2I27N 4OCWL 3S9DB 3GXMA 5D1QA 3ECVA 1S54A 2I35A 1P53A 1R3LB 1B4JL 1JZJA 1MSPA 1NLBL 2Y7SA 1DN0A 2HMID 3B2XA 3LQAC 2Y3AA 4UM9D 4OD1H 5GJTL 1FFOB 5KBPA 1FI8C 3GO1L 3BCDA 1TCRA 4WSJA 4AIZA 2C1PA 1CGUA 2ARJA 2OL3H 1QFWL 1THAA 3HRZB 4N85A 5ANMB 4YZWA 5D4IA 4YWGH 2NCMA 1DJWA 1AXSB 2Y01A 3WE6A 1R3JA 1T5XB 2HXAA 2XWDA 3JWNE 4HJJH 4ELKB 4G6AC 4NQVB 4YDVA 5FYKL 2XVGA 3MBEA 3RX7A 4XGZA 5K39A 1O9ZA 1NFDE 4YHKL 4TSBH 2KUTA 4DP0X 3N40F 1I1RA 3ULUF 5IQ9A 4BWUA 5KJRL 4I1NB 2Y7OA 4HOXA 5EUOA 3B5TA 2W65B 2BS8A 1JPFB 3L5JA 3ZSSA 4W9FC 3P0YH 3D1MC 4NRYB 1YC7A 2DYSB 1EGJH 2QV2A 1A6UL 2BSBA 4PWGA 4WI2A 4YSTA 5DK0B 1LNUA 4JJ5B 5KAQG 3ZSTA 1JZ2A 1BOGB 3LHPL 5EO0A 3U7YH 4BQ9A 3PBLA 5L6YL 1NBYA 1H68A 1YECL 3MJ7A 4BFRA 3VD0A 4AYBA 1U3HB 3ABKB 2BVPB 2GUOA 3MJ9H 3IJ7A 4WHTA 2FJGB 4ENZA 5BUPA 3ZW3A 3EH3B 3WQJA 4HZ1A 4P2OB 2R69H 1JNLH 4HK3N 2QSVA 3DVNB 3BHBA 3CDYA 2BJML 1ETA1 3RTQB 3B9KB 4RAHA 1DQLH 3JXAA 5IMOA 1OAJA 2BSSA 1MI5D 3WJJA 1VZGA 2H26B 1FG9C 1WIOA 2IADB 2XZZA 2WQRA 3S37X 1PX8A 4X9YA 2ZQKA 1AYRA 5C0DA 3IVKA 4PRAA 3MV8E 1M56B 5LXGH 4NKDB 5GGRB 1AP2A 1QPPA 2CJTA 2XIIA 3UONA 3V5DA 1N0LA 3S7GA 3GXTA 2R0LH 3HEIB 1A8JH 2JCCF 3E0GA 2KYIA 1BG1A 3L3DA 3UO1L 1RFDL 3CLEL 1S5HB 3D8MA 2P43B 3RWJB 4MXQC 4GO8A 3ZGIA 1BVKB 1ID5I 5CIPH 1YDPB 4ORGB 4P48A 4QGYA 1OCOB 1OSEA 5DWUL 5F72S 3L7FA 3WNOA 4HH9A 1PTZA 2FLRT 2QL1A 4HUMB 2OK0H 3WDHA 2GK2A 1ZTMA 4JFEB 5E2TH 4AMKH 1K85A 2XV0A 2FWSA 4JZNA 3WHE0 2APFA 2Y6TE 3NRPA 3MVSA 2BPBA 3PWPA 1QQDB 4YZFF 5JPMC 4YHZL 3RU8H 4ISVA 3SZKC 1AGFB 2X70A 2RIKA 2XWEA 3FCSB 4JRLA 3HS0B 2WXPA 4OCSL 1HCZA 3C6LC 3BAEH 2BY0A 4OUUA 1JHTB 1KB5B 2R2EB 5IBLD 1CDJA 4FN0A 5D96C 4OKVA 5FECB 5HPOA 1ZLEA 3AU1B 4OGYL 2X2HA 4QF1B 1T89A 2WZPD 3I85A 3NCFB 4N9GB 1LO5B 3FDWA 4YXHH 1WZKA 2YO3A 4Y1AD 5ICUA 3NESA 4D0BA 1DVFD 1T2XA 4K94C 4Y88A 2ENSA 4KXZH 2NW3B 4E42A 1R0AL 2VR9A 4S0TD 2PP7A 1SXBA 3OJ2C 3I6LD 4JO4L 4DUXA 3EYVB 2NY2D 5BUGA 4CSZA 3QDJE 2H8PA 2NR6C 2GHZA 1JPTH 3P0VL 5DVNA 5PCYA 1P7HL 3U30B 2ETWA 1NAMB 4N2AA 1YPZF 4KZEH 2C3VA 4YDJB 1RVFH 5C0GB 4MNGE 1UH3A 2C9PA 5G2DA 4U3CA 2YFOA 3B34A 1I3GL 4IK6A 1N0XH 3QQ3A 3CAFA 5G4NA 4MD1A 1I9RH 5HHNA 5BRPA 4NP4H 2Q8BL 1SEQL 2I07A 5MEQA 1CU4L 4S1DD 3WNLA 4P3CL 2FJHB 2DIBA 1TU2A 5KG9A 1QG3A 2YSSA 4HJSA 3GI8L 2OMBA 5KYWB 3MGAA 1JZ4A 4JRFA 5SWSA 4ELME 4TQEL 3QE5A 2JAGA 3OVUB 3LZFH 3IYLW 1FO0H 4A7TA 4EIUA 2QELA 5EU6D 5FF6B 1Y7VA 4K5OA 5F7HA 1MAKA 2FT7A 3LD8B 4XP9H 4Q9QH 5AW6B 1P1ZA 3UJIL 1W8OA 2IXQA 2F8IA 5D2LF 3HNTH 5KSUB 1P9MA 4FKHA 4LL9A 4XVUC 4BSWA 2VDMB 1GGYA 4Y4FC 5F1SA 3WL9B 2BRRH 5HVGB 3KLLA 4JUSA 2CLRB 5JA8B 2FEDD 1MCFA 2D3JA 2I24N 5CCJA 1HEZA 4UV4H 3U0WH 1MHCA 4JAMB 3L5HA 1WCBB 1ECYA 5GGSY 4DEPC 5GGTL 2OMWA 3MBWA 3WFHB 4APXB 2GUYA 1N4XL 3EW3B 1AD9B 2YLHA 1DDTA 1FNHA 3CFUA 2JFCA 4NEHB 5I6LA 5JOPD 2FGWH 1J8HE 2WNGA 4LLDB 1I1YA 3QJOA 3QWQB 4PJ9A 4XOBA 4YBQD 1JHKL 2CCVA 3MRGA 2C9UA 5IFJA 4HF5H 2R29H 4YSUA 4UDUA 1BHGA 3ULSB 3UO8B 3ZPDA 1ZGLB 4N6HA 2AXJA 2PW1A 4D9QE 2BMKB 3N43F 3MNWA 4TKWA 1UXLA 4BCYA 4LNRB 1URIA 3QNXA 5SWZE 1OP5K 1X6NA 4JO3L 4HK3J 3J7HA 3W2DH 5SX5H 1RJYA 3RVWC 5DEGA 2ODIA 3GMOA 2ZJSL 3HN8A 5DVLA 1Q1JH 5B6ZA 4JQIA 3HASA 3OZ9H 3IWUA 5AKTA 3P4MA 2P5ED 5TK2A 1DQQB 3KJ4C 4KJPD 3IRPX 5K9QI 3C6EA 1S7XB 1KJVA 2LE9A 1V3JA 4M6OL 5D96B 3Q5YA 1TQBB 3Q13A 1DHKA 2ADYA 3EZ8A 4ZMOA 4F8TA 2V3EA 4FLQA 1BEYH 2VDKB 3QZWB 5H2BA 3VXTA 3QFJE 4L0PB 2EEAA 3PDGA 3EJQA 3ARBC 4BK4A 1KENH 4ENEC 3B9AA 1F02I 1FG2A 3GMRA 3NN8A 5JIDA 2XYBA 1JDDA 2XKNB 3WUWB 2DWTA 2GB2A 4GIAA 4JJOA 3F7PC 4Y19A 3STBA 3RWHB 2XQYA 4ZJ9A 4Q4EA 3R0NA 5DVOA 4IJTA 4MBSA 3PWJA 3UADA 5ADOL 4PLOB 4Q14A 5T3ZD 2VMFA 2Y7MA 2GBTA 3D08A 4MKMA 1MNNA 4CADA 2AK4D 3F12B 2NY1C 5TFSL 3BAKA 4K9JA 2GW5A 4TLKA 3FTSA 3LN4A 4GW5B 5EUKA 3CD4A 3VNZA 4Z7IA 2O1AA 5AW3B 5IHZA 3HCVB 1HOCB 4XAWL 4BZ2A 4W9IC 3P0GA 2F6AA 2CM6A 2A9DA 1RCYA 4QCIB 5CJOH 4GLRI 4LHJB 4O00A 5A3IC 4P2QA 2JTYA 1JMXA 1I4FA 4C4KO 1M7DA 5T3XE 4PJFA 5CGYC 3QUYC 5E56A 1PBYA 1UVQB 4L35A 3H9HA 4P5SA 4AENA 1JUFA 4XMLH 1AGDB 4F7TB 3U6RA 2J4YA 4HWBA 4NBZB 3QHFL 1KJ2H 3QFDB 4ZS7H 3G5ZB 5IM7B 3IGFA 1VHPA 1I1CA 3L81A 5FUZL 1NJ9B 1ASQA 3DHUA 4Y4FB 5JDJA 4L4VA 2L3BA 1OAUL 3RFZB 1CCZA 1E4JA 3DO4A 1YY9D 4BUHA 3BZEB 2WSKA 5E6ID 5GQBA 3VH8A 4H2CA 4DVBB 3LEVH 4PJBB 3IMVA 2WVTA 1CPUA 2GABA 4XXJA 3KBEA 5IG7A 3ES6A 3V4PB 3FTVA 1WRFA 3HFMH 2X3CA 1PGRB 1P7BA 4GPVA 2VZUA 2GBAA 2QKIA 1T0MA 2XQYG 3OSVA 1UKSA 1MHPH 3TTSA 4OAWB 2ZAHA 5H37H 1WA2X 3NBNA 3US0A 1RZPA 4M6NL 4GG6E 4IHOA 1EO8L 2JJTC 4HZLA 3A24A 3ASNB 2FX9H 3KZ8A 1I8KB 2AGJL 2YPLB 3EJYC 4ZK8A 1PKQE 1D5ZA 5IB1B 2SODB 1C1EL 3M1BA 2VLRA 4X83A 3OXSB 4KHTH 3MV8D 2NDGA 3BT0A 3DUUA 1VGOA 4UG2A 1CDIA 3CXDL 2V33A 2BY1A 1E67A 3HS8A 4AYMC 1EDHA 5JPNB 3GM8A 1PW3A 4LDLA 5BRQA 4Q74A 2H0FA 2B1HH 4NM4L 4UAOC 5HJGA 2DY2A 3T1FA 4U1GC 3VWJD 4H25B 4A1RA 2YD1A 5EBGA 1IBYA 5DO2D 4ZFOL 2FD6L 3ROLB 1RK1B 2YD7A 4I3SH 2ZKHL 4G8GA 2R1YB 3QQDB 4U0RB 1GH7A 3PJNA 4BFFA 2EADA 2WLLB 3O45A 1A4CA 3MU3A 4OCLC 1KTDA 4W4OC 5AW9B 4APQC 2XG4A