3S3DB

Structure of thermus thermophilus cytochrome ba3 oxidase 480s after xe depressurization
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Mobility of Xe atoms within the oxygen diffusion channel of cytochrome ba(3) oxidase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s3dB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s3dB02
4EA3A 1PNDA 2Y04A 1WA1X 2PEDA 2JAGA 1M9WA 5A7EA 1X0SA 4KNTA 3QJVB 4UG2A 4BEZA 1E67A 2IDSA 1F88A 2PPDA 2TSBA 3AG3B 3IBOA 4P5SA 5I5MA 4YSUA 3CAPA 2HRGA 4G72B 1BQRA 2J55A 1Q5JA 4GYCA 3MX0B 4ENZA 5H2HA 2A3TA 5I6OA 1FWXA 3SN6R 2PP8A 3NSDA 1OCOB 4FAAB 4G71B 3WNIA 1PZCA 4HCGA 3QBIA 2B3IA 5H2OA 3NSBA 2BP8B 3ABWA 1L9RA 2Z73A 3ABKB 5DHGA 3QJRB 1J9RA 2YAHA 3H56A 2YAPA 1URIA 3WI9A 3NP3A 3SBQA 3ODUA 5G36A 4DPCX 1OE3A 3TASA 3QJTB 5H2LA 4N4WA 5AX0A 4XXJA 5B1BB 3S8FB 4AKOA 1FBKA 1SDDB 3OE8A 2YCXA 3DIVA 4MBSA 2WJKA 1KYAA 3T6XA 3HANA 1TN5A 3PWHA 1ILUA 4W9ZA 4BDVA 4BK5C 2F95A 1PZAA 1V54B 1M56B 5J7AA 5C1MA 2VW7A 3ZPRA 1A3ZA 1PLBA 3HARA 2VW4A 4L35A 5B7EA 4DP0X 2CCWA 1WA0X 2PPFA 1W6LA 3TU6A 2PPAA 1J9TA 2X72A 3BVDB 2XLLA 5B1AB 3HASA 3HAOA 3QJQB 1E5ZA 4KOCA 4FA7B 3WNJA 1AP9A 5H2PA 3RZEA 1SF5A 2UXVA 2VM3A 3CDZB 1JVLA 1QLEB 2PPCA 3MBVA 5I6LA 1ADWA 1AG0A 4HYJA 3FU9A 3V9EA 3SQRA 1CUOA 2XV3A 4M4RB 1TKWA 2GHZA 1L0MA 2XU9A 5B1JA 5I26A 4A66A 1SDDA 1AT9A 3RYMA 1RZPA 4GY4A 3X1GA 4E9RA 3UABA 5AFAA 4BEYA 4OV0A 4NAJA 3VGAA 1BEXA 5B6WA 2BHFA 5B6XA 3VG9A 3AG4B 4HAKA 3CVCA 3AG2B 1TU2A 1VGOA 4NC3A 3UACA 4G7RB 4XTLA 1BRXA 1GW0A 2TSAA 1ASPA 4MFHA 3DTUB 4W1TA 1KMEA 4XT3A 2W88A 3NS0A 5AZDA 1QKPA 5H2KA 1IBZA 1JZJA 2YQBA 2VW6A 1JZIA 4J4QA 3NSYA 1AG6A 3ZDWA 3ERXA 1LN6A 1NINA 3T6VA 1AS6A 3CDZA 3QQXA 2B08A 2Y02A 1BRRA 3L45A 3UAEA 5B6YA 4X31A 1VJMA 5A44A 1NDTA 3ZIYA 1UAZA 1OV8A 1SJMA 2Z55A 1ZIBA 2BP0B 3PAVA 2FQFA 3WQJA 2PCYA 2XVBA 3FSZA 4JR8A 1V55B 3GDCA 2CAKA 5G54A 3QJSB 1BYOA 2LNLA 2IAAC 2Y00A 2QT6A 5I5JA 1CYWA 2MRYA 1QM8A 3OD3A 1DZEA 4KNSA 1ZDQA 5IY5B 2I21A 3QJUB 5AHZA 1BXUA 3IN2A 4TXVB 3UG9A 1DZ0A 5FC9A 1SHXA 2WO2B 2IH8A 4WAVA 4QIDA 1GY1A 2IDUA 2YAMA 3DKHA 1IUZA 1AIZA 2CALA 4CSZA 1FBBA 4DP5X 5B3SB 1ID2A 2I20A 4IARA 4XTNA 3V2WA 3NJGA 2QPDB 4HCIA 1E65A 1X0I1 3OMIB 1J5DA 2HXAA 1S8JA 4HHGA 1AAJA 1OF0A 2AZUA 2AANA 5B6ZA 1PY6A 1HFUA 4A4MA 1AS7A 2EILB 3ABGA 5I5IA 3X1BA 2VSMB 3NJKA 1JZFA 1BQ5A 1L9SA 5ITCA 3N55A 2DYSB 1DYZA 1GUEA 2AT9A 2FT8A 2ZXWB 4A2GA 1C8SA 3S3DB 1GR7A 1ZV2A 2VM4A 2E86A 2DY2A 1JGJA 1OCCB 1L9TA 2UXFA 4JHVA 2KSYA 2CJ3A 2XXGA 4P5RA 3NYAA 1PCSA 5JJNA 2DWTA 1TN0A 1NPNA 4AMIA 1SFDA 3FQ2A 3FPYA 4LDOA 2PLTA 2FT7A 2R7EB 1JV7A 3H4HA 2WJLA 2GSMB 1BRDA 1OCRB 3WKPA 1AOZA 5BR5A 1QHJA 4DAJA 2ZONA 3ZEVA 4K9JA 5JJJA 1J5CA 5F8UA 1S53A 2R4RA 3OE6A 1PY0A 1XB6A 2IWKA 4PXKA 4N6HA 3S3CB 1XB3A 1PXRA 1CC3A 3NJNA 2JKWA 5H2NA 5AZUA 3WKQA 2M3GA 1O0AA 5DHHA 2YAOA 4YSAA 1GS8A 1U19A 5ETZA 2YARA 2I1XA 3EHBB 1I53A 4JKNA 1B3IA 1BQKA 3VI0A 1J9QA 4DPAX 4QKTA 2I35A 3AY2A 2OJ1A 3PAUA 2Y01A 1JZGA 4F2EA 4MD2A 1OE1A 2HLEB 3CVBA 3NJIA 4PXFA 4DP2X 3OE9A 2IH9A 3T6WA 1AACA 1HAWA 3AG1B 7PAZA 4GBRA 1WAEA 1FFTB 2R7EA 3UTWA 2XV2A 4DP9X 5I28A 4GPOA 4HHWA 1BXAA 5A8EA 4ZK8A 4FBZA 1JOIA 3TA4D 3V9CA 2XX1A 3X1FA 3CVDA 2YDOA 1E30A 4KNUA 1AS8A 1KV7A 4F2FA 4F7KA 1P8HA 1R2NA 2VSKB 2EIMB 3S8GB 2KSAA 2DV6A 4G70B 4N8UA 4RH4A 3V2YA 4UANA 4DP8X 1NICA 4A2HA 3ASNB 1MZZA 3IEAA 3NT0A 4YSQA 2BP8A 5AKRA 4KO7A 3UADA 1N70A 2J4YA 2I85A 3EH3B 2DWSA 3IN0A 3VVKA 1CWQA 3UTVA 3OMNB 2J5WA 2FT6A 1CYXA 4BXVA 3KW8A 1NIBA 8PAZA 4E9QA 1YLBB 5F7AA 1CURA 3QAPA 2YDVA 1FA4A 5B35A 2CUAA 5G2AA 3HAPA 5LWEA 3UZCA 4G7SB 3PPSA 3FU7B 5E9NA 1ZPUA 4YSPA 2FJSA 2QDWA 4IAQA 3FYIB 2BW5A 3AW5A 4UAHA 1PF3A 3NYKA 3UONA 6PCYA 1NIAA 5LDUA 1BAWA 1RZQA 1E5YA 4BV0A 2GC7C 1OOWA 4E9TA 3OM3B 4KOBA 1JV6A 2CBPA 3G5WA 4G7QB 4EIYA 3PLYA 2AZAA 1M0MA 4BWTA 4UF7C 4QRYA 2J56A 3DQBA 1AZBA 1ILSA 2XV0A 1XMEB 2IWEA 1KDIA 1UATA 2F93A 4BWBA 2FQEA 2AFNA 2GIMA 1S51A 3HAQA 3UZAA 1H68A 2ZZLA 1J9SA 4HWLA 1L9PA 4YSRA 3QBKA 4BWUA 4MD1A 2JXMA 4DP7X 2HX8A 1BM1A 1IXFA 1KCBA 2YXVA 2YXWA 2P80D 2QPEB 3FU7A 2MTAA 2FQDA 3ZBMA 3AYNA 1ET5A 3VHZA 4DP4X 1JXFA 2IWFA 2YCWA 3CODA 2XYBA 1JZHA 1BYPA 2NTWA 3OMAB 1M57B 3AM6A 5H2JA 3FU8A 1NPJA 1IKOP 1RCYA 1S52A 2HRHA 1VLXA 2XX0A 4YL4A 2BZ7A 1SNRA 1GYCA 3PAZA 1S8LA 1N68A 3ZX1A 1X0K1 4LDLA 4DJHA 1NZRA 1AZRA 1W8EA 1ZDSA 2H5UA 2LLNA 3AYMA 2QDVA 1RKRA 4BVNA 5H2MA 4IB4A 3N2JA 1C3WA 3COCA 1NIEA 5TK2A 2UXTA 5I6PA 3FQYA 5B7FA 3PBLA 5ITEA 1P8IA 2XUWA 5TK4A 5EN0A 2XWZA 4A67A 2ZIYA 1F50A 2RACA 5BR2A 3NJJA 4YSOA 5B1KA 2BP0A 1TEGA 3NJHA 4N4YB 3T45A 3TBBA 4YVNA 3UAAA 2EIJB 2YAEA 4EF3A 5B2NA 1PLAA 3KW7A 1WS8A 1A4AA 7PCYA 2ZWNA 1WS7A 2N0MA 2R4SA 3C9MA 4EJ4A 4JKVA 4KO5A 1X9RA 3ASOB 4E9VA 2Y69B 1KCWA 2PP7A 4AMJA 3NY9A 4HCFA 2X88A 3T9WA 4A68A 6PAZA 1SHWA 4A2FA 1IBYA 5D4JA 3QBGA 2HZHA 2X87A 5F7BA 5I6KA 2JFCA 2IDQA 1W6WA 3FPXA 4HIPA 4MQTA 4YVUA 1NIFA 1AR1B 3DDLA 3FSVA 3NP4A 1JZEA 4L0PB 2KS9A 4KLYA 2PP9A 3UGEA 4DP6X 2GC4C 4CSPA 3WIAA 2I7OA 4XT1A 5B7MA 3EH4B 5I6MA 3VW7A 3QPKA 2YCYA 3P0GA 2BRDA 1QNIA 2W8CA 4BWWA 4DKLA 4BDVB 2DYRB 2HX9A 1T5KA 1GY2A 1EHKB 2PPEA 4E9XA 3SBRA 1MZYA 3JTBA 3NJLA 2PCFA 1XJIA 3EF4A 4M3HA 3IE9A 3D12B 1KG9A 4AI7A 2NRDA 4AKPA 5A45A 4Q89A 4YSCA 1GSKA 1JVOA 1SF3A 2Q5BA 4KO6A 5TGZA 5EHFA 4A2EA 3T6ZA 1X9UA 4NB7A 3OE0A 3X3CA 2FTAA 2FQGA 4GP4B 1R1CA 3PXOA 1JERA 2YAFA 4L6RA 3C9LA 4X1HA 5G2DA 3QDCA 5G2CA 2YAQA 2BWDA 2KSBA 3C75A 5H2IA 3H4FA 4PAZA 2EIKB 2HX7A 3EH5B 3FT0A 3JT2A 4JQ6A 1HZXA 1NWPA 1PXSA 3REYA 4GP8B 1Q5IA 3MBWB 1KDJA 2NTUA 2IDFA 2BO0A 1QHQA 1A8ZA 4E9SA 2H3XC 2VN3A 4PCYA 5B1JC 4AX3A 1JXGA 3WG7B 1R84A 3S3BB 1JXDA 1GZMA 3X2QB 1PLCA 1PNCA 1IW9A 3GXUB 3KJ6A 3PCYA 1UCQA 2EI4A 2ZOOA 4GXFA 2OCCB 3D4SA 4X4KA 1L9HA 4Y9HA 1TEFA 2Q9OA 2L6XA 1S54A 3X1NA 5B34A 1NIDA 4Q8BA 1M0LA 1AZUA 1KGYE 2Y03A 1ET7A 5D4HA 1IC0A 2IDTA 3NY8A 4YSSA 2UX6A 3OAXA 3CZUB 2VMJA 4BXSV 1JFPA 1KGBA 9PCYA 1NWOA 1MG2C 2FWLB 2G87A 2UXGA 2GI0A 5D4IA 1GS7A 4AZUA 3UTYA 4QI1A 3FQ1A 4NERA 5G53A 2JAFA 1L9OA 1KBVA 1PAZA 3CG8A 3U25A 3RFMA 2I7SA 4DP1X 4UHRA 3FYEB 3EMLA 5B6VA 5AX1A 5I6NA 4MQSA 3QBLA 4GP5B 2OV0A 4E9WA 5PCYA 3PDSA 1AZNA 4YSDA 2GB2A 4HYXA 2BZCA 1OCZB 1ETJA 1SFHA 1XB8A 1V10A 4GRVA 1ASOA 2H47C 4AKQA 4YSTA 4QLWA 2BW4A 4DPBX 1ZIAA 1BXVA 1L9QA 4LDEA 3T71A 3A7KA 5AWZA 1IW6A 2FNWA 3OQRA 4GYBA 3HEIB 3GYRA 3PXLA 3FS9A 1A4CA 1GS6X 3ABMB 1XIOA 1EZLA 2YCZA 1P8UA 3AZUA 1F56A 1PZBA 2RH1A 1A65A 1MG3C 3SBPA 2EINB 2UX7A 3TBCA 4K5YA 1AZCA 4JHUA 2J57A 2GBAA 2HPYA 1C8RA 1AANA 4WW3A 5B0WA 3UTXA 4KNFA 2XXFA 1F4ZA 3FSAA 5AHYA 3NSCA 1KBWA 1A4BA 1WA2X 1HAUA 3HB3B 1NTDA 3BQVA 4X32A 4XTOA 1GU8A 4E9YA 4WTQA 5FJGA 5G28A 1ET8A 1H2SA 3X3BA 3NSFA 3NJFA 1ASQA 2ZFEA 2VT4A 1M0KA 1MDAA 2AVFA 5KKHA 4TL3A 4KO9A 1AQ8A 3NJMA 4YSEA 4HZ1A 3QAKA 1PMYA 1MGYA 4WKXA 3ZPQA 4HALA 1KG8A 3PQRA 5JJEA 2Y1AA 3ABLB 2BWIA 3FSWA 3X1EA 1OE2A 1QKOA 5PAZA 5ANHA 2WSDA 4A2DA 2WO3B 5DYSA 4FPDA 4BUOA 1E12A 1E0PA 2P80A
chains in the Genus database with same CATH superfamily
5JQ6H 2AQSA 2DAVA 3EOAA 5E56A 1IBFA 3WEBA 4DUWA 5L6YL 4F3FB 4LSVL 5INDB 1XIWC 3AG3B 3ZGHA 4L8DA 3CC5B 2XG4B 1RUPL 1U3ZA 4NP4L 1RUKH 2CRIA 3IFPA 1M6OB 1ZK9A 2V17L 1X5KA 2X4UB 1INEL 2BK8A 3BGMB 2Y5TA 3ARWA 4L5FL 5GISH 5FCSH 3NSBA 3CHOA 4UI2A 2LHAA 3M46A 1G4MA 4FCHA 4NYLB 3WY3A 5B21A 4GAGL 2C9XA 2BSSA 1KYUA 3MV8B 5DJAB 4OFPA 1EMTL 3O45A 1BLNB 4DPCX 3WTTA 4NWUL 3KYNA 3C9NB 4WJG3 2D9CA 3GMOA 4GLRI 3RWIA 4YK4C 5IG7B 3T6XA 4HPHA 5I15L 3M7OA 4HF5L 2GYSA 2WWKO 5F44A 5HYQA 2JB6A 2CHWA 3WENA 3CN0A 3B2PA 3EO9L 4RFNB 3RIAF 4WFED 4JN2A 4XVJL 3C5ZD 2APTA 1A22B 5IBUG 4C56E 2VSCA 2P43B 3CIAA 1J9TA 3QJOA 2A4EA 2FJHA 5D1QB 5T3ZH 4YLBA 5JDSB 4LARL 4QJ4B 3VXRE 2MWCA 3B2VL 1YEDA 4J3WA 3FDWA 3V9EA 3MODL 4UT6A 4M4RB 4MQ7A 5HSFA 3MBWA 2X4NB 1TVBA 4UQ2A 3EKCA 1SDDA 2LQRA 3RYMA 3MV11 3MRKA 1W2KT 3CBRA 3FQNA 4H13C 1F58L 1QZ1A 1I3GH 1B0GB 4L4TD 7CGTA 2BHFA 2YPLB 2A4ZA 4HPOL 4PJEA 1OAQL 3RNQA 3HIZA 2VXSL 3L3HA 2G4GA 2HLFD 4LP4A 1FL3B 3TBYB 4NUGL 2JI2A 4IQHA 3ZL4L 1Z5HA 4NS0A 3B9KC 3QR2A 3DTUB 5AVXB 3L3OA 4X80L 2CH8A 5AZDA 5DMGC 1JZIA 2FWOA 3OJDB 2F53B 1WYJA 5ALBL 4F80A 2O5XH 4WU5B 2D0GA 4PY8J 2P7TB 1J05A 4NEHB 4F7CB 1FFNB 2UYLB 1CT8A 2AP2A 2BP0B 2VDRB 2HJLB 4HOZA 4A6YL 3EFOA 3FN0L 4JQVC 4UM8A 3W81A 2WVSA 3RWEA 4ZNCD 3T2OA 2CLZA 1JG9A 1EEZA 2XTJB 1SXZA 1JK8A 3AS0A 4KNSA 4OCRL 4Y4HD 3RFZB 1BXUA 1XHHA 4JPKH 2NY2D 1DZ0A 3BCDA 1IEAB 1NMAL 2R4RH 2CALA 4ESKA 1S7SA 5HDBE 2OJZL 4LCYB 3UPRA 2WB7A 3NJGA 3I9GL 4JFXB 5T1KB 1F2XK 4GRMB 4DGYH 1RZ7L 2A9MH 4G6JL 4GW4B 4AY0A 4YNYB 5D7IF 3DV4B 2QZ5A 2DYSB 4BCYA 4HJ1A 1DDTA 2ZWLT 3AT8A 2C3VB 4TRPH 5EU7C 3CZFA 4FG4A 3MRJA 1EAJA 5T1LA 2GSMB 5EOQL 5EZPA 3WY1A 3U4BL 1VRSA 2EEAA 1BF8A 4H1LG 5IB3B 3GHBL 1R5IA 4HLZG 3WLBA 2R4RA 2EXWD 1Y7VA 2WBWB 2R69A 3DX1A 4UQCA 2ZAHA 4AJWA 1CC3A 2O6PA 2JKWA 3KPRA 2OW6A 3NJNA 4FTVE 4UQ9A 3GHPA 1BD2E 5DHHA 4ZUWA 2YAOA 4YSAA 5EUOF 3E7JA 2YARA 4KDTC 4AYEC 1JWSA 4OD3L 1UD8A 1CXHA 3KJ6H 3HS9A 3RUGF 4IRJD 3SDDD 1QBML 1KTLA 1XV8A 1RZJL 4HKJB 4LE8A 4W70A 2HLEB 5SWSE 4C54A 4LCWB 4OUUB 3ULVC 3QNYA 1OM9A 2VR6A 2J6WA 2HN7A 2O30A 5FK9A 5E7FA 1UZ8A 4ZK8A 2DLIA 2OYPA 3X1FA 4UBDC 1XF5A 2VLLB 5LCVL 3KCPB 5GZOD 2FO4B 2EIMB 5ANMB 3ROLB 3N1PC 3E80A 4BFKA 5DD0L 4APQA 4R97B 1RLBA 4MNQA 1S7TA 2K3TA 4Z7AA 3QIWB 2BP8A 3CFCL 1QFUH 5AW5B 4UTBH 3STBA 1N7MH 3BVUA 3UO1L 2QSCH 1FZMB 1MREH 3OMNB 2FT6A 3TIDB 3K2MC 1RVFL 3KW8A 5HYEA 3O6ML 2K9UA 5IFAH 5T3ZE 5I73C 2R8SL 3FUHA 2VR3A 3PPSA 1E8ZA 2ZUSA 1I8MB 2QDWA 1YN7A 1L5GB 3EXJA 1MH5A 1F00I 2DMKA 3NYKA 2FBOJ 3CE1A 3BDBA 4POZD 1E5YA 1KV3A 4D9RD 2BIMA 2VDQH 3KD4A 4HJUA 3PWJB 3ZYOA 4UB0H 3VD4A 4IBUA 1HT6A 1QSVA 3L3KA 4PJXA 4PUBL 2Q3ZA 2Z4QB 1JBJA 3R18A 1JPST 2EVIA 2QGDA 3KWUA 1I1AB 4ZTOH 4ZFZA 1TTAA 4RESB 4ALAH 5FYKD 4P2QE 4HJJH 4AYSA 3LKPA 4D0DA 2HLAA 3MV01 3O3DB 4HX1A 3NCCB 3DI2B 1HKFA 3GBNL 4HSAC 3H0TB 4PRNB 4Z7UF 1GC1H 3KR3H 3MXVL 6CGTA 4OJFH 1P1ZB 1WD8A 1BECA 3IGAA 3MZGB 4FLRA 3MJGX 1JMZA 4FE9A 2KKQA 5DLLA 1CR9H 1JPGA 1T0OA 3F12B 5IIEA 3QZBA 4ZD3H 2FX7H 4X99B 5DZPA 5J1TC 1FFOA 3T2LA 2E56A 3O2VH 4PRDB 1C3WA 4F7PA 3FK3A 2B5IB 1YQVL 3G3LA 4KHTH 3HUJB 4XCFL 3X3FH 4N6RA 3P0GB 1CFSB 4AJVA 2VMFA 4HK0A 4P23D 3MGOA 4FP8L 1KPRB 5ABDE 2RACA 2AQRA 3VU1A 4JQVA 4N9GB 2QGBA 3ZL1A 4MYPA 3IDGB 3T45A 4LPTA 4LP5A 3A4EA 5HYSB 3WN5B 3L3IB 1DQQB 2Y6SC 3OGOE 3GI9H 5I1LB 1OAZL 4BZYA 3UTQA 2OKMA 2F5AL 3CFDA 4HLZH 5I1EL 1KELL 2PP7A 2QR0A 3ET9F 4AMJA 2DIAA 3U79A 3WFCH 3LQAH 1JV5A 3PJSB 4QO1B 3WMSA 3AU0A 3ZZLA 2V3DA 4QCIA 1FVCB 4QOKA 3WEXB 4ANXA 4WY7H 1QUNB 5DMYA 1JHTA 3FSVA 5IOPA 3QEHA 2MPAL 3UGEA 3VU2A 2GC4C 3HZYB 4YXLH 2I7OA 2CHZA 3CN2A 4KY1H 3HC0B 4O5LL 4BM7A 5H37G 2VM9A 4BSWA 3ORJA 3QUYC 4XI5D 1ORQA 5EUKA 2HSIA 4RVBA 4HIEA 4HJGA 2D7OA 3IE9A 3Q1SL 5DT1L 2NRDA 4UT9A 3U7YH 1CIDA 2QTEA 3NIGB 5ENWA 3MLZL 5JHDA 2FBJH 5DRZA 5IWLC 4ZW8A 3FB7A 4H1LA 3CFIC 1CXFA 5SWZD 3C9LA 2YAQA 2EIEA 2BWDA 4Q58C 1E5CA 3PWPD 4ORGB 3LN9A 5FECB 2EDOA 3RJOA 5EEUA 3V5HB 2Q20A 1Q5IA 1OARH 4DCQB 5HHPA 1QHQA 1TQUA 3MBXH 35C8H 5FYKU 1R84A 3BPLB 3TVMD 3UYRL 4BA8A 4ZPTB 5DFVC 4PJXE 4GXFA 4PB9H 2VWEC 1L9HA 4Y9HA 4AJYV 3KWWB 4AVKA 2L6XA 4LVHB 1XEUA 4YBQD 3D39A 1VEMA 2DQDH 3KYMB 5E99H 2A9NH 4WNJA 1OW0C 3BVTA 4TVPH 4KBPA 4FQIL 4RQQB 4AQ1B 5D2NC 5EDSA 1E6OL 1DQMH 2ZUQC 2RB8A 3C12A 3PWPE 3HS0B 2KLTA 3JV0A 1MG2C 5HHNA 4D8PA 4M61A 2BNUA 2VDOB 3DX4A 4JRYB 3PFUA 3L8QA 1K5WA 5G53A 3VRJB 1RHHA 2I7SA 4KDWA 5AX1A 2X6AA 5KBMA 2FGZA 5BW7C 5PCYA 2I07B 1X9LA 5EU6D 5HTSA 4ZO7A 4Z5RB 3KJ4C 2WNWA 1NAKL 3O6FC 4L3CA 1X5LA 3RGBA 3M88A 5B1CA 2NUTB 3HR5A 3K5SA 4MZRA 1U58A 1MJJB 1VFAA 2BW4A 1UD4A 3GMMB 4GBXD 5FHBL 5HHOB 4KVNH 1NDGA 1WT5A 4KKZA 2WVUA 4APXB 4R3SA 3RX9A 1M05B 1XF1A 2GK0A 5CF3A 2CA4A 2V2WA 2ZJSH 4BH7B 5DYFA 3BIKA 2H2SD 4LMQI 3OJVC 5ELIA 3WHXA 4RAVB 4D3CL 1IGFL 2H6PA 2OMUA 4UOW1 5FDYA 3WAJA 1Q9WB 4LSDA 1Q0XH 4ZODA 4R5XA 1WFTA 5EU6E 3D09A 5DR5H 4KNFA 1NC2B 1BG1A 3S3SA 4B5EA 1KBWA 3W0WB 1U4FA 4Z78A 1HAUA 2GIXA 4RX4A 1NGWA 1GGCL 2WINB 4Z0XA 5HDRA 2WQRA 2QSQA 3VFMB 1JWUB 2BC4B 3BH8B 4IKNA 3CFKB 5HDBF 1LP9A 3RY4A 5HYIA 3ZE1B 5C0GA 2WQXA 3CN3A 4JB9H 3Q48A 2FR4A 4GAYB 4H2AA 1EDHA 3U0TA 1LK2A 1P9MA 1MGYA 1PMYA 5DRNB 2R15A 2F58H 1NUNB 2ZSWA 3NMEA 5BRZE 3LH8A 1S7XB 1XR8A 3MUHL 4GMTL 3FCGA 3MZTA 1C5CL 1OZTG 1Z0MA 1YEEH 3DJSA 3LS5H 3MNMA 5E9DB 5JHDE 5HVFB 4UQBA 1M9WA 4FQJH 4OU3A 5D7JB 2E0PA 2R56L 3BAEH 3QXAB 3OAZK 5A7EA 1ZVSA 1F6AA 3C87A 3BPNC 4P49A 1L3NA 2YGPA 3SKJL 2IH3A 4PJ6A 3DUSB 1MHHA 4TL5A 2C7UB 4GYCA 3V10A 5FUZL 3RWFB 2PO6B 1L4IA 2NY6C 3SE9H 4AYMC 5IJBC 3NSDA 5C09D 2HTLC 1D6VH 2I60L 2WW8A 3DWTA 2VN6A 4UIMA 2LVCA 4QRBA 4WNSA 3HKFA 4I9XA 5H2OA 1DSFH 2J8HA 4GRLD 4JZOB 5CLXA 3FZUC 2K70A 1Y6MR 3B43A 3L1OH 3E8UH 5TDNA 3E0GA 3QXVA 3EAKA 1N6QL 3NP3A 3AWGA 1K4CA 1XF3A 1DVQA 3F5WA 1SMAA 1RULH 3NRQA 3UTPE 5FO8B 3EJPA 4XXJA 4FQPA 1NGZB 2CPCA 3QUYA 4G8EB 1EHLH 5H37A 3QG7H 1JDCA 2KLRA 4L05A 3IFOA 3GIVA 4I7ZC 5D96C 2Y3AA 1ZV9A 1V54B 1XD0A 3QCUL 4KZDL 4KJYA 1FSKB 4KNQA 3ZPRA 1SY6H 3UTTB 1PLBA 3BO8A 1RUAH 4JL2A 2CCWA 4Y4KB 1JNLL 4BEIA 1N6UA 4LZKA 1CPUA 2JJVA 2ROXA 3TU6A 1MFCL 3WUZA 4EQ3A 1YY8B 2Z8VC 3HASA 2VLJA 3QJQB 5A2AA 4YN3A 3QUZC 3QUHA 5E4IA 5FV2A 3T65B 3FXIC 5TDPB 3WOVA 3CFJA 1QLEB 4E41A 5JPMA 1ZS8B 4MBRA 2DWDA 4QRUB 5GGTL 1LO2H 1C12A 4TVPE 5K9OA 4L9LA 5FFOA 4DVBA 3VD2A 4K71B 1DVFC 5DUPL 4X6DA 1AQDB 2A6DB 1RV6X 5TE7H 4PCSA 2WZ5A 3MRQA 3RU8H 1ES0B 4U6TA 1HKLL 3MMEA 5HXMA 2AJZA 3HE7D 4GY4A 3CVHL 4UNUA 3LN4A 4KZEL 4Y5YA 2G9HB 5AFAA 4NQXB 3EYVA 3MRIA 5EIIB 4NO5A 4OB5L 3N44B 4WO4C 4KJPC 2ZUWA 3O2WL 4GSDL 3OC5A 5F7KC 1Z9SA 1G9MH 2A4CA 5DJ6A 1OW0A 1Q4NX 3JVGC 4PJFB 3I6KB 4P9HC 3ZU8A 4Y19D 2EIDA 3LIUA 5D2NA 3ZZSA 2Y36L 3VXOB 2VL5B 5E4EB 4F2MB 5H2KA 3LEXB 1FNAA 1M7XA 3P3SA 3V6OE 4AM0A 4IBTA 4XE0A 1MSPA 3ZDWA 4PIBA 1FUNA 1LP9E 4I0PA 1HHHA 4L8SC 4YPGA 4MS8D 1G7JA 1NLBL 4KQ0A 1EAOA 3ARBC 3CFEA 5DJ8B 3WE6B 3QDGB 2O5ZL 2BNQD 4NN7B 5EPMA 1YNLL 4PWHA 1AQKL 4WHTA 4Z7NB 2WWMC 1OPGH 4DERA 2PKDA 5I1IL 4XCYA 4QRQB 5D1ZI 3WNLA 4LAQL 5F3BA 5G54A 4M6ML 2O5YH 2CGRH 3E3QE 3O3BA 4JHZA 1KXQE 2X89D 1JIBA 3UG9A 4HW6A 3WS3A 1CXEA 5F93C 4ZMXA 4U3XA 5DC9B 3BD4A 1IUZA 5JW4N 4NT6A 4UV7H 4B9CA 1WDAA 1XAKA 5KSBA 5AB2A 2NW3A 2I20A 43C9A 2QPDB 2B7DT 2H26A 1IKFL 2CMRH 2EYRA 2FD6H 1UUNA 1OF0A 4NQEB 2AANA 1LDPL 4Y9EA 5LBSL 4ZMQA 1NFKA 2EYTA 4FHJA 4GKZA 5ITCA 4NI3A 3QFGA 3REVB 1DYZA 3TWCL 2F54B 1XZ0B 1T2XA 4FQHA 2ZXAA 4UT7H 1RU9L 2ZXQA 3GKWH 2DY2A 1JGJA 5ADPL 1L9TA 3OR7A 3IDYC 4UWQB 1AKJB 1S9XB 4FXGB 3BSHA 1JV7A 1PQZA 4H8VA 5C6TL 1JRHL 1NEZB 2UUDH 1RJZA 5DJ2A 3TS8A 4J5VA 4NRYB 4NQDB 4L4JA 1JGUH 1H8LA 4ZMWA 4QYAA 3BP5A 1A7OL 3RJQB 1IGYB 3S3CB 2P44B 3JTSA 1RPUA 2PWHA 5IROA 2GTQA 1Q72L 1S6NA 3ZSTA 1N64H 1DEEA 3L4TA 5MI0C 4Q9QL 1FV1A 1QFWI 4JG1H 4AITA 1MN4A 4NZTH 5CCGE 1IM3D 2WVVA 4B7LA 1ZTMA 3TYGH 3GSUA 2OJ1A 4MAUL 1ZE3C 2BM3A 4S0TD 3UIZA 4FZ8H 4E41E 3GBEA 3CSYA 3D9AH 3F6IA 3L4YA 4QXTA 3IK2A 1BXAA 4HS6B 3KYAA 5E8EB 5HBBA 2H8PA 1OCWH 3ARGB 4PMFA 5D5ME 3GF8A 1F13A 2OZ4L 3V4UL 4BGDA 1BV8A 4CVXA 4W9KC 2J71A 4DP8X 2J12B 1G9NC 5EU4B 4A2HA 4FNSA 5EN3A 4FQCH 3ZR6A 5F96L 4KO7A 2WY3B 4Y1SA 1G7PB 2Y06H 3MUY1 3VVKA 4PJXF 1CL7I 1AGEA 1FGVL 4BXVA 1EAPB 1K9TA 2G3ZA 2VDKL 1KB5A 4N5ED 2CNZA 4ZYKA 1MWAH 5CSZA 5JXEC 2W9LA 3UZCA 3V8OA 2YD5A 4JCLA 3G9VA 1A66A 4P4KB 3QORD 4G1EA 4H25B 2O6CA 4XBGB 1KF9B 3O4LD 2BSCA 4O4YH 1M6UA 1GZPB 5CKAA 4LCUB 2YBGA 1HESA 1S7VB 3H3PL 3RGVB 4KJQD 3QBTB 4WI7A 4MA8H 4NO0A 1M0MA 4CN4A 5IT2L 3CXFA 4MWFA 2W0LA 2E6QA 3BEVB 3CDCA 1UM4L 3EGDA 3SKMA 3O81A 1JGIA 1JNNL 1DSWA 3V0FA 4PQXA 4PJ9C 4Z1PA 3L5WB 3DPDA 2E7CA 4P3WA 3HAQA 5CD3B 5IM7A 1CLZH 4M1GL 1ZS2A 4G80B 3U6XS 1F18A 2OXHB 5DZVA 1CU4H 3L3JA 4MD1A 2JXMA 3W57A 3IFLL 4BWUA 4AMXA 3RZCD 3QVAA 1ZVNA 4NUJB 1AXIB 3O4LE 3QWQB 3VXNB 1QEXA 2P52A 3ZHDA 5ICZA 4EOWH 5IMMA 3GSRB 4FQ2L 4Y8AA 4D9QD 4G6MH 4RMTA 1CD1B 2B14A 1JZHA 2PYFB 3JVGA 4WK4B 1VGEH 3WFDH 2RCSH 3WCYA 1SOQA 3NTCH 2XWBB 2PW1B 3ISRA 3RWCB 1EH9A 3RX7A 1A3QA 4NQSA 3V2AR 3QDJA 5ID0B 3DMMC 4M6NH 5GJSH 2WUBL 1DUYA 4PW4A 4KK5C 3C09B 1M7IB 1E5BA 1B2WH 1S5HB 1C5DB 1ETZA 4L8SA 4Y16B 5HHQB 2ZCKL 4RSYA 2PTTA 4AYID 3UBXG 3BQUC 2ZNWA 4HJ0C 1A7RH 4JRLA 3K80A 2NZIA 2W81C 1FE8H 4HFWA 2X4OA 2ZX7A 2WOBA 1F4XL 4DUVA 2LFGA 3C9MA 2W0FB 3PAYA 4LXFA 4XVSH 2I69A 2VABB 4S0SD 5I82A 2W94A 3FFCD 4AGLA 2D7MA 4I4WB 2EE2A 2NY1C 2OSXA 3WTWA 2R1XB 1FNHA 1BDYA 3PL6A 3V52H 5FS5A 2KS9A 2PW2A 1KIPA 2IQ9L 2E59A 4ELMA 2WHVA 3MLSL 4HDIB 3V5DA 3TF4A 1Y6NR 2VAJA 4QRPD 2E5EA 3UG4A 4IM8A 5E70A 1DEDA 4ZUTB 5LXGL 4HFUL 2ODIA 2FJGB 1AGFA 2IAND 3G04A 4QTFA 4FLHA 2J8UE 3W2DL 3JWNC 5DEFA 2GJ6A 1IGTA 1GSKA 5HI5D 3QRFM 2FBRA 1R3HA 3MHZA 4I0CC 3JT0A 4FJZA 4GP4B 5DJXA 3SGEI 3LPWA 4IRSB 4F15B 4ZW6A 2OCFD 3QUGA 2YAFA 3EO0B 4JUTA 1TJHL 3QDCA 4NKOB 5L4FA 3BSGA 2QSTA 4OZHB 4PRIB 2NX5E 2ARJQ 4M8QB 3JV4A 1C16A 5C8JA 1J5IA 3VJ6B 2IANE 1GZMA 4Y2OB 1QABA 3IRPX 1IW9A 4PGEA 4YLCA 4ZS6C 3VXMD 2VLKE 4PGDB 3D4SA 4LNRB 5D1ZB 4NO3B 2X53A 3PUUA 5T5FA 1NIDA 1VB9A 2YHGA 3DETC 5CU5A 5FKPA 4QWWD 3CFBB 4OZ4B 3WY2A 2WC7A 3AAZB 3WMPA 4N2KA 2FGWH 3QDAA 4ODHL 1ZLEA 2FE0A 2QKIB 3IJ9A 2C4FU 2CLRA 1MAKA 3HE6B 1KXTB 4KKLD 1KGUA 1BVKA 1NWOA 1S7RA 2EKJA 2XQYG 1DQLH 4HIHA 4AGQA 4Q6IC 3D06A 2I27N 1N2RB 3MV7A 2JAFA 1UVQB 4M9OA 4QRRD 2UUDK 2P5WE 1YN6A 1MCWM 5DRXA 2ORBL 5IVOA 2QV4A 1MLCB 3MCLH 2B15A 1KIUB 4GMSL 4CBPA 1VSCA 1B3JA 1SVBA 3V0VB 4OJCA 1GAFH 5DVMA 5I1DB 2DLHA 4MJJA 1K6QL 3HVDA 1TYRA 3PP4L 4WWPA 4BZ2H 4U0RC 1M1XB 4ZZKA 1RY7B 3VD3A 3I9IA 1JI2A 3LAFA 4HXAH 1KEML 3LB6C 1HHKB 2CE6A 5DMJB 5I1CL 4M6AA 4NKDB 1KBPA 1MLBB 5BQDA 5CZXC 2WBJD 2AERT 1A3RH 1NGXB 4S1DC 3TBCA 3FT4A 1NCIA 2WD0A 2IMMA 3G5VB 1K3ZA 4JHUA 3X11B 5J12C 4BUHA 2VRAA 1BVZA 5B0WA 4EUPB 2XXFA 3VI3B 1L6PA 3A6CH 2JJSC 3HG1D 3O9WA 3ZQWA 3QFJB 4M6OH 3IJSA 4OV6F 3BQVA 4X7TA 1LK3H 1UJTA 4NBZB 1ZXQA 3MRMA 1XCXA 5I76A 3F7YB 3IJYB 4M3KB 5KJ4A 2UY7B 3EZJB 4BZ2A 4ELME 4W6XB 1SQ2N 5EU5A 3W9EB 1FYTD 4DGVH 5C2BL 3DRQA 4MZIA 4KO9A 2Y7LA 4DH2A 4MA1C 3NCJH 4G9FD 4U1KB 4IEFA 5SX5H 4WI0A 3G5ZB 3OKDA 5JOPD 4FGMA 4NO2A 1FVEB 1GKEA 4K94H 4M7ZC 3QXDA 1XCWA 5CGMA 1C7SA 4N68A 5GPRA 4FYRA 1E12A 4NDMA 1AVAA 3Q5OA 4JY5H 1ZGLA 4WJ5A 2PEDA 3B7YA 3HG1E 4K07A 4XMPL 2GITA 3NA4A 4NQCA 4PJCA 3TEXA 1E67A 4XC1L 3BQUA 2R0ZL 2PPDA 1EX0A 4M8UA 3UBXA 1FNGA 1YVLA 2AK4B 3VWKD 4YSUA 3B83A 4YHIB 3KPNA 5CP7B 3KLSA 1XL6A 4XCCH 4H8WC 2Y7MA 4C4BA 3VWJA 1R3KB 2DWEB 1FVDB 1F3DJ 5J6SA 4C59B 1FH2A 4P2RD 1DQDH 1FQ9C 4M7LL 5I0WA 2P49B 3SYAA 2V5SA 3QXWA 1U8LB 2B3IA 1CTOA 1L9RA 1UOKA 2BP5M 1NL0L 4M5SA 2D7TH 1NCDL 3BP7A 3KGRA 1D7FA 3NBNA 4LSSH 2R1WA 3H55A 4B41A 2YQ2A 3X12B 4QGYA 3MRRA 2B39A 5INDA 2K45A 3HPLB 4GH7B 5F89B 4KVCH 2AXJA 2JTDA 1H3WM 3CC5A 3CLFH 4MJIA 1PZAA 4OZGA 1MRCL 1HXYA 3RAJL 5D5MF 2Y5QA 4G8AC 4M7KH 4C8XA 5HHQA 1RZKL 4RGMC 4YHYB 1IIKA 1T7ZA 1M6OA 3EBHA 2WLYA 3WO4C 2FJFB 3Q44A 2X4UA 3Q43A 4KXDA 1VACB 5IHBA 5IVXB 3C60B 2P24B 3SDCD 5F6IB 1T4KB 1AP9A 4IOIB 3IMTA 1AP2B 4Z76A 3VD0A 2EACA 2AJUH 3VCLB 2N1TE 3KPOB 5DJAA 1KUMA 5CSGA 4MNGB 5CR8A 5DQ9B 5IFJB 3C9NA 1HZHH 3NQIA 3C5ZC 5DJDA 2XNAA 3HNTH 3QEGL 4LBEB 5GGRB 2N56A 2YD0A 2IG2L 4X98A 3CPUA 4IKJA 3D48R 4XPBL 5DSCB 2WNGA 1RZFL 4P57B 1J8RA 4OLYL 1QACA 4R8WH 1M7UA 3AG2B 1RZIA 1TU2A 2F19H 4ZOBA 3HC3H 1NFAA 1K5NA 2YPVH 3I75B 2TSAA 2ALWA 1IBHA 1BA9A 3GXTA 1BXXA 2GUYA 3DGDA 3T77B 2XFGB 5DZAA 3VFGH 4D2NA 1SMDA 4Q6IA 2XQYA 3OLEA 1A5FL 4P0DA 3ZKQD 1QTSA 4LF3B 4LLYA 1SXAA 5GHWH 3K7UA 4ZMLA 4WI2A 3LTVA 4HJIA 5GS0H 3LHAA 4P99A 4EI6B 1VJMA 4K23H 5DZJA 4M4RA 2O61A 2VDRH 4PJIE 1SJMA 4KH2A 2HLFC 3LZLA 2JKNA 1U2YA 4BFBD 3S36X 2CAKA 1KCRH 3CU7A 3QHFH 1CDYA 3M1BA 2IAAC 5CMAB 5DVOA 3NACL 2R4SH 4X5LA 3Q05A 1CDBA 4L48A 1WPCA 4PJ8B 3G6DL 1DJSA 2YPLA 5JPNC 4LKCB 4FMFA 2W59A 4J3OH 4TSBH 1FO0L 2YMTA 2APFA 1WLHA 3C6EA 4YBLC 5IHZA 4K7PY 2WUCL 5C97A 1WH0A 2AZUA 4KMTL 2MOGA 3MLRH 2QGCA 4WNQB 1UEMA 2DH2A 3OJDA 5G5DA 2F53A 5LGHL 2AABL 1CWVA 4Y2DB 4XN5A 3L9RB 4WU5A 4Y4HC 5HVHC 4IJ3B 1GUEA 1P5UC 1QTYT 2D7PA 4JFDB 1I3RA 3G5XB 2NY2C 1SBSL 2UYLA 1DVTA 2QQKL 2YKLH 2HJLA 4F37F 5EA0H 1MCKA 1T2JA 4YDVB 1QRNB 3B2DC 5DD6B 3BKML 4U6XB 4XE5B 2C1OB 1TQCC 1YEFH 3MROA 5A16B 4FCAA 5EBWB 3VFSB 1WBZB 3QT2A 4R2GD 4JPWL 4TSCH 4U1JB 2R51A 5BXFB 4RA0C 2IWKA 4WJKB 3DVIA 2FX9H 4LCYA 4V1DB 2I26N 1YMMB 2WJ7A 3D85B 4N2GA 3EYSH 4ZX6A 3IF1A 4LSPL 3ZDYB 1CGWA 3VRLE 2N4IA 4FLQA 3RDTB 2CDFB 3GMLB 3VD7A 3KEHA 3A67H 4J6RL 4AGNA 1K3IA 3MCG1 3DV4A 3Q9PA 4QD2E 2IIJA 5I2IB 4WCYH 4ICXA 4AMKH 2GABA 2J8UF 2IOMA 3WLWD 1HX0A 4DETA 5AQ0A 5KSUA 2EXWC 4IGBD 5JW4Q 3WKYA 4RCAA 1J8KA 7PAZA 2XV2A 3MV8E 3FO0L 2J1YA 3GMNB 3ILPB 1XGQA 2BY3A 3ZQ9A 3FHAA 5I5RA 4JG0H 4AXWB 4TPRH 4OCLC 4TUOB 5IB3A 1HH6B 4ACPA 1N5YL 2F9BT 2YLHA 3AS2A 4IRJC 3SDDC 5SV4A 4OQ1A 4J3BA 4YXHL 3B7TA 5CFHA 3B2XA 3P3UA 2CO3A 2JB5H 3FH7A 3L4CA 1CFTB 3GO1H 4Y5VC 2DWSA 3QEUB 4M43H 5CGYD 3DARA 5CEYA 1WITA 4PM1A 1YLBB 5F7AA 1F5WA 1YEKL 5D1QE 5B35A 4QHLA 1JV2B 2Y0SA 4L4VB 3EJJX 5GZOC 3US1A 4LCWA 2Q8AL 4NXKA 2ZCHH 3NSXA 4KRMB 4WGVB 5CCKL 1W72A 1OD9A 5K39B 4FFYH 4EVNB 5IMKB 1QFWM 2WLLB 3KCPA 2FO4A 3SO3C 2V9QA 4XO5A 1EO8L 1NBYA 5F6HJ 5KVFL 3L17A 4YFLF 3IDUA 5FF6A 2H4EA 4HUUA 3QG6B 1T1ZB 5D7LD 3SDYL 3KVPA 4AZ8B 1FZMA 4PLOB 4HS3A 4UQAA 3T0VA 4POZC 3B5TA 3DOIA 4F1SA 4EIUA 3C5ZA 1MRFH 2LAAA 1AE6L 5C08D 1V7NH 2DS4A 4Z8FL 2F53E 5GRJL 3AYNA 4F24A 1AO7D 2K4AA 2CRZA 5FO7B 1L5GA 3HG4A 3BWUC 3KE0A 3BT0A 3OMAB 4U3CA 5A6LA 3D2UD 2HRHA 4FFYA 4BUGA 4ZAKD 3A4DA 2XFXA 2CXKA 2ITDB 1VCAA 1JP5A 1KEGH 2WXGA 1DBML 3SGDI 3NABL 2PABA 3LZOA 3UPCA 4H44C 5B7FA 2XUWA 1I1AA 4I13B 1MFNA 3NZ8B 5C08E 2ZIYA 1XSKA 3SPVB 3MO1B 2J6EL 1XT5A 5JR1H 2NLJB 3SDAD 1AO7E 1HWHB 1OGAB 4GLRH 4ELMF 1F11B 4J3UA 3MRHB 3NCMA 3RY5A 4DK3A 3ULUL 4PRNA 3H0TA 1QFWL 3AVEA 5JPNA 1EFQA 4HKBB 4JKVA 3LDBB 4PB0L 3GHEH 3APNA 3MQIA 1G7LA 4P23C 2V2TA 3QUMB 5KSAB 1OPOA 1OAKH 4X99A 3TO2A 1Q1JH 2BIQA 2NNFA 2NQ3A 3KBPA 4DAGL 4G42B 3LXCA 2NYKA 1L6XA 1ZSHA 4PRDA 1JZEA 4MXVF 4KLYA 4XB7A 4Y4HA 1T21B 1UD6A 1KACB 2CO7B 5BZWB 3HUJA 3TT1H 1TMQA 1U36A 3P0GA 2BRDA 1CFSA 4PVMA 1IGMH 4PWFA 1KPRA 4I77L 5CUSH 4WHDA 4N9GA 1SN0A 5IV2B 4OCWH 1S9KC 1WWAX 1BOYA 4J12A 1T1XB 4PV9A 1YPZB 3WN5A 5AAMC 4U1GC 1DQQA 1AZZC 4B0MM 3T6ZA 2C9QA 4X5XA 3TOPA 3RB5A 5AOLA 1U8HB 5F7EL 3K6DA 1CL7L 3QAZC 1WFMA 3D0LB 4HOXA 4U7KA 4QF1A 1CK0L 3PJSA 5HYJD 2KSBA 1EDQA 5H2IA 4XI5C 1EFXB 3X3GL 3CK0L 3LZRA 1FVCA 3EH5B 2Z7UA 1UXSB 3WNOA 2E4TA 5IUSA 1QUNA 1WHOA 3FQTB 3JZYA 1V7ML 4JHAH 4MQSB 4E9SA 2FUQA 2J4WL 4NUMA 1PZ2A 4YGVB 4FHKA 3HI1B 4F91B 3HC0A 3A6BL 4H0LC 4JPVH 5ANME 3GXUB 5E2WL 4F7MA 4PLJD 4WW2B 2KLSA 5AB0A 2EADA 5LGKA 2EQDA 4AYDC 1UACL 2D8KA 5KYYA 2NUPB 3UH8A 1BIIB 3U7WL 4AC4A 1QWHA 4ZXBD 5J3HD 5SWQB 5GGUA 1OGTB 4R4BA 4CUCA 2N3JA 1F6LL 1ZAGA 2X70A 5IQMA 5EH1A 5LVEA 3DGGA 3TVMC 4IRJA 2EH8H 4N2AA 1FPTH 2VDOH 5FHAH 3SHSA 4F5CE 3FULA 4NERA 3MRLB 5FECA 3QCTH 5C7ZA 4A1RA 4HMDA 1UB6A 3HHMA 2IPKB 4KI5E 4LGRB 4KX8A 4DP1X 4YBQC 5I6NA 4HPYH 4Y5VA 1RJCA 2DQJL 1UC6A 2ENQA 2Z34A 1GGIH 4GT7A 4PJDF 1EEUA 3C5XA 5JIQA 4ZPTA 2HFGL 3OR6B 5KG9B 5LGYA 2K6YA 2GSIB 3DSFH 2OP4H 5FGBA 3TPKA 4XO3A 1KGJA 4LGPB 2WWNA 1P6FA 3GT6A 3KYMA 1JWMA 5KBNC 3BKYH 3U7AA 1XXDC 4AQ1A 2FNWA 3P3TA 4TTGA 3Q3GB 2B9BA 3RG1C 3ZTNL 3CDYA 3TN0D 3DC0A 1KBGH 1TZGH 2RH1A 2YRZA 1KXHA 2WV3A 1FC2D 4FQXB 1IC4H 4PJIF 4OF8A 4JFFB 4AVJA 3FTWA 4AW7A 3KBHE 4G7YL 5HJDA 4GBXC 4IRZH 1SUJA 3CZJA 3MPCA 3WD5H 4B27A 3Q2CA 2DICA 1A7QL 2HMID 1G6RA 3S5ZA 1S9VB 1FDLH 2YRLA 1PG7W 2H2SC 2NUTA 4NM8H 3TX4A 1UJ3C 2EEDA 3LX9A 4PJGB 5E4AA 3FTUA 3S37H 3IKCB 3KS0J 1JGLL 1EXHA 4MNHB 2EC8A 1TVHB 2Y1AA 3WKML 3X1EA 1U8JB 1OE2A 3ZMRA 3QYMA 3BUYA 3QQ4A 4Q14A 4Z95H 1I4FA 1D5MA 1X0SA 1JCKA 1W8NA 2A6IB 3ABZA 4KX7A 2ZAGA 4MGXA 5H94A 1NC2A 1GGBL 2X12A 4AEEA 2BWQA 1N0LB 3W0WA 3OAYH 2RR3A 5DJ0A 3MOBH 5CAYB 3WE1A 2ZX5A 1ACYL 5EZOL 4AJ0A 5H2HA 3GTTA 1KWKA 4HOWA 3CFKA 3NEXA 2KHAA 1FN4B 1CFVH 1WISA 4XB8A 3FT2A 4ZQKB 4FL4C 3TBSB 5AD0B 1T1WB 1E4HA 5FOBA 4WF7A 3JWDH 4GAYA 3WNIA 1K72A 3VRLF 1NCAH 4XMLL 1LWRA 3JWOH 4GQZA 5TF1L 1OSPL 1ZXKA 3RWDA 4PJBB 2W07B 3HCVB 4NBXB 4P59H 2ZOLB 4W4NA 4HZLA 5JOEA 2CUMA 1GIGL 1U42A 2CDGB 3NIGE 1PAMA 5E9DA 3ODUA 3K6IA 3Q2LA 5D7JA 3QXAA 3F7VB 5H2LA 3AABA 7FABH 3ZW3A 1TN5A 3W38A 4GRLC 2P3YA 4GSRA 5H35B 2C7UA 1FBIH 1EJOH 2EECA 4I9WD 5E8OB 3RWFA 2XJLA 3GRGA 1P7QB 3C6LB 3K4DA 5AAMA 1CGXA 1GYVA 2PO6A 4UOW0 1NAML 4YHLL 3VG9C 4O2EB 1JGDA 5I1GL 4S2SA 4CC4C 4Y2NA 2P4AB 3FU0A 2NMSA 5MEND 5KVGL 4CNIA 1YJDL 4PRHD 2WLHA 3PU7A 1QLEH 3LEVH 1IU1A 2VZ1A 5BMFH 1S9YB 1XVSA 5GGSB 1OP3K 4UTAL 5L0QC 1PLGL 4BELD 4EZLA 4XWGL 1QSFB 2NY0B 3O6LL 4PLKD 3PHOB 4UAOC 2GJJA 4PWJA 1KCSL 4XNZC 3DUHA 5DO2D 4JS7A 4RGOL 1A7PH 4JRYE 5SWZA 3D30A 2CJTA 3LZQA 1J10A 3ZKMD 4C83A 3CQQA 2YUXA 3FUKA 4XRCB 1G7HB 1YAIA 4YHKH 1MCPH 1RIUH 3UTTA 3GRBA 5GS1C 3V6OC 4FNQA 4O51A 3LJ3A 1G87A 5C9JA 2CGZA 4OJYA 2VZ3A 1HSAA 4CC0A 4J1UA 1XBDA 1CLOL 4PBWD 4MFHA 25C8H 1YY8A 1INDH 3TVMA 2YQBA 2W95A 3NSYA 4JHWL 3T65A 3BZ5A 5SX4H 1TLKA 3HE7C 3T6VA 4NSKA 1QPXA 3GSQB 1MVUB 3LVEA 4KQ4H 4PWEA 5C0ND 3ZK0A 5GQBA 5AVSB 5A7BA 5BV7C 5HHOE 2X4TA 4DZBB 5DQJA 1ZANL 2XIDA 3F8UB 3E3QC 2A6DA 2G60L 5I8KH 1D2OA 4B9KC 2PCYA 1ES0A 4X6BB 1SM3L 3SZ6A 1U8KA 1PEZA 1T0MB 3OKEA 5CN3A 2G9HA 3RIKA 5IY5B 1DZEA 5CJOL 4X5WB 1U8IB 1KN4L 4O2CB 1NC4D 3BSZA 5DS8B 5G2NA 3V9FA 4ABUA 4ODUA 2L8AA 4PJFA 3I6KA 4J7RA 4MS8C 3FT1A 5K33A 2HKHL 2EXSA 3IDXL 3R7RA 2ZPKL 3VXOA 1I82A 2VL5A 4B9PA 4DN4H 4GG6B 1J5DA 4F2MA 2IAMD 4J3OF 4WHCA 4K7FA 5IBTH 3FTSA 3ABGA 2HT4D 2XZCL 2ICWB 3ZE1E 2L7UA 1IC5H 1XGYL 3O4OC 3TH2T 4QHKI 3WE6A 3L5XH 4GBXA 3LNHA 4IJTA 3DBXB 4JHVA 5I1HH 4G83A 4PVNA 2AEPH 2WZPD 3U1SH 4I18B 4ONFL 4QRQA 1R3JB 5E5MB 4ANVA 4UIKH 1P84J 4CN1A 2VH5L 3FPYA 3LZFL 2VIRA 5D72H 4DGIL 5E9DE 3S5LG 2NCEA 2BHUA 5BR5A 1QHJA 3DROB 4HHAA 4JPIA 2DQIH 3QDMB 1GPOL 2ZONA 4MMXC 3KMDA 3NAAH 2X7LA 1AHWB 3QNZB 1W16A 2GW5A 1O6SB 5IZ7A 4ANKA 2YFNA 1U92B 2XXCB 4KUZL 4NBYB 4G5AA 4DGUA 3IRCA 2ESVB 4PP2B 5FYLL 4I1PA 5ACLA 2Y25A 3APFA 4UUJB 2IALA 4W93A 4X7FC 3T4AB 4G9DB 3H42L 1ZLUK 2F54A 1T83A 1XZ0A 2R9HD 1JPFA 4LPWA 3A3YB 3EBGA 4DTGL 4N0FA 2FUTA 2EDWA 3UTOA 4NJ9H 1P5VB 1AKJA 1S9XA 1GTFA 1GJUA 3ZRCC 2CHXA 3OV6A 5I8OH 5E08H 2GFBA 2DLFH 1LJMA 1HINL 2CO6A 3NA9L 2HVBA 2ZSVA 4OLXH 2ZF9A 3A47A 3AS3A 4NQDA 5EOCL 3DO3A 3SGKC 2KZBA 4BQCA 1FFRA 2BY1A 2ADJB 2VSKB 3I9PA 3Q5TA 3S8GB 4I2XB 4PH8A 4D0CB 5IREA 1SPDA 4GKOA 1IGYA 1MCBA 1JAEA 4N1CA 1NMBL 1ONQB 3UTTE 1GGYA 1LEIA 1QOKA 1X5FA 4JO5A 2CKBL 4L2YA 1ZD6A 4YMPA 4HH9B 4UILL 4GW5B 2CBMA 4ZFOL 5C09A 3K6OA 1CURA 3ZDZF 1CLYL 2M26A 3HFML 4IU2B 4JVPA 3RJDA 1D5ZB 3FYIB 3TV3L 1F8TH 3RURA 5E8EA 4GKNB 5C0CD 3REWA 3NGBC 3ARGA 5LDUA 1PEWA 3MLTB 3TA3B 1FNSL 3IDMB 3G6JB 3PY9A 1RIHH 1BOGB 2X5PA 1G9MC 4KJWC 1GA2A 4KI5F 3CSTA 4N5EC 5DD5H 4CVZB 1SVCP 3EOBB 1XZWA 4IS6B 1E6JL 1WSST 4OLUH 4MJ4A 1Z32X 5DFWH 1OALA 3QORC 1G7PA 1KWGA 4BWBA 4PJFE 1EZSA 4OFYD 4TQ8A 2P28B 3NCWA 3CBJB 2Q3XA 3BKCH 5CEZH 4R4FL 4F58L 1CI5A 1EAPA 4FEMA 1Q9OB 1J5HA 4F2ME 5ACZB 1SYSA 2N1KA 3BJ91 2AJYH 4KJQC 3TZVB 1MQ8A 2H32A 4HT1L 4P4KA 4DJMA 4RZCB 4XBGA 1MW1A 3BH9B 3RI5K 4DQOH 2XYBA 4MA7L 3QDGE 1MCLA 1GZPA 5DHYA 5FWQA 3DOSB 4LCUA 2CSPA 4TSAL 3RHWF 4Z7NE 1JJUA 1FL6A 3WTYA 3DLQR 1GYCA 1S7VA 1WQVT 5DFTA 3SYCA 3BJLA 3RGVA 3PGCB 3VXTB 2DDQL 1FCCA 5ACMA 3S48A 4CDHA 5FCUL 3D4GA 2Q8BH 3RZCC 3BEVA 1PVHA 4IB4A 1MI5D 4GI9A 1A6AB 2J1WA 2OXGB 2A9BA 2WGNB 4ISVB 3W56A 3L5WA 3WO3B 3WV0A 4EUPG 2HT2D 3E8VA 5CD3A 5FLVA 2OMTA 1LMIA 3PWLA 2YKKA 4YDKH 3WU1A 2R0WL 2BNRB 4U33A 1HHJB 4Y19A 1N19A 1V3KA 4YSOA 2LV4A 5DA0B 2AJXH 3HLKA 4NQEE 4C4UA 1VCBC 2A74C 5TGBB 2BVQB 4A7UA 3ULAB 1AR1D 2OL3B 1YQ2A 3DBSA 3QWNA 3QI9C 4X5QA 3D18B 4K8RL 1SVZA 3NY9A 1U8QA 2FSDA 2BNQA 5KYWB 1SHWA 2PW1A 1AQMA 2FVNA 4A2FA 3RWCA 4LOUC 2Z7ZA 3FPXA 1UFUA 1OAYL 1NIFA 1S9WB 2H0FA 3V0GA 1UD5A 3CPLB 4L0PB 2WXPA 2PP9A 1M7IA 2DQHH 5HJBA 1S5HA 1C5DA 3F6JA 3EDFA 2X89A 12E8H 4K55A 4TNVF 4XT1A 3WIAA 2RGSA 1AXTH 1ZK5A 1CF1A 1ZHNB 3ARPA 4FX5A 4YIQB 1S7QB 5C07D 1KJ2L 1CF8L 1Y1UA 1H3PH 3ZE2B 4LOVA 4BWWA 1XH3A 2PPEA 4E9XA 3CZSA 3EADA 4JG9A 3P0VL 4ONHB 3CDFA 1YUHA 2MQGA 5LNDA 3T0XA 4JPSA 5A45A 3IXAB 4CW1B 4Q52A 2D7NA 3S5LA 3LRHA 5I0YA 2FTAA 2ZYHA 5AOJA 1W9XA 1SEQL 1J8HB 2VABA 2XPGB 5I8EA 3LQMA 5HGAB 4DUXA 1TJIH 4HSCX 4MX7A 3NEEA 5F8RC 1G7IB 2N7BA 1WP6A 3UGUA 4GQRA 2PTVA 4AEFA 4HBQA 2R1XA 2D03H 4QUOA 5JQIB 4O9HL 1JK9A 2BRRH 1J11A 5HI5C 2OMVB 3BPOC 4HDIA 2L4OA 5KS9B 4X6EB 3V4PL 1EXUB 1G0YR 4FKEA 2KZWA 2FJGA 2GHWB 4ODSH 4MAYD 3LV3B 5EZIH 2QADB 2HKFH 3E2HC 2J72A 1P4IL 4Y1AB 4DGWC 1IM3A 2O93L 2VITB 3KLAA 4NAQA 1NEUA 2B1AL 3DRTA 3EO0A 4HAGA 2FWLB 1E3ZA 4NKOA 4L8BB 5AOZA 3IXTB 4HCRH 5E1GA 4DO5A 1MIEH 2DIJA 2WIIB 4UZGA 3MR9B 3RTQD 3ALWA 4GS7B 5AVTB 4XPFL 4QWWC 3M86A 4M8QA 4GP5B 2IGFH 3VJ6A 3TO4D 3ISYA 5JO5A 3RILA 4TNFA 2K0RA 2VDLB 4FQLL 4PGDA 4BRJA 5J6HB 3GSVB 4KKLC 1WBYA 4N8CH 3C2SA 5I8CB 2IJ0C 4NO3A 2H47C 2NXZB 4AKQA 2WKOF 3KPSD 4OZ4A 3B2UD 1HTYA 5DJCB 5CEZE 1I8UA 1T20B 2NNCA 4GYBA 5BQ7B 1NCJA 3HE6A 3PXLA 1A4CA 1BZ9B 5CXPA 3DURA 4XOEA 3HB3D 2Y6TE 5ID1B 3QXUA 2NSQA 1KPVA 2A77H 3PV6A 1PY9A 1U95A 1IT9H 4P5KB 3VYOA 2OMZB 4HCRA 4ELKB 1UVQA 2FSEB 5D71H 5HDQL 3MA9H 2VNCA 5K9JL 5E2UL 5LG6A 5E8NA 2AAAA 2K7QA 3OXSB 5D1XD 3U0PA 1WA2X 5F9AC 3GMPB 3FQRA 3M6DA 4DF9A 1AJ7L 1I8IA 4JRXB 4WTQA 3EH1A 2WBJC 4OI8A 1ASQA 1M1XA 1NSNL 2AXHA 3CSGA 5IOKA 5IR1B 1JZDC 5KSVB 1KCLA 3TCLA 5IF0A 3VFPB 2GTWA 1K8IB 5JYMA 1DQTA 1HHKA 4EZMA 1HOCB 3T8VA 2BSTB 4H20H 3T1FB 3ZE1F 4NKDA 1MLBA 2G5RA 2DQTH 5JQHC 4RDQG 2XN0A 3O6KL 1RZJC 4WFHD 4YX2L 4PGBA 3RZCA 2XPYA 1NGXA 2XA8L 1IAOB 4NHUB 3G5VA 3E6HA 4J8QA 3X11A 5CN1A 3FB5B 3IJEA 4EUPA 3GPEA 1P4LB 4GSUA 5FO9B 2CIIA 3FO9A 1F88A 5G4OA 3KH3A 3QO0A 5IGXL 4M7JH 3V0DA 1JF5A 3ZQXA 3QFJA 3CAPA 3C08L 2R29L 4KHXH 3BUDA 5D6DA 2A74A 4AG4H 4EIGB 2OTPA 5AKSA 3UJJL 1T5XB 5AW0B 3NN8B 3F7YA 4HWZA 1QLFA 2GEEA 2UY7A 5BPPA 3SN6R 2VZUA 4YOKA 2F8XC 1BFOA 2PP8A 3GJEB 4YO0A 3W9EA 2WPGA 3AWFA 2H1LM 3FU3A 2WYHA 3K8LA 1DBKL 2VISB 3G5ZA 1B9KA 5BRPA 3KNBB 3CFQA 3I3DA 1FVEA 1EZVX 4NCC2 1HDMB 1U9KA 3VWKC 1A6VH 4NZUH 1UH3A 3PWNB 4PWIA 4X9YA 3BZDA 4EPSA 5L7XH 2H0EA 2XZAL 4K5OA 2BHYA 1AGBA 4RMQA 4XO9A 4KY2A 3AMKA 2EDYA 4GUQA 2HH0H 1I8LC 3H3KA 4HWBH 4LLQA 3L9BA 2CU9A 4WSKA 5AX0A 2Z3FA 3NH7L 3S8FB 3SCMB 4AKOA 3DIVA 5KVDH 1DJIA 4AW4A 5HGHB 3FUNA 1AD0B 2YGVA 5C7XH 3SGJC 3MVSA 1QW8A 4NWTL 4OZHE 4ZFGH 1ID5I 1PJWA 3CSFA 3FFCA 3GC3A 4PRIE 5CP7A 3O3EA 1CGSL 1INQB 1KN2L 2DWEA 1MF2L 2XBDA 5CJBA 1FVDA 4HMCA 5JHLH 1CS6A 5L2KB 1OAUL 3V0AC 1P7BA 2PPAA 4CU8A 4WU7B 4H88H 1KB3A 1U8LA 4JDTL 1BZ7B 1J9CT 5KVFE 4QRPA 3TYFB 3LRSB 4UV4L 1JVLA 3GQFA 1KY7A 2YOAA 2CQVA 2V5TA 4WI3A 1X5ZA 4OSUH 4KKRA 3VXSB 1CUOA 5I26A 2YJLA 2C9VA 5K9KB 4J3TA 1N0XL 2PF6A 4HUVB 3BX7C 4HWBA 1QNZL 2E75C 1PD0A 1RL1A 5F89A 4O02B 3ZTEA 2YD4A 3L2MA 3SDCC 1X7SA 3GSXB 5HHMB 3GK8H 3PNRB 3II1A 3UGXA 3MRCA 2ITEA 3ULUD 1KCVL 3FOMB 4HGWA 5JHLA 4XTLA 2FJFA 1GW0A 3L3DB 5FB8A 5IVXA 2Z8WC 1XF4A 5AKTA 5DHEA 1A2YB 2R2HA 1IBZA 1T4KA 2XRAH 4LRNL 3VNZA 3QQXA 4A6YA 3FF7A 4LLDB 1HQ4A 4XCNB 3VCLA 1YRKA 2XY1A 3LSOB 3UAEA 9CGTA 3QWOB 5DEGA 1B88A 5C0RL 2F5BH 1PZ3A 4G8GB 1X4XA 5CGTA 1DQKA 4MNGA 3BGFB 1QBBA 4IMLB 3RPIB 1WUNT 3Q6GL 3FSZA 1L7TH 2VDPB 2YD7A 4WWKB 1HL5A 1IGJB 4LBEA 3DX7A 5GGRA 4G8FB 5DSCA 5KANI 4Z7NF 3ULUE 2NT0A 2KMWA 1MJ7H 3OZKA 3QJUB 2DQCH 3KCWA 4QRRA 1HIML 1I9JL 1VEPA 2I9TA 1BFSA 2EDJA 2WXLA 5MERA 3VI3E 1AIZA 2P1YA 1QR1A 3I75A 1ID2A 2YC1B 3LHPL 3F83A 3UX9B 1RHFA 4E42B 4HUXB 3P4MA 2BS8A 3T77A 5EEVA 4XN8A 3KLQA 2AK4D 4ZO9A 2R23A 1LNUA 4Q6KA 4WUKH 1PZ5B 2ZAIA 3HC4H 4LCIL 3E38A 4Z7WA 1RERA 2JCCF 3SBWC 1WZMA 2EJ1A 4TNWF 3PGDB 3QS2A 3EG9B 5DJYB 5E9AA 4EI6A 1ZHBA 4R4ND 2KSYA 3OKYA 1DFBH 2DWTA 3SKNB 1CGTA 4NC0B 1CGVA 5AZEH 4RIRA 3Q0HA 1L6ZA 2ED7A 3D3VB 4LDOA 5LAXB 3UZVA 2E47A 3LXBA 1BWMA 1BJ1H 5LBVA 3UXFA 2IO5A 3EHBD 4ICWA 4LKCA 3GTNA 5AWNH 2BJML 3VFNB 1PY0A 2W5PA 2MH4A 4BZ1L 1NFDB 5T8IA 5KTEH 2AK4E 1UURA 4YAQB 3TWYA 4N6HA 5EU3B 4XNXH 3QA3B 2W38A 4Y1TA 3PP3H 1N26A 4EN3D 4UM9D 1YYLL 3WMQA 4JFDA 5D2LB 3ECBB 5CIPB 3L08A 5GS2H 1A7NL 4R2GC 1FYTA 2FECI 1F02I 3D07A 3SJVB 1R47A 4MD2A 3QARA 1MRDL 2VR7A 3HRZB 4PN6A 4G9FA 4TLUA 4YC2C 3CH1B 1K8DB 3RBGA 1AACA 4U6YB 4GBRA 4P2OD 3VFTA 1HE7A 2JJTC 5LCVA 2C1OA 3IMVA 4LHUB 4LPCA 2MCPL 3MJ7B 5CHNA 1YC7A 5EBWA 1WBZA 2NNAB 2VN7A 3DYOA 1HXMB 4MA3A 4U1SB 4KNUA 3GSNL 5GJTL 4MD5B 1P8HA 5KVDE 3EH2A 4E9WA 5ALCH 1YMMA 4HWUA 1LO4L 5BCAA 3WLWC 2BP3A 5E94B 1KIRA 1KZYA 4IGBC 3VWKA 3GMLA 3ARXA 1YEGL 2QPUA 2X2YA 3FO2B 4JFED 4WI6A 4AGPA 3BFQG 4DN3L 2J5WA 4F93B 5TE6L 1ZA3A 2G5BA 4OJEH 2CUAA 1EO7A 3C2AH 3SGJA 4B3EA 5K9QG 3IVKB 4L1SA 1JPSL 4LDEB 2G75B 2JKJA 5AVQB 3F00A 3GEWB 1XGRB 4H4NA 4KAQL 4MNGE 3T0DA 4RBPH 3WN6A 1U91B 1J1XL 1PSKH 1TETL 3OM3B 1HH6A 5CGYC 1F97A 2DYPB 3NFNB 4QHNA 1CBVH 2AZAA 4NQVB 2WTPA 4B3VA 1QR4A 1S7UA 2P5ED 4HJEA 1CFTA 5A2FA 4QRAA 2AFNA 1O6TA 4NC1E 5EF3A 1RK1A 4HWLA 1DJWA 4KZCA 4MD0B 4HU2A 2D31A 5TE4H 5IW1B 4DKFH 5INCB 5AOKA 4GEJA 3PDOB 1FHGA 2ENYA 3N1MC 1N12A 4AL8H 1JV2A 1YNTB 5LUMA 4PBXA 2FQDA 3VHZA 3IDJB 3QIUD 5TH2B 1I1YA 1FJ1B 3EOTL 4BQ8A 2NTWA 4MMYB 3IU4H 1S52A 1VLXA 1MJUH 5FGCB 4EVNA 3DIFB 3I6GA 4MDIB 2WLLA 1O7VA 4G5ZL 1WUZA 3NFSL 2MMXA 2AK1L 1QRND 2UY6A 4ZW7A 1WWBX 3TPUA 2UXTA 5I19H 3FQYA 3GMQA 4AZ8A 5IFHH 1FRGH 1X9QA 4OFDA 4L8DB 4KRLB 4HIXH 3VTTA 4HC1H 4RMSA 3T8MA 4F1ZA 2XWTA 1TEGA 4ZAKC 2QZQA 3FQXB 3MKKA 5A2KH 1X5AA 5E5LA 5KOVC 2Q7YB 4PRPB 2YAEA 1USQA 4JFDE 4L3AA 2P9RA 3GLAA 4P2AA 2Y5TB 1MHPL 4ZTPH 2DIBA 1IB5A 4I87A 5K93A 4MQXD 1AI1H 5FV1L 1D9KD 1PDKA 3MTRA 4OF7A 3QUMH 1QRNE 5C0IA 2X6VA 3VX0A 3QBGA 2X87A 2JKIS 2ITDA 5HGDA 2IDQA 1W6WA 3JZ7A 1K2DA 5EWIH 3SDAC 4ZMAT 3GSWA 3O45B 1CDHA 1XX9C 2IBZX 1FORH 1UD2A 3SBWA 1T03L 3RWIB 5B7MA 5I6MA 5JHAA 3VW7A 2YCYA 5G4MA 4V1DE 1YMME 2JF1A 1TNMA 3MO1A 4OM1L 2H2PD 1N67A 4YDLC 3VFOB 4JCMA 3ZDYE 2JB6B 1IVTA 1RPQA 3KWXA 3MRHA 4UINL 1AKPA 4GO6B 5I0VA 3F58L 2J1ZA 4MRBA 2ZCLL 5AVZB 3VXUD 4HKBA 3QR0A 3QH3A 1LHZA 1KFAL 4TV3A 4FI6A 4ETYA 2EDLA 2HVKA 3ASWA 2HWZH 4I3RH 1DBBL 3ETBJ 5E8PB 2JCWA 4N2OA 1YEDB 3N41B 4FFZL 1CBJA 1OD7A 1IM9D 2OULB 1ZT1A 2YZ1A 1MFBH 3MBWB 2NTUA 1A4JB 1TVBB 4UQ2B 4M7LT 1T21A 1H9DA 2VN3A 4NOFA 4OZHF 2CO7A 1NBVL 4RMWA 5BZWA 2VQTA 3U9PH 3INUH 4X5PA 4XXCC 1E50A 1ODAA 1YSOA 1NKOA 2ZOOA 1CD9B 3BD3A 4X4KA 5EC2B 1MIMH 1F4WH 4PJEB 3VGAC 3L3HB 5KW9L 1IGCL 1YPZA 4N9OB 5FX3A 2DQ6A 4N2IA 1IILE 4TULL 1P0SE 3L3GB 3L3OB 2VC2B 2ADGB 5F0MB 3P69A 5I1KH 1WZ1L 4I48B 4L4VE 1MHEA 2XQBH 4M5YH 2UXGA 4JM4H 5D4IA 4PLJC 4O2FB 1IFGA 4LFHD 1JCVA 3FU6A 1UXSA 5JIMA 1J05B 3VVVA 5LN4A 3E6FB 1T7WA 2CR3A 1OB0A 2ZP8A 3FQTA 4QAWA 2AXWA 3NIDB 4MQSA 2BPBA 4U4IA 4ZXBC 4HU8A 5J3HC 3HI1A 3POCA 1U8MA 4HWEL 2VDNB 4NNYA 2CLZB 2YMXL 2OTWA 1EEZB 4YE0A 1JK8B 1JTTA 1BF5A 3CXDH 1ZWIA 5IJKA 4LLAA 1QYGH 2NDGA 1L9NA 1S7SB 3KLKA 4JO3L 4DEWA 5I6XB 5I71C 3LH2H 2VXQH 2IQAA 1OGTA 1CD8A 3A7KA 2KT6A 3HEIB 1MNUH 2CCLA 1MFEL 3N1GC 1FLRL 3NOIA 3WIHL 2DTSA 4ONOA 3MRLA 3ATBA 1E43A 2GKIA 3SQOL 5FYLD 2IPKA 3GBML 1Y6KR 1A6UH 2FX8H 4XO4A 3MJ9H 2ENJA 3IFNH 4FYSA 4HBCL 1IAMA 5CJXC 3RP1A 3CZFB 3ULUF 1OSYA 1X5YA 3MRJB 2WZAA 3CXHJ 5T1LB 1BG9A 5EORH 1R17A 5FIEA 3HHRB 4JKPH 5KG9A 1KCUL 3TN0C 1GMEA 2GSIA 3VI3F 3NSFA 4BFJA 4JBSA 3WLBB 2B20A 4KTEL 1IX2A 2AVFA 1EGJH 5D7LA 5EBLA 3VGDA 4DKTA 2VXQA 2BOCB 5J89A 3KPRB 1WIOA 4N26A 1N6VA 2Y2TA 3F7RA 3Q3GA 3LIZL 1OGAE 3FSWA 3QPQD 3U82B 5IQ7H 3DYMA 3P77B 2HMIC 4A2DA 1R0AH 3RFRA 1R19A 2V33A 1IRAY 4JFFA 2DI7A 3LKNB 4OTXL 3UTSB 2M83A 1XIWB 4PJ5B 3QJVB 5KBPA 4L1LA 1D6EB 2AQ1A 2GT9B 3D2UA 3N9GH 4P5SA 4Y4FD 1BEYH 2NY4D 5I5MA 2HN7B 3ES6B 4ZAKA 3W5MA 2GVYA 4UMSA 1UZ8B 3FN9A 4N0UB 4TOYH 1S9VA 1UB5B 2KI6A 3OG4B 4YR6A 2GTZB 1FAIL 3K74B 4XN9A 2OSWA 3N40P 4PJAA 3BWAA 1NGQL 2R83A 3RA7H 4MNQB 5E6ID 1S7TB 1A3LH 1TVHA 5ECGA 2BP8B 2IH1A 3BN3B 1JD9A 2AQ3A 3OX8A 1U8JA 1KC5H 3QJRB 1B6DA 2KPNA 3SDAA 5DQDL 4RGND 1JHKH 3BE1H 1VZHA 3TTYA 1KNOA 2XN9D 4QEGA 4YK4B 1HYSD 3RNKA 4IBYA 2NR6D 4JM2D 4HIJB 2H1PL 4ODTH 3HANA 4IIQC 3S88H 1MH5B 4OIAA 4DFIA 1RH8A 1I9EA 1TZHA 5J11C 1M56B 4Q9RL 1O9ZA 1A47A 4ZQKA 1FN4A 5IBUB 1UWFA 5M95B 3TBSA 5AD0A 1FNFA 1T1WA 1NCCH 1TO4A 3H7BB 1DBAL 1K85A 2V9TA 5GGTA 1MCOH 3NZHL 3IKKA 1T2QH 4PJBA 3VQLA 2UXVA 4C4KT 2WLMA 1LO3H 2XN9E 1ADWA 3CVHA 3SGDH 1PJ9A 3F7VA 1I7UB 1XAUA 4D0DB 1S7WB 3NIFF 3WJJA 4OF0A 4HX1B 1NCWH 5H4YA 4KTDL 5H35A 5HYJA 3VGAA 5B6WA 5E8OA 5JW5A 3SSGA 3CVCA 1B4JH 1E2VA 1VGOA 3B9KB 3GLEA 1T7XA 5CINL 4NM4L 4W1TA 2ICCA 1ULVA 2NQDA 4OIFA 4PLKC 3NS0A 2F7QA 4K8RD 3OWEA 4D7PA 3TF7C 1CGYA 1YECH 3BW9A 5CLYA 1XH0A 4F7PB 1IBBA 5DO2C 3BVXA 2VDMB 1BGXH 2CWRA 4N6RB 4BE5A 4HK0B 3ZKMC 1DQIA 2VZVA 4TQIA 2B1HH 4ZXBA 4WAFA 2Y5EA 3S8WA 4M1CD 4K2UL 4UNIA 3RLSA 4ZW3A 3PHOA 4CKVX 3P40A 2OR7A 4XNYH 3HNSL 4JKKA 3L4VA 1LQSR 4XNMB 2V7NA 1MEXH 4G6AD 1JHLH 1OT1A 1QM8A 2E3VA 1UCTA 4QXUH 3V4VL 4JFFE 3CFDB 4M00A 4XRCA 5C3LD 1G7HA 2QR0B 2YK1H 4WUUD 5C0NC 1T89C 4QIDA 1JV5B 2ZYSA 2XI9A 2JQMA 4Y7MA 5LBSA 4QOKB 5LO7A 5BVPL 1YAZA 4XTNA 4WK0B 1HL4A 4HHGA 3N91A 1KENL 2QTVA 5IOPB 3QEHB 5GIRA 3S37X 5I5IA 3GSQA 4XBEH 1MVUA 3NDYE 4PJGE 2WSKA 2FT8A 4BSWB 3FFDA 4R0LC 2UWEA 1EAQA 4DZ8A 4HJGB 3MOAH 4FN0A 4J4PD 3ENEA 1DANU 3BZFA 1ADQH 1IC7L 3Q2VA 1T0MA 2WCGA 5ENWB 4KMQA 3TN0A 3S36L 2IAMC 1GOHA 5C6PB 4FMVA 1B0RB 1C1EL 3E1F1 1U8IA 3MLXL 4X5WA 4H1LB 2DQGH 3ZEVA 2HT4C 4OGXL 2A6KA 1ZHKA 3US9A 2ZOTA 4K3JH 5HHPB 4KKBD 5JW3L 4YZWA 4CMHC 4KFMA 2I1XA 4JKNA 3H1ZA 2XWXA 1BFVH 5FM4A 1WTGT 4B9ZA 3PAUA 1D5IL 2ITCB 1DUZA 1FH5L 1DN2A 1OE1A 4AC2A 3CVBA 4S1RL 4PXFA 4PJBE 4I18A 4XPTL 4A7QA 1F4YL 3LNIA 3AG1B 1GMIA 3GXMA 2OZ4A 1AH1A 1RP8A 5IJDC 5JQ6L 1CFBA 1XCQA 5A8EA 4XHJD 2C9SA 4PLNC 3DROA 3TA4D 3ZDXB 3P1VA 4CU7A 2YDOA 1NCHA 5KVEH 1E30A 4D8PB 5HHNB 1AHWA 4PJHA 2BNUB 2R9HC 3L81A 4N2LA 1VZGA 2KSAA 4OCMC 5DHMC 1JFQH 2QQLH 3VI4A 1RHHB 2QKSA 2QVIA 1RUKL 3MBED 4PP2A 1URZA 2QQNH 1SBBA 1KJMA 5DJZA 1NGYA 1Z3GH 1IO4C 1CYXA 4KQ3H 2A83B 3FQUB 2WBKA 3LEYH 5GISL 5I73B 1M3IA 2L7JA 2G2NA 1P5VA 4R5TA 4N25A 1U58B 4IIQA 4L37A 4BJLA 1VFAB 3TFKD 4YSPA 4GO9A 2FJSA 2O72A 3FL7A 1NDGB 2C9PA 2ADFH 1QSFE 2DIEA 1W0YT 2VN4A 3FU5A 4B6ZA 4L3ED 4AIOA 2JKRM 3N04A 5D8JH 2GK0B 4UYPA 3E9UA 4PGCA 2OK0H 3BIKB 2EDMA 3WHXB 1J86A 4UNVA 1BQLH 3MRGB 2CR6A 3KPQA 4U4BA 4QRYA 2E27H 1ONQA 5EOCJ 1OP5K 2G2PA 2V8LA 3QUXD 5CZKA 4Z78B 4Q2ZA 2XN2A 5E8DH 1NGWB 5I0ZA 4Z0XB 1PY4A 2HB0A 5T3ZL 1KCBA 2RAMA 4L3EE 4NN7C 5MENA 2QPEB 4IU2A 3ZBMA 4LEXH 1D5ZA 4RLDA 4GKNA 5I1JH 3FU8A 5GGVH 3TA3A 3MLTA 2B4CH 1N68A 2EKSB 3G6JA 4LOEA 5T5NG 1XR8B 3MOQA 5T1DH 2GJRA 3FT3B 3WS6C 1LO0H 3BYYA 4CVZA 1I3GL 3UIYA 5A3ID 1KPUB 4CN6A 1U3HD 1ZVSB 1F6AB 4XP1H 2FATH 2LAGB 1FHNA 3VG0H 4FA6A 1P8IA 3NFPA 1JZ7A 1P84K 2O1AA 1F50A 4NFDA 2MIZA 2HPTA 4GG6E 5B38B 2DN7A 3KLHD 1MCQA 4A55A 4HGKC 1F41A 2CJSA 4PS8A 4YFLI 2O5XL 3SE8H 2EIJB 2OL3H 4UIMB 3QXTA 3KW7A 1QSED 4RZCA 2EDQA 5FM5O 4KO5A 1T89A 3RL1B 1E9PB 3DOSA 3MLUH 4W6WB 1IKNC 4P4RA 5C71A 1MXDA 2HT2C 3CDGA 3O3UN 4F57H 2FECL 3A4AA 4OBRA 4ETQA 1KXVA 3M07A 4U05A 5DK2B 5ISZB 4ZBJA 2NNXA 3EDKA 1AYOA 3F5WB 1XF3B 2FNBA 2PXYD 4JPKL 5E51A 2ZKHH 2R4RL 3GIZH 1A6AA 3QDME 2OXGA 4X7CC 3VYPA 4DP6X 1AR1C 3QUYB 3M8OL 4H0GA 1RZKC 1NC4A 5F1NB 4YZFF 4QHUA 3IFOB 3GIVB 3K4ZA 5CBEB 5K1VA 1EHKB 1HHJA 4DGYL 4KJYB 2A9ML 2PR4H 1MZYA 2ESVE 3JTBA 1KMGA 4WGWB 1F0LA 4AKPA 3JYCA 2IAMA 4M56A 3MRFB 3QNFA 3WJLC 5JDJA 1I9RH 3L7FA 4HJTA 4PBVC 1ZTXH 3LN5B 4TRPL 2VLJB 4WEUD 5F97E 1A02N 2H0PA 3H8NA 5EBMA 5E95B 4RWYH 2X40A 5KYWA 4Z3GA 1A14H 2DWDB 1R9FA 2C7FA 4GMSH 4PAZA 1YEHH 3JTTB 1C12B 2BDNH 5K9OB 5CP3H 1S9WA 4X6DB 4ZX4A 4ILDA 4LSUH 2AJ3A 2GAZA 2JSFA 5KVEE 2V37A 1JXGA 5E1AA 2AJZB 2FIKB 3KGUA 1ZHNA 4I2XE 4YIQA 1S7QA 1PLCA 4H8UA 1E8XA 4R5VA 3VFVB 4NO5B 3IM1A 1Z9SB 2EO9A 5GXBB 1UM5H 1JVKA 1H6TA 3QZWG 2UZIH 3IXAA 4CW1A 3KJ6L 1Q0YH 1FL5B 5D2NB 4WW2F 3VW3H 2EDTA 2ZUQB 4WHYG 5CILH 5A43C 1MCHA 5LG1A 3LNEA 3UO8B 2VMJA 4BXSV 1J8HA 2Z7WA 1JFPA 5HGAA 3QQ3A 3B5HA 2VCOA 1HHHB 2Z31D 4YPGB 4JM2F 1G7JB 3QFDB 3S34H 3BRFA 5F8QC 2SEBA 5EPMB 4WHTB 2AV7A 3FYEB 4MAYC 2YEZA 3QBLA 5LQBH 2OV0A 5TFSH 1DVSA 5F3BB 1JYWA 3KJ4B 4Z18A 3O6FB 5KS9A 3N43B 2BZCA 3V55A 3BLBA 2VDLH 3O3BB 4JG5A 4TUKH 3DK0A 1E8YA 3C6SB 1QFUL 1OL0A 4UTBL 2BCKB 1GW6A 1N7ML 3WS3B 4JJ5A 3PHSA 2VLRB 4YSTA 2QSCL 3KVQA 1MREL 1ZIAA 4WSJA 2WXMA 2OZNA 2NW3B 2ERJC 4Y1AA 3RTQC 2H26B 3MNZA 1M71A 2EYRB 2WTRB 4PS3A 4XAWH 1NCUA 1NMCC 2COVD 4NKQB 5E2JA 5IFAL 1A9EA 5KZCD 2N7SA 3TO4C 3R8BB 2DWXA 1F56A 1PZBA 3K4AA 1D5RA 4GKZB 1S3RA 4FQHB 3ECQA 2WIIA 3MR9A 3DXAD 1H15B 2J57A 3OR7B 3WHE1 1KGWA 2VDQL 2XJKA 1WAPA 3B2UC 3BFWA 4UB0L 1GZQB 4GXVH 1PQZB 3ZT5A 1GXEA 4FA8A 2ARJA 1ETB1 2I25N 3GSVA 1U6AH 1GU8A 1RJZB 3HB3C 5DJ2B 5KJRH 1PFOA 5CS7A 4Z3IA 3ALPA 1LLAA 4GUPB 4OZIA 4ZTOL 5DJCA 4XVTH 1T20A