3S3DB

Structure of thermus thermophilus cytochrome ba3 oxidase 480s after xe depressurization
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Mobility of Xe atoms within the oxygen diffusion channel of cytochrome ba(3) oxidase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s3dB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s3dB02
2IDSA 4DP8X 3COCA 1KG9A 1JVLA 1ZDSA 2IH9A 1BQRA 1KCBA 1M56B 2YAHA 4W9ZA 2IAAC 3V9CA 4BXVA 4E9WA 1NIDA 2J57A 4FAAB 3PAZA 2I1XA 2I7SA 2IDQA 1P8IA 2VW4A 1PXSA 1A3ZA 1TU2A 3FQ2A 4E9RA 2DY2A 4HCFA 3OMNB 3ZDWA 3QBIA 2G87A 1PNCA 2Y04A 1WS7A 2EIJB 5I6NA 3SBQA 4G71B 3FPXA 1PZCA 2GB2A 2XV3A 2YAPA 3HEIB 2KSBA 3OM3B 2QPDB 1JXDA 4BWBA 1KYAA 1ZV2A 1OCRB 3AY2A 3UONA 1B3IA 1OOWA 4N4WA 3PQRA 2I20A 1XJIA 1C8RA 1E5ZA 4K9JA 1DZEA 4GP8B 4NAJA 1KG8A 2AZAA 4JR8A 1QKPA 1FFTB 3S3CB 3BQVA 2YARA 1KGYE 3WG7B 6PCYA 2YQBA 4E9XA 3CDZA 4HHWA 2I35A 3AYNA 1GS8A 1J9RA 2PPAA 2PLTA 2EIMB 3L45A 4X32A 4N6HA 2VN3A 2YAQA 1KGBA 3PCYA 2DYRB 2H47C 2XV2A 2ZXWB 2BW5A 2NRDA 4WAVA 4BUOA 5D4IA 1WA0X 2N0MA 1ASQA 3AG2B 3UTYA 4DJHA 5B7EA 3RZEA 4XTOA 3UZCA 2XYBA 4BEZA 5FJGA 1XB3A 4TXVB 4IAQA 2OCCB 3DDLA 2WSDA 3D12B 3UADA 4AX3A 1QNIA 1HAUA 1NWOA 2YDOA 2NTWA 3UTXA 1ADWA 3EH4B 4KNFA 3FT0A 2YXVA 3IN0A 1F4ZA 3AG3B 2JKWA 4WKXA 1NINA 4RH4A 2TSAA 1BM1A 1ILSA 8PAZA 5AHYA 4HZ1A 2QPEB 4WW3A 5I28A 3HANA 1CC3A 3NSDA 4PAZA 4DP4X 1L0MA 1JXGA 2PEDA 1KDJA 3CVBA 2BRDA 4MBSA 4NC3A 4IB4A 2UXTA 2VSKB 3PXLA 4ZK8A 1CURA 1I53A 2BO0A 4QI1A 3KJ6A 3QDCA 2YAEA 4BV0A 1ID2A 1FA4A 2XV0A 4HWLA 3QJRB 1NTDA 3NSBA 1ASPA 1AS7A 1PY6A 5H2JA 3NP3A 1AZCA 3CG8A 1P8UA 3FPYA 3NJFA 2YCZA 1F88A 3OE6A 1V54B 2YAMA 1LN6A 1E67A 5B1JA 1C3WA 4G70B 2IH8A 4HYJA 4GYCA 1Q5JA 1FWXA 1XB6A 4QRYA 3UAEA 3PLYA 5A45A 1AP9A 1XIOA 4G7SB 3X1GA 3D4SA 4JKVA 3T45A 1Q5IA 1NIFA 3AZUA 4YSPA 1JZEA 1AANA 3FSWA 5F7BA 3VVKA 4KO9A 3OMIB 2FQEA 3ABLB 3RYMA 5FC9A 2J5WA 4CSPA 1AG6A 3FSAA 2YCWA 3OD3A 1KBWA 1JZFA 5G2AA 2UXGA 1W6LA 1A4AA 5DHGA 4JQ6A 2RACA 2KS9A 5A7EA 1EZLA 1L9PA 2JFCA 1ZIAA 5B1JC 4PXKA 3WIAA 2I21A 4BWUA 5LDUA 2F95A 3NS0A 1ZPUA 1SNRA 2UXFA 2EILB 2GI0A 3TBCA 1HFUA 4W1TA 2WJLA 5B35A 5G54A 2GC7C 1JFPA 3VW7A 4E9VA 1L9SA 3QJSB 1UATA 3IBOA 2BP0A 2F93A 4MQSA 5ANHA 3QJQB 1X9RA 2EI4A 5DHHA 4MD1A 5KKHA 3EMLA 4A2GA 1SF3A 1F56A 1RZQA 2DYSB 4KO6A 1AQ8A 2W8CA 4HAKA 5B6YA 1NPNA 1E65A 2FJSA 5B7FA 1AZRA 4GYBA 5EN0A 9PCYA 1JVOA 1UAZA 2PPFA 1ET5A 3FQ1A 2BWIA 4L0PB 3WNIA 2YAFA 4F2EA 2NTUA 3P0GA 5AZDA 1BQKA 1ASOA 1JZIA 1GS6X 2QDWA 1S8LA 1JERA 1A4CA 1SDDB 3FQYA 1HAWA 5AKRA 4FPDA 4QLWA 1PLAA 1IUZA 5B34A 3GDCA 3N55A 3S3BB 5B7MA 2VT4A 3EF4A 3SQRA 1C8SA 4DPCX 1AZUA 2J55A 3AM6A 5F8UA 3CODA 2J4YA 2CBPA 3ABWA 1BXVA 5B1AB 1IBZA 1F50A 4UG2A 1X0SA 1RZPA 5DYSA 1OCZB 4DPBX 1M57B 2J56A 5B6ZA 1WS8A 1DZ0A 3NY8A 1AS6A 2KSAA 3A7KA 5A8EA 3UG9A 1J9SA 1JZGA 2HX7A 4YSUA 2Y03A 1YLBB 3UZAA 2HPYA 4FBZA 2VMJA 3CVDA 3X1EA 1MG3C 1AT9A 3QJUB 4TL3A 1RKRA 2DWSA 4BK5C 1AZNA 4BDVB 1AR1B 4GP4B 4KO5A 2X87A 3SN6R 5H2KA 1JZHA 3HAPA 3S3DB 3QQXA 1S51A 1JOIA 4JKNA 3ZEVA 2PCFA 3X3BA 3FYEB 2H3XC 5PAZA 3CVCA 3PPSA 1W8EA 5H2PA 2Y69B 2PP7A 5B1BB 2BP8B 2YDVA 2UXVA 3FU7A 3JTBA 5JJNA 5E9NA 3ASNB 1M9WA 2JAFA 2YCXA 4YSOA 1GZMA 2HX9A 3KW8A 3PAVA 1KMEA 2M3GA 2WO2B 1QHQA 3TU6A 1J9QA 4AKOA 4MFHA 3TASA 4GY4A 2HXAA 2BWDA 1E30A 3PBLA 3FS9A 2BW4A 1X9UA 2FT6A 3NSYA 3HAQA 1PY0A 2HRHA 1E5YA 1R1CA 3FSVA 3OAXA 4BVNA 3NJLA 4BWTA 4A2EA 4NB7A 4KNUA 1M0KA 5B6WA 3C9MA 3OE9A 3DKHA 3AG4B 4UHRA 4YVUA 2WJKA 2DWTA 1GSKA 3NSFA 5I5IA 2IWFA 1BYOA 5AHZA 1QKOA 4YSDA 3SBRA 2PPEA 1HZXA 1X0I1 1BQ5A 2UX7A 1BYPA 4L35A 2JAGA 1S52A 3NJNA 5F7AA 4MQTA 3FSZA 5AWZA 1ETJA 1BXAA 2W88A 3EHBB 4KOCA 5D4HA 1KBVA 5LWEA 1OV8A 1PAZA 2EINB 2B08A 4XT1A 3NJJA 4G7QB 1L9HA 1AG0A 1MZZA 2XLLA 3NYAA 2MTAA 4JHVA 2FNWA 4F7KA 2GSMB 3T6WA 1ZIBA 3ZBMA 3HARA 1VLXA 1QM8A 4GBRA 3BVDB 3CZUB 3GXUB 5AZUA 4NERA 1GU8A 4P5RA 4E9YA 5I6OA 2UX6A 4YSCA 1KDIA 2GIMA 1AOZA 4XT3A 2XUWA 1J5CA 1P8HA 1SJMA 3DIVA 3FU8A 2PPDA 5B6VA 3S8GB 1GY2A 3IEAA 4KOBA 4DP6X 4DPAX 3AYMA 1BEXA 1ET8A 5H2OA 4AKPA 4E9TA 1V55B 1QHJA 7PCYA 3OMAB 1ZDQA 5I5MA 1OE1A 5G36A 5B0WA 4PXFA 1O0AA 1MDAA 2AFNA 4HALA 1H68A 4KLYA 2FTAA 2I7OA 5I6KA 1PNDA 1A4BA 3ZPQA 1N70A 4EF3A 3UTWA 1TN0A 3SBPA 2IDUA 5I6MA 4FA7B 4EJ4A 2HZHA 3PWHA 1EHKB 5C1MA 1IXFA 2Z73A 3ASOB 4YSRA 2R4RA 4DP0X 3MX0B 3GYRA 3V2YA 3NYKA 1FBBA 4X31A 1SFHA 1KV7A 4MD2A 3WNJA 4YL4A 5ETZA 1NIEA 1PZBA 3QBLA 1J5DA 4XTLA 1TEGA 2Y00A 1NICA 2PP9A 5JJJA 1SF5A 4QKTA 5I26A 3T6VA 2R7EB 2E86A 2CJ3A 2X72A 2VM4A 3ZPRA 2VSMB 5AFAA 1GY1A 3X1NA 1CYXA 4A67A 2R4SA 2Z55A 4ENZA 2IWEA 4YSAA 1L9OA 3MBVA 1CYWA 2FWLB 3N2JA 2WO3B 2XWZA 4L6RA 4BXSV 5B2NA 5BR2A 3IE9A 1NWPA 3ABKB 1A8ZA 3QJVB 3WKPA 4UAHA 2XXGA 5EHFA 2FT8A 1PLCA 3T6ZA 3UACA 2CCWA 1S54A 5AX0A 3FU9A 3FYIB 3NY9A 3PAUA 4N4YB 3ABGA 1ILUA 4HCGA 1KCWA 2ZWNA 2FQFA 2IDTA 2H5UA 2BP0B 1MZYA 3JT2A 2CALA 1R2NA 5AX1A 4KNSA 4YSSA 3ERXA 1N68A 2ZOOA 4A4MA 4J4QA 1GUEA 1BAWA 5H2HA 4WTQA 4YVNA 4X1HA 1L9RA 1M0LA 1U19A 1GS7A 4LDOA 3HAOA 2CAKA 2ZFEA 1MG2C 3TA4D 2XU9A 3H56A 3CAPA 5D4JA 5H2LA 1MGYA 3QAPA 3WQJA 1GW0A 1BXUA 5G2CA 4AI7A 4K5YA 3RFMA 4GRVA 2IDFA 3IN2A 1VGOA 1H2SA 1WAEA 3T9WA 5I5JA 2Y01A 5TK2A 4LDLA 3VI0A 2OV0A 4DP5X 4P5SA 2B3IA 4EA3A 4KO7A 2LNLA 1OCOB 1SFDA 1PLBA 1W6WA 1IC0A 1M0MA 1T5KA 1V10A 2IWKA 1TKWA 1VJMA 3NT0A 1S8JA 5JJEA 3ODUA 4GXFA 1E0PA 1S53A 4DAJA 1PZAA 3UTVA 2GBAA 1XB8A 2Y1AA 1L9QA 4M3HA 3HASA 5J7AA 2HX8A 3UABA 1BRRA 5G28A 3NJHA 4UF7C 4E9QA 1NZRA 1OF0A 3DQBA 2A3TA 1IW9A 5IY5B 5H2IA 4AKQA 2GHZA 4A68A 3G5WA 3AG1B 2YAOA 2PP8A 3CDZB 1SHXA 4A2FA 4HHGA 2Q5BA 4GP5B 3VHZA 4A2DA 3QBKA 4QIDA 1GYCA 1L9TA 3VGAA 5ITCA 1NIBA 2QDVA 2XXFA 3FU7B 2Q9OA 3PXOA 3DTUB 3KW7A 1AS8A 1SHWA 2VW7A 3V2WA 2PCYA 3H4HA 3ZIYA 3QBGA 5TGZA 2Y02A 4A2HA 1AACA 2AVFA 2OJ1A 4DP7X 4PCYA 1CUOA 1IBYA 1OE2A 3NJKA 1E12A 4Q8BA 4YSQA 3QJTB 1OE3A 2BHFA 1JZJA 5G53A 3ZX1A 4Q89A 1PF3A 4M4RB 1IKOP 4OV0A 2AZUA 1OCCB 2DV6A 4HIPA 1BRDA 1PXRA 3C9LA 2ZZLA 3PDSA 4E9SA 3UAAA 4G72B 3OE8A 1RCYA 2CUAA 3NJMA 4YSTA 3T6XA 1JV7A 1PCSA 2VW6A 4GPOA 3V9EA 5H2NA 3T71A 4EIYA 4DP9X 4XXJA 1NPJA 2LLNA 3X1BA 2QT6A 1PMYA 2XX1A 5B3SB 3MBWB 2R7EA 4AMIA 1AIZA 2PPCA 3NJIA 5ITEA 2MRYA 4XTNA 2BZ7A 5H2MA 1AAJA 1URIA 2P80A 2JXMA 3C75A 1WA2X 2AT9A 3TBBA 2ZONA 2YCYA 3EH5B 3NSCA 1JXFA 1FBKA 1SDDA 3U25A 2BZCA 4LDEA 3HB3B 4AZUA 4F2FA 4AMJA 4DKLA 5G2DA 3S8FB 2HLEB 2FQGA 4BWWA 4X4KA 3ABMB 1ET7A 3WKQA 1J9TA 4DP1X 3NP4A 1X0K1 1JGJA 4UANA 1UCQA 5B6XA 3VG9A 2L6XA 5BR5A 3AW5A 1R84A 3REYA 1WA1X 1QLEB 4Y9HA 3NJGA 5TK4A 1A65A 4KNTA 4N8UA 2VM3A 4HYXA 5I6PA 2AANA 3UGEA 4CSZA 3WI9A 2X88A 6PAZA 1TEFA 2KSYA 2I85A 3EH3B 2XVBA 3H4FA 5B1KA 3X2QB 3X1FA 5A44A 1NDTA 2FT7A 4HCIA 2ZIYA 1NIAA 2GC4C 5PCYA 4BDVA 7PAZA 3OE0A 5I6LA 1BRXA 3X3CA 1CWQA 2EIKB 2FQDA 1IW6A 2XX0A 4G7RB 1DYZA 2YXWA 4YSEA 2TSBA 1JV6A 4JHUA 4BEYA 3QAKA 1TN5A 4IARA 3QPKA 1GR7A 3OQRA 4A66A 1XMEB 2RH1A 2BP8A 4DP2X 2HRGA 2P80D 1AZBA
chains in the Genus database with same CATH superfamily
1SY6L 2ZNWA 4ZXBA 3AQZA 3MXVL 2Q87A 4E9WA 3FQUB 3GSRA 4U1HA 3WJLC 1WC7A 3N44B 3EJUA 1VFOA 4PP2A 1U91B 4M62L 4XPHL 3HMWL 4FQ2L 2AQ2A 3KPSA 5D7IA 4JRYD 2QKSA 2EDLA 3RB5A 1EDHA 4NQCA 2DQCL 5FO7A 3SBQA 3FPXA 4B53A 3BPLB 3C5SB 4JKMA 2E5EA 1TJHL 1OOWA 1HH9A 5CZXC 4APQA 4M61B 4YMPA 3D3VA 2VABA 2I20A 3GMRA 4GT7A 5IESH 5TGBA 1TTRA 3AT9A 4POZC 1KG8A 1VZGA 3NH7L 3UTSA 2Y6SC 1FFTB 4IRZA 4TQEL 1F2XK 2UZYB 1AZVA 2ZSVA 1SYSA 4L3CA 4PWGA 2YQBA 2LFGA 4EN3D 2WVTA 3QZLA 2P48B 3BKCL 1BFOB 4KTDH 4NUGH 1J5OH 1CXKA 4TUKH 1CFNB 3MV9E 1TO4A 2DYRB 5CHNB 4X9IA 4OZFB 4UMSA 3HPLB 1YMHA 4WSJA 1GHFL 1LD9A 4YC2B 5IMKB 1H8SA 4FL4C 4XNUH 3NFSL 4MVBD 1I8UA 2IIJA 5IJKA 1YCSA 1DUZB 4IAQA 2OCCB 2N0KA 3BQUA 4TL4A 2KI6A 4Y4KA 3II2A 4PWFA 2MCAA 1FH2A 1AJ7L 3IFPB 1ODAA 4NKDB 1XGTA 4A7QA 1J1OH 2V5TA 3VXTA 1A6VH 3RGHA 1L0MA 3MA7A 1CMOA 3CVBA 4KITB 1DHKA 3TBVB 1G0XA 3H9SB 5D7KD 5I76A 1NC4B 2BO0A 3VTMA 2FLMA 5CU9A 5FK9A 3QIUD 2XV0A 3U6RB 4LPYA 1PX8A 5GRYA 2ARWA 1LHZA 4GSXA 2KQMA 4X99A 5FFGA 3MGTB 1GKOA 5ACZB 1B9ZA 3HS0B 5BVPL 3KPMA 4FFYA 1ICTA 2QFPA 1XIOA 2WWMD 5A2AA 3RWFB 4FEMA 8FABA 2BIHA 3N9GH 4WV1B 5MI0C 4QHMB 5AZ2H 3S2CA 4NO2B 3T1FB 1BM3H 2AXGB 2DH3A 5LBSH 1S3KH 1DQKA 2R29H 1ZA6A 2X4QA 5JNYA 2I9LB 1CB4A 2APSA 1I8KA 1ZLSH 4WZ9A 1I1YA 3HHSA 3MLWL 5I1KH 3VD0A 3MJ7A 1MREL 2FBJH 2W91A 4WO4A 2JI1A 5CILL 1EHLH 2XWEA 4PV9A 1CL7H 3WIAA 4CDHA 2VIRB 3LKSB 3AVEA 1WIUA 2ZCZA 5AVSB 1AHWA 3S6CA 1RURH 4IRJB 2DQEL 5IKCA 5J6HA 1BQLH 2GI0A 5D7IF 1UKSA 2EE0A 2GJ6D 1IEBB 4N2KA 2XQYA 5IJCC 1NAMA 4NQDE 4AJ0A 4FXKA 2F93A 3VD5A 2ITDA 5AB1A 1XSOA 4ESKA 1U2HA 3EMLA 4KO6A 4WI4A 2NY5L 2L7EA 3D39D 4BSVA 4YK4B 4GW5B 5DU7A 2EXTA 2FJSA 3VXRE 3FAXA 9PCYA 1UAZA 4XCEB 5IQ7H 1OAXL 4KNQA 1I1FB 1SQMA 3K4AA 1LYQA 1YUHA 3MLTB 3B1UA 5AL8A 5KSBF 2QDWA 3CVHB 1HILB 3ESPA 1JERA 2FR4A 4QRRB 4RDQF 5ALBH 3ESMA 2QGCA 3S5LA 4OFYD 3S3BB 1NMBL 4N0UA 2J55A 3OKDB 5SWSB 2EVHA 5FM5O 3G6AA 4YHYC 1MIEH 2CHNA 3BUYB 4P06A 1EJOH 5IB5B 4ZS7L 4EN3C 1UENA 3G5ZA 4RAUB 1GZPA 1PG7X 2W1NA 4IRSB 4ZMTA 1JI2A 1NLBH 2ADJB 3HUJB 2IAMB 4NNYB 3MRBA 4WI8A 4F9LA 5HHQA 3IKCB 2VMJA 4F8TA 3V0AC 2KDYA 4BDVB 2WXKA 3D1MC 4M5SA 1JP5A 5JOPE 4MLIA 3JWOL 1LE5A 1W16A 4PJHE 4TRPH 3D4YA 3GIVB 3ZZSA 3WTUA 3GHBH 5EUOE 2WUBH 5EU7E 2ZPKL 2OA9A 3SEPA 3WEAA 4JM0A 4UILH 2ITEA 4OGXL 3T6QC 2M8XA 1DEDA 4JFEA 4Y88A 4FG6D 4WK2B 5DRXA 4NP9A 2BW4A 2VC2B 3QIUC 3DIFB 4K8RC 4TKWA 4KV5F 1QABA 3HI1B 4NNPH 2EE3A 4XVSH 1XT5A 1XGYL 1E9PA 3VACA 3HG1B 3QJXA 4NENB 4QDGA 1TG8A 4KH9A 4HA1A 5C0EA 1IGJB 2IOOA 4PJIE 5I5IA 2WWMC 2PPEA 1IKNA 1CPUA 1I7RB 1Q8MA 4HIEA 1ZLEA 3HN5A 4QO1B 3BJ91 4QXWA 2ZCHH 4JFPA 3WCYA 2VDPL 5FO8A 2RALA 1J8SA 2PN5A 4XAKE 4AWJC 4Y2OA 1OD7A 3BCFA 1KGJA 2IADB 5B8CC 3IRCA 3GHPA 4YH6A 3LHAA 4V11A 5HY9B 2O5YL 3JVGA 1HL4A 3S3JA 4HIJB 1A5FH 5DGRA 1G7IB 4PJ8B 4MNQB 2WZPD 4BRVA 3VU1A 1FGNH 1JMXA 1DQVA 1MXGA 5LCVL 1I8MB 1TQBC 3OKYA 1IGML 2HTKC 3QQDA 1Q38A 3JYCA 4OV5A 3LIUA 3CFDA 4HDIB 5FYKU 4AITA 3WS3A 4G43B 15C8L 1HKLL 1V3KA 3GMPB 3OPUA 2NSXA 1NFAA 2ARJQ 1QHJA 2XOTA 3DBXA 4L8CA 5I5MA 5CZVH 2B4CH 3EXLA 1F45A 1UVQA 2J8UA 4UT9H 3SE8L 5A3ID 3FFCA 3VXOB 2OP4L 4KLYA 4MZIA 3GRWA 4B41A 4ETQB 3K7UA 3ZPQA 1NOLA 1Z9SA 3GGWA 1E6OL 3F7VB 4ICWA 4EJ4A 4N85A 3PWHA 1O9ZA 4HKZA 1KB9J 4FXTA 2JCCB 1JHLH 1YA5A 4LGPB 5CBEA 3VXNB 2JNZA 4AYGA 3TF4A 1MFBH 1ZT7B 1RZJH 2BSTB 2H32B 1TVDA 1J5DA 4NX0A 5TQ0H 4HJGA 5JJJA 3A21A 4W9DC 1ACYL 3BXNA 4N8CL 4BQCA 4DCQB 3ZYIA 4R90L 1NBCA 1DVZA 3ARVA 2VM9A 5BZDB 3X1NA 3G08A 4A67A 5J5EA 3CZFA 3QDGB 4KZ0A 1RJYA 2BNRB 3QDME 3OGOE 1RHHB 3IE9A 1O6VA 1A8ZA 4AZ8B 3GB7A 1DN2A 3TXAA 1UURA 3HI5H 1FIEA 2CCWA 4XGZB 4XN7A 5AX0A 3B7RL 4U6VL 2C8NA 1AY1H 4LLUA 5DWPA 3BHBB 1ZKAA 3AXLB 3T3MB 4X7FC 2DBJA 4BFIB 5HJBA 4YSSA 1R2NA 4KHXH 5I66B 4ELME 1QPXA 3FN0H 1BVZA 1D5MA 4HJIA 3ARGB 4MGXA 3DMMA 4N2FA 1N59B 1UWXH 3E9TA 4DK3A 4X6CF 2WKGA 2VZ3A 4AK2A 2CAKA 4F33B 1JN6B 1SLWA 1UUNA 4K07A 4D7PA 3DVFA 2R2HB 3SKMB 3QWRD 4QY8A 5IBTH 5D7HA 3V0DA 3UPAA 2KLSA 5C08A 2FH6A 2EYSB 3DHJA 5I5RA 2GAZA 3TCXA 4AI7A 3JV4A 2VR3A 4N2HA 1MN4A 4JZNB 4JPKH 4P2OB 3BP7A 4LARH 1H2SA 3ZT5A 5GGSB 1KTDB 3SE4C 2Q20A 4KZEL 1PEZA 4DIXA 5AVXB 4DO5A 1U8OB 1OIOA 3ZHDA 2WD0A 4G9FB 1T5KA 4Q56A 5KBPA 4GUOA 5I2IA 1P4BH 4YPGA 1MNUL 1YN6A 3CK0L 2JCCF 5AOIA 3ODUA 3K6FA 1IBDA 4PG2C 1X5YA 4GW1B 4WI3A 5J7AA 3MLYL 2X05A 2J8UF 1BRRA 5ICZB 1K9TA 3H9HB 5F70A 4CKQA 1T7VA 4NC1E 4DOHB 4Y9FA 4X5RA 3LH2H 1SLVA 4W6YB 5JIHA 2DIAA 3WE1A 1J5IA 4GRMA 3C6LD 3E3QE 4NP4L 4MAYA 1PQZB 3CXDH 2YPLD 4Z7UA 2WWOA 4WI0B 1QSVA 4DKFL 3NZSA 4G7VL 1PZUB 4JO2L 1VKXB 2W9DH 1OAZH 3ZR6A 1QLRA 5E2TL 4ZAKD 4A2HA 2E9WA 4JDEA 1SYVB 2JTDA 4FQHB 1J11A 2R0LH 1RI8A 4W6XB 1UA6L 3II1A 4APXA 2XTSA 4LCUA 3VWKB 3GKWL 2L7JA 4LSSH 3ZIMA 5F7UA 3EYFA 3QIBD 4F57H 3MFFB 3U4BH 2J21A 4KZCA 3MX0A 2QHLA 5KTEH 1J1XH 1KYOK 1T2QH 2OMZB 3UP1A 4RISH 1AQDA 3ML9A 5E56A 5JIPA 2VW6A 3WN5C 3OB0H 2XC8A 1BW8A 1NPJA 1YEJH 3BUPA 3KH4A 3IGAB 1RK0B 3MRRB 3PWNB 4LF3B 3L3OA 2R7EA 1C9SA 4OIBA 3K91A 3WIFA 2G75A 3PDDA 2CZNA 3IDXH 2AT9A 3BDBA 2YCYA 1ZD6A 3U6XS 2ADIB 1TZHB 4Z77B 4AUJA 4URTB 5L9DH 1Z5YD 3A67H 5ERWA 5C0BB 1M05A 1MJ8H 3KLQA 1QFWM 3G5XB 4WW2C 3L4VA 5IT2H 1BJ8A 4FI6A 4QJ3B 3UYRH 5EZOH 3LKPB 3IFOB 4L9DA 3TJEL 1UT1A 4GBXD 4HBCL 5GRZA 1BQUA 4HYXA 1Q0XL 2NLJB 3GSUB 6PAZA 1G5AA 1FNSH 1W9XA 4H88L 4JCWA 1USZA 3COOA 4XMKH 4JJOA 4DO4A 5KZCB 3RKDD 1S7TB 4M6NL 3HRZA 5K93A 5AB0A 2FQDA 1GIGH 2YXWA 5GGVH 2TSBA 3D09A 3HMXH 1CLOH 2WKOF 3GBNL 3V5KB 5I17B 1CXEA 2WSPA 4TULH 3P77B 4Y2LA 4Z0BH 4JCLA 3VG9C 1U8LB 3MZTA 4GINA 3QWOB 4MASA 1H15A 2B20A 1AZBA 1DQQB 3OKLB 2P5WE 4QXUH 1HI6B 4DP8X 2GCYA 3GSVB 4K7PH 4W9ZA 3N91A 1T03H 3MV9A 3T08A 1HQ4B 4K5OA 2DZEA 2I1XA 3QG7H 5JUEL 5FB8B 3MBED 2YSTA 5HDWA 5BZWB 3IMUA 2CNZA 3SGKC 4OI7A 1JD9A 1VFAB 2VOTA 3T65B 4L1SA 4AYBA 2RD0A 2MCMA 1IAII 1Z7JA 4Z7UF 3P0GB 5HGHB 3VU2A 2EE6A 3JTTA 1W0VB 1OGPA 5I8OL 5EU4B 3DARA 1ZV2A 4HH9B 4JQVC 3UPRA 4YX2H 1OK8A 4ZPTA 1QI4A 1SQ2N 2CR6A 2PTTB 4K9JA 3GSNA 4PJAA 4Y9GA 5KS9E 1JZ7A 3RWHB 1KTLB 4NAJA 3BEWA 2NY4B 1P7HL 4P49A 3ETBF 1DUYB 3BVNA 4MS8D 2WYZA 3OKMB 5CGYD 3WELA 1RJCA 2PLTA 4BGLA 2VDRL 3ARDB 3SE6A 1IGIH 4FFWD 2XV2A 4Z7QB 4ZAKC 3HE6A 5DUJA 3SJVE 1ASQA 1ES0A 3FQXB 4DJHA 1JWMA 3O6KL 4KU1A 4OJYA 4LDOB 5FHBL 4OLYL 1QR1B 1DQMH 2Q2EB 3M8OH 3SDXB 3CH8A 4Z95L 1RJLA 4PRHE 4P3WA 4YUEH 1J86A 2NTWA 2XNAB 4KNFA 4IKIA 4UNUA 5HYJD 4KROB 1FIGL 5ITBH 2XQYK 5IG7A 2IOIA 2ZCLH 1YNTA 2X6UA 1ADQL 3AJ7A 1U41A 4HZ1A 1CLZL 5TE6H 4M02A 1UYWL 4DP4X 5F3BB 1YMMB 2WWNA 1JXGA 3V6OC 3WTTA 5F7EL 5DJ0B 1NJ9A 1QNZL 4GKNB 3T77B 2ZF8A 4AEFA 3OXRA 1M7IB 3P4NB 3EYOB 4QI1A 1T80A 2Z0BA 3HZKB 5AEAA 4P2RB 2LW3A 3AREA 5AUMB 2WXJA 1QPKA 1NTDA 3HAEB 4O5LL 2WGNB 1EO8L 1AFVL 1JI1A 2DQHL 1UXWA 3FUDA 4G1EB 4KMLB 4FMKA 4FLQA 3UAFA 3OE6A 3GK8H 4GXVH 4OZ4A 3V0WL 3WTYA 5B1JA 3VQ1C 32C2B 1SDYA 2ALWA 3EXJA 5DZAA 1QYGH 1L7TH 3BPNB 4GNKB 3LRSA 4JHAH 4WCYL 1XCXA 3MJ8A 3QFJB 3VXRA 1VHPA 4GBXC 4GFXA 4RETB 1LO0H 1JNJA 4I3SL 4QLRA 4PY7A 5D2NC 3RGVA 1FZOA 3D85B 3UTTD 5DRWB 3VNZA 2ZD0A 2ILLA 4GFTB 3QI9A 3HTLX 4EZMA 3RKDC 3TBTB 1A7QL 5FYJU 3H3PL 2OXHB 5D2LB 1S4IA 3C12A 4WUUE 4B9GA 2QZQA 3O45A 3EOBB 1YEIH 5CZRA 2VXVL 5I15L 4X4XB 1B4JL 4OIIH 3F7KA 1SNRA 4FHKA 4M1GH 1DEEA 2H45A 4K3EH 4AVIA 1R33A 1YSOA 1TZIA 5CJQL 1HEHC 3WL9B 3LKNB 2O72A 4L1DA 5FCUL 4MD1A 2QVMA 2ZYHA 1BF8A 1U58A 4G6ML 4Z7QF 4NO0B 2BMKA 3P0YL 1CTOA 3MBEC 4L29A 4HAKA 5B6YA 1NPNA 4PJAF 3ZHLA 2X1WL 1QW8A 5JXED 5J1SC 3LNGA 2Z8SA 4Q74A 1F86A 2X4RA 5HXMA 3IETB 4QLWA 1PLAA 4GQ9L 3EJJX 2VT4A 1S7QA 2D2CC 2WLMA 3KPPB 3LZOA 3SPHA 4LVNC 3ULVL 4BKTC 3E8UH 2BY0A 3MOBL 4DKEH 4RDQG 4I87A 1BXVA 1H0DA 4JFDE 3RDJA 3TN0B 4Z6AT 4JANB 3SBWA 5BVJA 5GISH 4PTTB 2ZZUT 3WO3B 4QHUA 4DPBX 2RGSA 3AWEA 2OCJA 4OLUL 2GSGA 4ZD3H 3A7KA 5I0XA 4FFWC 4ZUUB 3O81A 3TWCH 4XO4A 5FCSH 1YNTF 2WXQA 5H37A 1AT9A 3QJUB 3GPEA 2DWSA 1PTZA 3GMLB 3NVQA 4FQXA 4O2CA 5CN1A 1BWWA 4KO5A 5D6CA 5IEKA 5AAWC 4A7SA 4PJIA 2XZQL 4NHCH 4FC3E 4FJZA 5FGRA 3FQRA 1ZPLA 2HVJA 1RUAL 4JRLA 3K80A 2N7BA 5CEZH 2JQZA 4J1UB 2K7QA 3K72A 1A6WH 1YEWA 5GIRB 1YAIA 5LGHH 4C4KT 3VFOA 1I7TB 5EUKA 1M9WA 5BJTA 2XZZA 1SJHA 4ELKB 2M3GA 1TFPA 2H3KA 2WO2B 3WE6A 5D7JB 1J9QA 3GSQA 5TFSL 1LQSR 5K9OB 1K72A 4NQVB 4BQ6A 3WFHA 4TS6A 3FS9A 3QUXB 4HXBH 3FTUA 3LXBA 4HC1L 3LN4B 3UAJA 3QCUL 4RQQA 3U7YL 4UYQA 4JJ5A 1P7KA 2FYVA 1S9VA 2EYRB 2F8VA 4PRPB 1S7UB 4J3WA 1KBGL 1IE4A 1GSKA 4HVBA 3QXAA 4OM0H 3JYBA 5EC2B 1OM3H 3TZVD 1X0I1 2UX7A 1PX3A 3Q5YA 4AY0A 1S52A 5F7AA 1HXKA 1EEYA 5AWZA 2AV7A 4KJWD 4PTUA 2EINB 5HHPA 2NTFB 1LJMA 2AJUH 1CS6A 3BN3B 2CBOA 1HL5A 1SOSA 4ZX6A 3DVIA 4LNRB 1SMAA 1ZVSA 2XQYG 3ATBA 1ITCA 1I85C 3BWUC 4F8OA 2AJSH 3BVDB 2ZCKH 1VENA 4P9HH 2AGJL 3LS4L 5F0PB 2UX6A 1S7SB 3QIWC 2OZ4L 4XT3A 3IDUA 2VC2H 1NGYB 4OZHA 4ZFZB 2ZXAA 4P57B 5DFAA 5KSAD 5GS1C 2BOCA 3PJSA 2MHAA 3D33A 5DLML 4HUCA 3P9MB 1PZ5B 3MLVH 4HKXA 3Q48A 1EAPB 4DEPB 3JTSA 3CLEL 3O3UN 2DLFH 2Q1EA 3B6SB 4TUUA 5D96C 3EO1A 3QDMA 5JXEC 4HALA 3NIFE 4A38A 3S5LG 2VDMH 3ECQA 5I6KA 3B9DA 5DSCB 3I6SA 2EDBA 1KXHA 2VZVA 1IGYB 2ZKWA 3BO8A 3N43B 2OTPA 1C5DB 4JO1H 5JO5A 1AGFA 1K8DA 4JR9H 2NQCA 1IMHC 5I1IL 1CR9H 4U6XB 3FU3A 3HFFA 5AOKA 1Q72L 2L7QA 2OTUB 3HS8A 3SE9L 4ELMA 3LYRA 3UGXA 3BZEB 5C0AA 2YSSB 3DUUA 4M7KH 5FDWB 1RUQL 2CRMA 4LLWA 1NICA 2ICEC 4D0CA 2Y06L 3FQWB 3L9RA 4PM1A 2MIZA 2YZ8A 1TZGL 2JQAA 1S6NA 2X72A 3HW7A 2JXMB 5LQBH 2BFGA 4O02B 5AFAA 3FUIA 4PJBE 4ENZA 3DX9B 3KH3A 1ZSHA 3UDWA 3Q01A 3CLFH 1NCCL 4X9YA 1A9VA 4NUQA 3V8CA 2E7LC 3SY6A 1QSEE 4LL9A 1MHCB 3HNTH 5AW3B 3W9EB 3WKPA 4NRXA 4GS7B 2IV9A 1PLCA 1P1VA 3K4DA 4PWIA 1FLRH 2CUMA 1FFQA 5K9JL 1JFHA 3AQXA 1B6UA 3QUZB 1RIHH 1HHKB 2XKNA 3QXDA 4JFYB 1R9FA 1UOWA 5GGRB 4MA3A 4YE4L 3DXAB 4BKLB 5IOPB 1MZYA 3PG2A 3BZ4B 4C57C 2MOVA 2ZOOA 5LN4A 3W57A 3KYKH 2H32H 5HDLA 2Y36H 2J71A 4XR8C 2FJGB 5L8KB 4BSJA 2QTVA 5FPIA 1KFAL 3C09C 3PWUB 3T8VA 2NZ1A 2K8MA 5LBSA 2R29A 3BOVA 2QADB 3P40A 4NKMB 4ISVB 3ATDA 2PR4L 5A2CA 2W59A 3ZPDA 1F2QA 3U0PB 1KB5B 3V4UH 2C7UA 5H2LA 3QUMA 1KLFB 4DPRA 2WHVA 1W72L 4F7PA 3BFWA 1VGOA 2G2PA 4S2SA 5ELIA 3T9WA 2K6ZA 1LNUB 2CO7B 4OZHF 4ODHH 5ABZA 4KO7A 2LNLA 3K5RA 1VESA 5HHMD 1PLBA 1W6WA 2A77H 1HX0A 4V1DE 3T2LA 1IM9A 5HHNA 1IKFL 1TVHB 1ZLUK 2EXSA 4OGYL 1YQ2A 1X9QA 5G28A 3NJHA 2MSPA 3KJ6L 1GZHA 4AIZB 4IHOA 4DZBB 2X10A 4QRUB 5JDJA 5KSAC 1IGCL 3FULA 3KXFE 3DX6A 4HHAB 1AGBB 3IT8D 3TF7C 3VRIB 2BP5M 4H8WC 1NGZB 4XMPL 1OTSD 2A6KA 3KPOA 5T3ZD 5IZ7A 4GKLA 4Y5YC 4KC3B 2KHAA 3CD4A 4KTGA 2JKTM 3WIIH 2HRPL 4XPBH 2W94A 2EDQA 2ZUQB 2G9HA 3MRGB 2V5SA 3OX8B 1NBZA 3H9SE 1UQSA 5HP5A 2ARJB 4OQTL 2V9QA 3NSXA 4PCYA 1OE2A 5BV7C 2DTSA 3FB6A 1E43A 4XP9L 5J6SA 5I1DB 4C58B 4PV8A 1XGUA 1CYGA 1S9WB 2Q86A 4L1TA 4MDIB 4HS3A 3RA7L 5CR1A 1X5MA 2IV8A 2NY7L 1CQYA 3H3BC 5JQ6H 2ZX5A 3NQKA 4XH2A 1UZ6F 2A73A 3T6XA 5AG8A 3V9EA 2YQGA 3WEBA 4IOFD 4U1GB 1A4JB 2QT6A 3D18B 5CP3A 1QVOA 5E5LA 3FFDA 4WHDA 4GSUA 1H3GA 1KIUB 4MQTB 2X89A 3L9EA 1WA2X 1O7DC 2CLVB 4GIAA 1BOGB 3CDFA 4X6EA 3LEXA 3O4LB 5DS8A 2BZCA 4AMJA 5ID1B 2P5WA 3C5ZA 3Q2WA 2ENSA 2IPTL 5KYXB 2YMXL 1DCEA 3IVKB 3OKNA 3QK0A 4XNZB 2DL9A 2DQDL 4NKOB 5AYQA 3D7PA 2R15A 4JY6A 2A38A 5M94B 2NY0B 3RG1C 3IWVA 1A65A 1LTXA 2ZAGA 4A2MA 2K78A 5LWYL 2HFGH 2QSCL 4UOJA 5DC9B 2VDOL 1M6UA 5A44A 5CCGE 5GRVL 1OLLA 5PCYA 4Z7NE 1KJ2L 2EXYD 2M2DA 1I3RB 5HVHB 1I82A 5D55A 4QNPE 3X3CA 5F7KC 3BSZL 3ES6B 2X41A 5FYKL 4OLXH 1FF5A 5KS9A 5IQMA 4MCMA 3AWFA 5CEZE 3QAKA 4TVUA 1TITA 4AJVA 3ZKSD 3TONA 4QRRE 2J6EA 3ZN6A 1J1PL 2Q76B 4J3TA 4CILA 4OCSH 1TZOA 3MREB 2C1PA 4MB4A 2QSQA 1KCBA 1HXYB 3FTGA 1WEJH 3NOIA 1HC1A 1KLUA 3IPEA 3I75A 4JFSA 5LAPA 4F91B 4Q97A 4F7TB 3SJVA 2BSSB 4RA3A 1TU2A 1A1OA 3BCDA 5E6ZA 5CD5D 2GITA 3OMNB 1RIUH 4MSWB 3TOPA 3FHAA 1O0VA 1U36A 4X4ME 4BFKA 3QCVH 2OL3L 3VI4B 2G87A 2E7MA 4X2UA 4ZX4A 4PJ9D 3C60A 2GW5A 1J0ZA 4MJ4A 3LVEA 4NM8H 4ODSL 3HEIB 4PRHA 2KSBA 2ID5A 2QLVB 5I19H 4BWBA 3UX9B 3NESA 1I9IH 1A3RH 3KWWB 4UT9A 2NNAA 5CUSH 3WUWB 4XMXA 1K3ZA 3SE3C 1U93B 2AXJA 4K2UH 2ZX8A 1RK1A 1CXLA 1RLWA 3BH4A 2YXFA 1TZAA 1ORSA 2OMNA 3N5AA 3EIFA 2BPBA 4PJ5D 1CDJA 1OTSC 2DOCA 3OXSA 2VN3A 1KGBA 2V7NA 4A7VA 1HCZA 3ARUA 4YHOH 1UT9A 1WA0X 1TT6A 5D1ZA 3AG2B 3ZE2B 3OTTA 2R27A 3U30C 1R3HB 3D25B 4L0YA 1XCQA 4XTOA 2F5BL 4KVCH 3MRHB 2W0FB 3D87B 3GQFA 1PD0A 1T66D 3K2IA 1KLGB 5IB2B 3LX9A 5A7BA 1G7MA 1FL5B 1EMTL 3AG3B 4BH8A 3STBA 2Y9RT 4RH4A 2TSAA 1UOKA 3OWRA 3QWQB 1F1DA 4IOFC 4F15B 4NEHB 3HANA 3D0LB 3DTXB 3H53A 4WUUA 4P05A 4F8QA 1CG9B 2DKSA 5B1CA 3WS6C 5HHVH 2UXTA 4EVNA 3OKKB 1DDTA 4OW6A 1FVCA 4ZW3A 3WHXA 4BZ2L 3FBKA 1CE6B 4GAYB 1ASPA 5H2JA 1H3TA 3TO4D 3TJPA 3FB7B 3PP3H 5IMMB 1OKEA 4FF9A 1V54B 4U3SB 2IQ9L 2AXFA 2HJKA 3IJ7A 1NDGA 4PJ7A 4HU8A 2V17L 2OXGB 2UV3A 4C4UA 1BEYH 3ZTEA 5DMIL 5IJVB 1KG0A 4JFXA 5KS9F 3PLYA 5EOTA 1EDYA 5F7DA 4G7SB 2VDNH 5J13B 3QNZA 3T45A 1F58H 4WENB 3TA3D 5CGMA 5F7BA 3QYNA 4OCXL 5CMAB 2J5WA 4BM7A 1I1AD 4HUKB 3WTWA 2KYIA 3OD3A 4PRID 3IGKA 5F1IA 4ZO7A 4TUOB 2EXYC 5DO2C 5JIIA 4FCAA 4Y16A 5MEND 2RACA 4UTBA 1BG1A 4ZQKA 3NCEB 5AVTB 4MB3A 4DW2L 4V2BA 5C6WH 3DGDA 3FUHA 4LP8A 2BHUA 4Y4HB 3G3LA 4JFDA 4PMFA 3V5HA 2XZCH 1MFMA 2BVEA 4JZJC 4PJEB 1IQDA 1XZ0A 4LGRB 3RQ3A 43CAA 4G11A 4Y19D 4A39A 4NQTA 3LDBC 4WAFA 3QJSB 3ARRA 5IK3A 2VLLB 5KKHA 2DDQH 4H8PA 3U1SL 1U8JB 4ORZC 5DO8A 1XH2A 2WNWA 2VDPB 1MLBB 4HUUA 5J12B 5CD5C 3Q8BA 1H3VA 2A6DA 3CFTA 4AENA 2BH0A 1KPRB 4J39A 3QR1A 1BD2D 4PJ9C 2Q8BH 5A2LH 2A9CA 3LHPL 4JQIH 4QWWD 1R5VA 2V2TA 2VSCA 1XEDA 4BD4A 1JZIA 5EO1A 2EC8A 3GI8H 4Y5XB 5C09B 1SDDB 4HD5A 3CSPA 2OJZL 3O8XA 4DK6A 3QE5A 3ULUD 4N1HB 4RGOH 5DEFA 1JNLL 4CVWA 1VDGA 1L6PA 5SWZE 1IC7H 4NNXA 4UG2A 3DOSB 4Y4FA 2DWEA 2OSLA 4LGSB 4BZ1H 1COBA 3DSFL 3VFNA 1RUMH 2B8OT 5CLYA 2AJYH 2NW3B 2DD8H 4HJTA 4N1CA 3MHZA 4OUUA 2Z31A 1IGFH 3FH7A 4Y5VA 1FV1A 2EH8H 3BWAB 3IK2A 3O6FD 2X4PA 1GJIA 2DM2A 1HL9A 3CMOL 1U8CB 4QHLB 5ADOH 3UG5A 2F5AH 4NYLB 3AM8A 4UM9B 4F58L 1NFDF 4PS4H 2WQUA 3QEHA 3MLRL 2MPAL 4XNYL 4HFWA 2F53A 2GUOA 1UH4A 2ZYRA 1BV8A 5I30L 4MD4B 1FVDA 1IV8A 1BQHA 4WW1B 1FDLL 2FZ3A 2R51A 5E8PB 1JZ2A 1JPTL 4W6WB 4HX1A 4N2OA 4OLEA 3PGFH 1PAMA 4AYID 2YHGA 2NX5D 4PJ7F 1FZMA 3T0EB 4Q52A 5C0RH 3VSQA 5KBDA 3LPPA 2QQKL 2HXAA 4ANWA 1G9NH 1T7WA 2CRYA 4G9FE 4LBEB 5DURB 5E03A 5DD5H 3QQNA 3OAXA 1J5HA 3O2WL 4PLOB 4NZ8A 2RTTA 5FYKD 5CCHE 4JDVA 3DX4A 2XWDA 3GZPA 3WAKA 4DOHE 1M7DB 1VFUA 5GZND 3ZO9A 3IU3B 3SPCA 3GS0A 3QB7C 4HGWA 3TA3C 4G80B 5SWQA 4UBDD 5EU5B 4AYFA 4PN6A 3U0WL 1I1AC 3OG6B 1TSHA 3D69A 3H85A 3BVTA 3SKJL 3KLHC 4AQ1A 1NMAL 1D7DA 4HV8B 4XOEA 2FYYB 3O2DH 3EDFA 1AG0A 1CLCA 2XLLA 4ZTPH 4OU3A 3FCTA 3D4ZA 1U4EA 3L3DB 3WY1A 1QWHA 2J8HA 4BQ8A 1W91A 4K4KA 1JPGB 1QO3B 2FIRT 1KDIA 2KLTA 1U92B 1XTMA 1KCRH 2EO7A 1VADB 3QDAA 4HK0B 5GJSH 3MRKB 2Z7UA 3QQ9D 4H1LB 2IH1A 3KJ4B 4M8UA 4XP1L 4E9TA 3KLDA 3AADB 4TQ8A 2F7QA 3INOA 4AW4A 4B3EA 4U49A 1ZDQA 4D7BA 4KQ3H 4J7RA 3EG9A 1E9QB 1QSEA 4JAMB 5FA4B 2ICWB 4CBZA 4QWWC 4YOKA 4AC2A 3QA3A 2ZOUA 3GPSA 1DFBL 4RA0C 5LXVA 5I1GL 5C0BE 4LCIH 2JB6B 3BC9A 4JPWH 1X5IA 3FQUA 3L3GB 5ETZA 4FI8A 4KKZA 1OP9A 5DK2B 1NGQH 2LAGB 1QHPA 3T6VA 5H37G 3D06A 1YYLL 4JVPA 4UV7L 3WDIA 1ZSDB 1HOCA 2P5EB 3DVGB 3O6FC 1V3JA 3BJLA 4LVOC 2VMEA 1L9OA 1CYWA 2FWLB 2GBUA 5I9QC 2UZIL 1P6WA 2CJTA 3KLKA 2G9KA 4HEME 4HS8L 4P4RB 1U8MA 1QI5A 1BIIB 2E75C 4YE0A 4KMQA 3W0WD 1C5BH 4PRNB 2LOEA 2ISDA 3VG0L 3WDHA 3RDTD 3O4OB 1J8HD 2R69H 5L0QC 2BX5A 2R39A 3N41F 3PHAA 4HFUH 5GQBA 1AQKH 5BRPA 3G5YB 2GEQA 1G0YR 2XRAL 2A9BA 1BFOA 1MI5E 4V1DA 2ED6A 5KJRL 2H5UA 1CFNA 1SXAA 3ATFA 3IWUA 4YLCA 3HN8A 5CHNA 2N59A 5JOFB 4YPJA 1IC5L 1H3WM 3TH3T 4W9FC 5DHDA 3HPLA 1CBVL 5BOJA 4UAOC 4LVEA 1TETH 4U1LB 1FYTD 4WI2A 1R46A 1VCBC 2NW2B 3FF8A 5AWNL 4E41D 1OCWL 5G4OA 3WFBH 2P4AB 2NSMA 4U1IA 3KXFA 4AM0Q 1UHVA 2VZOA 3QHTC 5GS0L 1QBLH 3HG0A 2EDHA 2NYYC 2AK1L 1IM3D 3EJYD 4EI5B 5FOBB 1X5HA 3S96A 3CAPA 4PJFB 1AGCA 4ZFQA 3LIZH 3CMGA 4OJFH 4PI0A 5HI3C 2EEFA 1CO1A 2J1XA 3BYYA 4WI7A 4X83A 3E8VA 2XTJB 3H9SA 4UBDC 5BPPA 4FZEL 1HHGB 3PV6B 1DVTA 3H6JA 1EZVX 2HVKB 4WU7B 2BLFA 1ZANL 1N0XL 1PYWB 3FN3A 4YXHL 3U6RA 3ZJAA 1KJMB 2N1KA 3BH9B 4X9GA 3AS0A 5EBWB 2H0EA 2PO6D 1DJXA 5ACZA 5IJDC 3MNZB 4YDNA 4KGJA 3HASA 2P7TB 4YWGL 3NZHH 5IQ9A 3UABA 3MJ9A 2WTPA 4E9QA 5HGBA 2JLLA 1OF0A 3W2DL 2I24N 1MF2H 4QCIA 1UJ3B 4QXGL 4MA7H 4LBAA 3D5OF 3QQ9C 1KCSL 3O9WA 4G5AA 4QHMA 4WV1A 3SDXE 4NO2A 1G7PA 3VGFA 2AXGA 4M4PA 2PMZA 5EIQA 2AEOA 1DL7H 1VSCA 1IB5A 4RAVB 2DQIL 4HHGA 4YDVB 2DMBA 1VGKA 1YN7A 1ECYA 1CIUA 1NBYB 1KB5H 4H8VA 1AS8A 2HLAA 1OTTC 2CDGA 4QAMB 1YMME 1G84A 5D1QB 5TTRA 2VJ0A 4OGAD 4ADIA 5L4JA 4IEFA 3D51A 3I9AA 4JE4B 5I74B 4APQD 1B2YA 4KFZC 4P2RE 4WWKB 1IEBA 4K94L 2DAVA 3KYNB 3UTSD 4DGVL 3HE7B 4NBXB 3LEVH 3LZPA 4WFFE 4UOQA 3RJQB 2QQNL 3S88L 2HJLB 1OCCB 3NCJL 1MCWM 4N2GA 3VCLB 2EDRA 2VN4A 3C9LA 4FNPA 1K6QH 1L3WA 3OE8A 3ECUA 1XSIA 4HJUA 5E4OA 1JV7A 1PCSA 3QFJE 4QRQB 3WJJC 4CC4C 3UC2A 3UL4A 2VDRB 1KCUL 1SY6H 3MBWB 4E5XA 4R3SA 3MLTA 5ITEA 3MXVH 2WVUA 2YOAA 3C75A 4JGNA 5E9DB 2G5UA 4BH7B 2KBGA 1I7UB 1FZJB 4QRRA 2NTSP 3LPOA 4LDEA 2WVSA 2C9UA 2EO1A 1Z0NA 4M62H 3VB9A 4PJFF 4X4KA 4XPHH 3HMWH 4FQ2H 3D0VB 4LO9A 3OKDA 4OQ1A 1A1NA 2DQCH 3FU6A 4J23A 4G6JL 3RDTC 4UANA 3TJHD 2D7NA 5F89B 5I1JL 3DRTB 1XSKA 4UQDA 1PIGA 1II4E 1DQLL 2BY1A 1TJHH 1F1AA 4H4NA 4R7NA 4X4MA 2APTA 2M83A 4X42A 2ADJA 1S9XA 2HRLA 4RMSA 1CZ8H 4LCVA 1E28A 4QRPE 1FI8C 3NH7H 1FORL 1PZ3A 3IKCA 3MCLL 4R4NC 4TQEH 2DH2A 4BDVA 4FTVA 4DHLA 2M26A 3BKCH 3P3YA 4XMLL 4G7RB 3ZHNA 3VDAA 3ZTNH 1JG9A 4DEWA 5CJOL 3NZUA 2XKUA 4KMTL 3EJYC 4QHKJ 2HRGA 1M53A 3CFJB 3NFSH 5IW3A 1M56B 2VLRB 3BPCB 3DK0A 1XR9A 1I4FA 3OAYH 5IHLB 3FT3A 1P8IA 2BS71 4HCFA 5F3FA 3DIFA 1AJ7H 3MUZ1 1PNCA 2JKXA 2Y25A 3U7WL 2L3BA 4N8PA 2JJTC 4G71B 3QUKB 2WLKA 2PO6C 2ZKYA 2VGLM 1DTUA 2DQJL 4W70A 3GDBA 5DTFB 1OCRB 4ZXBC 1W15A 2NY2D 1URLA 3OGCA 1XJIA 3V6BR 1G7JB 4Z5RA 3B7TA 2EACA 1I7RA 4Z7VE 4I2XE 3PE9A 3BWZA 2CCLA 5BRZA 3L7FB 3N6YA 4PU2A 1UWXK 4MQ7B 2R0WL 5DUPL 4G5ZL 4WWPA 4YBLC 4RMVA 5BUAA 4ZT1A 5BVPH 3I74A 2I35A 3KGSA 2VKWA 3KDMB 2VE6A 5CEXB 1WAAF 3FSOA 2H47C 4DSYA 1HYSD 2P26A 4L4VD 1E6JL 1G7IA 2WAQA 4PJ8A 5C0FA 4L18A 3RL2B 4APQC 3A4DA 2Y5TB 5CJ8A 1HWGB 3MLWH 3GM8A 2QGBA 4OY9A 1MREH 3DX1A 3A47A 1ZLWH 5C0IA 4D94A 1JD7A 5CILH 4ZFOL 1JGLL 3JWNH 4G43A 1HAUA 4UM8B 3GMPA 2DB8A 2WN3A 3CSYB 4J6RL 2JJUA 4PRPE 2DQEH 3PPEA 2WCPA 2WLJA 1T1ZB 1UZGA 2CBMA 3VXOA 1MCBA 5FYJD 3IMRA 4MBSA 4LSVL 3DPBB 3MRQB 4BA0A 2VSKB 3VD2A 2DQGL 3F83A 1DBKL 5LXGL 3RTQB 2WUCL 2NY5H 1A6TA 3W38A 1BZDA 1XMWA 4DTGL 2YAEA 4J3OD 5FGBA 4KI1A 1SM3L 5AALA 4L1HA 1TKWB 4AGLA 2F18A 1MFUA 1VEOA 4BJLA 2A83B 3SGDI 1OAXH 3RL1A 1T6VN 3T4YB 2H32A 5D93C 4HYJA 3TJHC 2VERA 4N2DA 2WWKO 4GKZB 5GS0D 4JE0A 4ANKA 5FFOA 4RGNB 3IPFA 4JFED 1QZ1A 1CFQA 1NMBH 3FSWA 2YBGA 3B83A 4K71B 1O6SB 3HZYB 4ABVA 4MJHA 3L3HB 3P4MA 1K4CA 3QARA 5G2AA 4FFZA 2OLDA 4ZS7H 2OR8A 2CR0A 4H8QA 5SWZA 3LKOA 1S5HB 5B3NA 4B9YA 1KIPB 5I1HL 5IJBC 1KPVA 3VNYA 7FABL 3VW7A 4E9VA 3OF6D 2IO5A 3JWOH 1ZLDA 2JKLA 3PUCA 5I66A 2O61B 4W9HC 2HJFB 3UJJL 5ICYB 3GUTB 1WLHA 1SLUA 3VFGL 4IBUA 3ZZ1A 4W9CC 1MCRA 4J8RA 4WO4C 4AUYA 3RWCB 2G2RB 3D2UA 3SGEI 1BLNA 2ZPKH 3PQYB 3RJDA 1FNGA 1AHWC 3P30L 4F33A 1SN0A 3V0VB 3WNIA 4OGXH 3C9NB 2R2HA 3SKMA 4PGBB 3W9DA 2O5NA 3U4KA 3LNHA 4ODUB 1UXSB 2EYSA 5B7MA 2NY2C 3N55A 4FXKC 5CJ5A 1FPTL 3TT1H 2UVFA 1X5AA 2FNBA 4JZNA 5EMYA 3U6XA 4ZW7A 4OVUA 1XGYH 1CICB 1U9KA 5GGSA 1X0SA 2NUPB 3FFCD 2Y07H 3KM1A 2V3EA 5BUPA 1YYML 5CF3A 4YXKL 1AZZC 3QHFL 3DXAE 1Z9PA 2ZXQA 1HYSC 2HX7A 3LNEA 1M42A 4FBZA 2CDFA 3POCA 3CVDA 2OMTB 1MG3C 4WU5B 2VDPH 3H9HA 3SY0B 2APWA 3LH9A 1S9YA 3AXIA 5IHZB 3QSKB 2FCBA 3KPLA 4HPOL 2O5YH 4MJ2A 4NQXA 1HK6A 2EDEA 4K5LA 5DFWH 2Y69B 5E2WL 4F5CE 1LL1A 4KXZI 4GAAA 1XZWA 2IXQA 3GXTA 4WI0A 2WIIA 4AGPA 2YDVA 5LCVH 1YZZA 3FZUD 4F9LC 1IGMH 2VXSL 1MH5B 2YPVL 1XO8A 3P11L 3NTCL 2O5XL 3LNIA 1R47A 4PGZA 5E1HB 1FHGA 3OR6B 5DZOA 15C8H 1HKLH 4QPEA 3VWKA 1OB1A 2VXQL 1E5YA 2X6BA 3CDGB 3CNKA 3UZQB 3SE8H 1IX2A 3SDDD 1ULVA 2OP4H 3MFFA 3WEOA 1M0KA 1ND0A 1RIVL 3LD8B 1JZ8A 4XCCL 1E6OH 1DBBL 5KEZA 5ISZD 1AMYA 2Y1VA 4KJPD 2EQDA 5C92A 4Q58C 3TBYA 1X4XA 5F0MB 4E0RB 5FW7A 4XNQB 5LWEA 2ADIA 2FDBP 5KYWA 2DQUL 3F00A 3BRDA 1RAMA 3KCPB 1KIRB 1DLHB 2YEQA 2Z1PA 1ACYH 3TS8A 5C0BA 2HCZX 4TQPA 1N2RB 2A0LD 1HE8A 4N8CH 3HARA 1T4WA 3ARYA 4I0KA 4R90H 5C08D 4S11A 3OAUL 4GBRA 4HK3N 5I6OA 3P73B 3LKPA 3DX2A 4JHWL 5FUOL 5I16B 1IKNC 3BAEL 2EDTA 2LU3A 2B5IB 3WY2A 1YEGH 3NIGB 1W72B 4R96B 1Z9NA 4AUUA 1QA9B 3AYMA 1BEXA 3UYOD 3EHBD 5HVGB 5HPMB 3QZBA 1NCJA 4ZMYA 1U95A 1D9KB 4PGDB 4HEMA 4U6VH 5I1EL 2NUTA 3CX5J 3JVGC 2NXYD 1S7XB 4F8LA 2FTAA 3FMGL 3GBDA 1PIFA 5IVXF 2H1PL 1DSFL 1WIPA 3P77A 1L3NA 3RWGB 4GRWH 3LQZA 2V5YA 5I6MA 3UXFA 1HS6A 1JNHB 2ESVB 3TBSB 3ZHKA 5AOZA 1MI5A 3SKNA 3NYKA 4D8PB 1FBBA 3L5XL 3HBGA 2GJJA 4R7DB 4MD2A 1CLVA 2FB4L 1B0RA 5HDQL 3H7BA 5ESVB 3QAQA 3DGGB 3DVNB 1KOAA 1U8KB 2DJSA 4L8DA 3CN0A 2YO3A 4H1LH 1W0VA 2VSMB 2XY1A 3EYSL 2V6HA 4LOUD 1E5BA 4YSAA 1U8QB 4YBQD 2TRYA 3SQBA 5DD1L 4HH9A 2X1QA 2UWEE 4KZEH 4RGMB 3GMNB 1BQHG 3PWPB 5HSFA 3WJLA 4XWGL 2CPCA 3RWHA 1OTUD 3NACL 1MNUH 2XWRA 1DVYA 2JE8A 3CK0H 2VN5A 5AYUL 4FYTA 2P42B 3GSXA 4XN1A 2AK4D 4OSUL 5BO0D 3MLYH 4PBWD 4WGWB 1OAJA 2DQTL 4LL1A 4UQ3A 5E1AB 4Z7WF 5F6IC 1WWCA 3FZUC 5IBUB 4GKSA 5INCB 3REWA 4X6DF 1ZOXA 4LEXL 4FA8A 4JY4B 4NP4H 2BNUB 1P7BA 4R0LC 1AO7B 2AEIT 2BIQA 4DGYL 2KKQA 5F1SA 3H3KA 1FBIL 2I9TB 4E42B 1LO5B 4LDOA 3VI4E 1QR1A 3BE1L 4DKFH 1PDKB 2WNKA 3JWNE 4G7VH 5CO1A 4JO2H 4HU2A 5BO1L 3MV7B 2QVIA 4KKAD 4LHUA 5E2TH 2XNAA 1RJZB 3AT8A 4DVBB 5BV7L 3MNVA 1J9CT 1UA6H 3QAPA 1PCXA 1MHHA 3HR6A 5I71C 5F3BA 4KJPC 1D6EA 3GKWH 2IBZY 2QTEA 4XZUA 1T5WB 5DJ0A 4GKNA 1OARL 5CEYA 1M7IA 5DFTA 3MGAA 5A16B 1A66A 4NN7B 2VDOB 3FTSA 3O3BB 2X70B 4JN2B 4YAQA 4YXLL 4YS4A 4G1EA 2A0LC 1T7ZA 4ZMZA 4UU9A 4QEGA 4FDWA 3SDAD 5CD3B 1L9QA 1YNKL 1V05A 32C2A 3NEEA 3ZE2E 2ADFL 2VISB 1UB5A 4EMZA 2FGZA 1QRNB 2BS8A 2YPLE 4ZYKA 4JQIA 3EO9L 3N42B 4QTIL 3D85A 4CL7A 4KHTL 3EHBC 1FZKB 1CU4L 3ZRCC 3QEGL 4ZO6A 2Q5BA 1S7RA 3AB0C 4TVPL 3C8HA 3HR5B 4I8DA 1G0DA 2XXFA 3MRPB 2A74A 1KPUB 1FRGL 2VAJA 2X38A 3KW7A 3VA6A 4HBCH 3ZUCA 2PCYA 1MCDA 2E8ZA 1Q0XH 2VN7A 4BZ1A 1IRAY 1IBYA 3BD5A 3TVMB 4U1NB 3OHXB 2IANB 3A5VA 3HKFA 4X6FB 5I1LA 4MAYC 3LKNA 2AW2A 4M6NH 1Q94B 4KKLD 4G83A 1TVBA 3GBNH 2DV6A 4ZFGL 4HIPA 3IB4A 4QRPA 1AI1L 5FR3A 3V55A 2ZZLA 3PDSA 2CUAA 3GZOA 1V7NL 4GPOA 1MCFA 5H2NA 1PW3A 2ATKB 5E00B 4NI3A 3V7AE 3L48A 5MI0B 1QUNB 4FKKA 3EFFB 5JXAL 2ITFA 2BZ7A 2MRYA 5H2MA 4KY2A 4LOUC 1AIFA 1M1XA 3TBBA 3UBFA 3EH5B 4YBQC 2Z35B 5F9AC 2YBRB 3IETA 5JUEH 2GK0A 4AZUA 1W8NA 1DJSA 1KN4L 3VE0B 2HLFD 1GVIA 1ET7A 2BSRB 5H2BB 4MXVE 4Z3IA 3TN0A 1JGDB 1KBPA 4JANA 5I8OH 4PJEE 2L6XA 5BR5A 3C2SA 4RFNB 4ZUTB 3L3OC 3F62A 4J3UA 4LPUA 4Y9HA 4N90D 5CU5A 3UGEA 2Q6WB 3P3TA 4YGAB 4ZUUA 5JHDB 3ARED 2X2YA 4XMWA 3O3AB 4M7JL 3GMLA 5JQHC 4NQDD 1LK2A 4OKDA 1F4WL 2PW2B 3VM7A 1IW6A 1F18A 2FX8L 4EQ3A 2VDRH 4I2XA 4IOIA 4Z7VA 4FEIA 4EN3A 1TN5A 4I48B 4KKAC 4M93C 3V6ZB 1Y6MR 2Q7AA 4R26L 4MB5A 5HVFB 4AM0B 3EYVB 5FYLL 3U2SA 3O6KH 4W81A 5FHBH 4OLYH 1FN4A 3QI9D 4WHYG 5K9OA 4Z95H 2CD0A 1A3ZA 2BRRL 2JVUA 4E9RA 3HRZC 1DVFB 1S2EA 1FIGH 2ZSWB 4KRMB 1ADQH 3EO0A 1CLZH 4UNIA 2OAAA 1UYWH 1K2DA 4CN1A 2XV3A 2EYRA 5F7EH 1QNZH 1JE6A 4HETA 2D3NA 2BSDA 4PRPA 2ZP0T 5HHOB 4Q9RH 4NCC2 3X3GL 3DX7B 3O0LA 2YGVA 1E5ZA 4PW9A 3FN9A 5EC2A 4O5LH 3VYPA 4PY8J 2B2XL 4LCWD 3RZCB 1EO8H 1AFVH 2DQHH 1QKPA 2H41A 4O2EB 3V0WH 3LOWA 3ZE0F 5JOPD 2NTFA 4XWOD 1TMQA 3KCWA 3SD5A 3SYPA 4WCYH 3N3EA 2BSEA 5DFVD 3MXWH 5HJGA 4LNRA 3T0EE 1JCKA 1QWNA 1XHHA 4NSKA 2ZXWB 4N3TA 5L4MA 4I3SH 4ZSOB 1I7ZB 1UTDA 3F7LA 2YC1B 2ADGB 1S7SA 2FSDA 5B7EA 2G5BB 1A7QH 5DVMA 1MWAL 2C3GA 3H3PH 5HYJE 2AS5M 4ZPVA 3P9MA 4XVJL 2OMUA 1V3LA 3D12B 1NCBL 5CS7A 4E5XG 1A9EA 4M4RA 3WEMA 2VXVH 2X3BA 4LASL 5I15H 2NY6D 1B4JH 3B6SA 4WKXA 2M1KA 1N10A 1NINA 3OKEB 5KBMA 5CSZB 3KLAA 4H20L 2EO9A 5CJQH 2WBJB 5SX4H 4GRWE 2R69A 1IGYA 5FCUH 4MJ6A 1HEZA 4FQXD 5E4EC 4A2LA 3LV3B 5F9DC 5J1AA 4G6MH 3VWJB 2WAHA 2YGOA 3P0YH 5B8CB 2HLFC 1JWUB 3LQAH 3E9UA 1OSZB 3BGFC 3INUL 1E2WA 1FFRA 3CFKA 4XAKD 3ZL2A 5IW1A 1NLDL 5I1CL 2VJXA 4J4PD 2YSSA 2ZUUA 4GSQA 5CR8A 5B4MD 5FDWA 4KX7A 3B2DC 3NGBC 3UTTE 3FQWA 1TQBB 1ZT4B 2HPOA 1TYEB 3CUPB 5C3TA 1ZRUA 4GQ9H 5GXBB 3S9DB 1AANA 2C1OB 3GMOB 3REVB 3SKOA 3ULVH 2J1WA 1EIBA 4OFYA 5FC9A 1BGXL 3PJLA 1MKFA 1E8ZA 2EIZB 3AREC 3UAJD 4RMRA 1QD0A 4PYGA 3LIZA 5C0DB 3CVIH 4KK9C 4JQ6A 2Q7YA 4OLUH 1MHCA 3ZE1F 1IAIL 3W9EA 2PXYB 4PXKA 4PR5A 5B1JC 3EJQA 1CVSC 1E4HA 2ICWI 4FG4A 1WG3A 3ASWA 3QO0B 1YJDC 4HWBL 4ZI8A 3JZYA 3QUZA 5DHXB 4JFYA 1JFPA 4YDKL 1JF1B 5GGRA 3RGVC 3RY6A 1Z6JT 4I13B 5CP7B 3DXAA 2XZQH 3BZ4A 3QI9C 5D5MF 4FLRA 1RUAH 3HI6H 1SJEA 2GTZB 1Q90A 3IDYB 5IFAL 3WD5L 2J4WL 1AZRA 2FJGA 2BVTA 2PTVA 1MEXL 5JW4M 3EOYG 4ODTL 4DT2A 4L8SB 3IGLA 3PWUA 2BWIA 4ONOA 4ZFFA 2J6WA 3OR7B 4I88A 2P52A 4F5CA 4U2YA 1HAWA 3U0PA 1KB5A 1NKGA 2D31A 4PLKD 3CCHA 4FP8L 1KLFA 3HJEA 4MB1A 3SQRA 4HC1H 1X5ZA 4XP5L 3QCUH 5DVLA 4R97B 4UMGA 3U7YH 3FUFA 2BSBA 2VL5B 4P46B 4L4TD 4N68A 2CHWA 2CO7A 2E27L 1F50A 2V3FA 1X44A 4GUPA 2MMXA 4WWID 1KBGH 1DZ0A 5DFVC 1IC4L 1IAOA 4X9FA 4FLOA 3S34L 5E8NB 1J05B 5F9JA 2P9RA 5F0LB 1JJUA 5CIPB 5EU7C 3T0BA 2C7FA 3S3PA 2NY1B 5B39A 3S4SB 2KC0A 3BPOC 2C9SA 2L0DA 1TTUA 1SY6A 4DZBA 1GGCL 1M9SA 1G6VK 2WXFA 1T89A 3MN8A 2N01B 3FYEB 3SBWC 1U30A 3I3DA 5I8EB 5GHWL 5H2PA 1JYWA 4LB8A 4UQ2B 2NY6C 5DQJA 3VRIA 1KV3A 3QPQD 2AGJH 3LS4H 2OZ4H 3O3EB 1F90L 3ASNB 4QRTB 2WZPA 4M43L 3DURA 4JG9A 5DLMH 4BFJA 3VRLE 2ARJA 3TU6A 3V95A 4NPYA 4FQXC 3DA0A 4MFHA 4ATWA 2BDNL 3MRJB 4U7MA 4B96A 1MCPL 3SGJA 3CLEH 3F05A 4U1JB 3UMNA 2UY6B 2JK5A 3PL6B 1MHPL 2XSKA 1HHHA 4JVUA 3CFIC 2Y7MA 2YD4A 1IEAB 4PREA 4Q6IC 4ZOEA 3TO2B 5MHSE 5B4MC 4OR1A 2WXIA 4CC1A 2IWFA 3QDJE 4FNQA 3D18A 3SBRA 5HHXH 4GEIA 5I1IH 1CT8A 2BNQB 5DUML 2JAGA 1JFQL 2MFNA 1A7NL 4MQTA 3FSZA 1FC2D 4GQQA 5DJ6A 3VUAA 1HCYA 1Q72H 4UB0L 5DRZB 5FYLD 3SE9H 3CFEB 2YRBA 1BOGA 2Z7WA 3UAJC 1PL3A 5IEHA 2OTWA 4NOFA 2JWYA 2BCKA 1RUQH 4XT1A 4JREC 1Q9WB 5ID1A 5BOPA 1HSAB 2GSMB 1TZGH 3RVTD 3T6WA 2O1AA 4HP5A 2EAEA 4K5MA 1QM8A 1X4YA 5TDOB 4H2CA 1N18A 2VR8A 3GXUB 4NERA 4YHNB 2GIMA 3WLBB 4LCYA 1NCCH 1GY2A 2GI7A 1QFPA 3F5WA 3G6JE 1GYAA 3T5WA 2EABA 3ZW3A 3T2PA 1MFDH 1URZA 3RUGE 3BVWA 4G8FA 3VH8A 4L37B 3CX2A 5K9JH 2ZIDA 4WW2A 3V4PA 2UWEA 1BZEA 1I3RA 4ONFL 5GGVY 2OR9L 4PXFA 4JL2A 2EEXA 1F4XL 4CADA 2Q2LA 4OLVH 4YE4H 4NUJB 3R4RA 1UFGA 1HCVA 4JRXD 3P9LB 1GAFL 1FFNA 3OJDB 5C97A 2RFXB 3M1OA 4KRPB 3DV4B 1V5JA 2Q76A 5IMLA 4PLKC 3QC5X 1EHKB 5C1MA 3A0OA 2XWBB 5IQNA 1HXYA 4K55A 1KFAH 3RPIB 2NY3D 4F7TA 4OZGE 3WNJA 1MXDA 4JY5H 1BF2A 1KCVL 2GJPA 3ZDYE 4F93B 4MSWA 3C6SA 4UUJB 4G8IA 1BVKA 3VI4A 3QWRA 5D6DA 4QI3A 3L08A 2XPGA 4PLJD 1W72H 2Y7LA 1U6AL 2DYPB 4N20A 2VXUL 2G4EA 3H2QA 2XWZA 3GSWB 1F41A 3RE0A 1EAQA 5F44A 2D7TL 2ITCB 4KWUA 2A9AA 2FT8A 3MV01 3W11D 3H0TB 4E68A 5ICXA 1IKFH 4LLDB 1P7QB 3FYIB 4FQJL 4JZOA 2UYLB 2Z34A 4A7UA 1QFOA 4OGYH 5E24E 1SEBB 2V37A 3W81A 3RWEA 3KJ6H 3PHQB 4R4BA 3S36H 2VMFA 4OCYL 3QJZA 2IFGA 3MKKA 1YDPA 4KUCD 2CALA 5IV2B 1F11B 4ABWA 5IMOA 1XBRA 3UDWC 5AD0B 2P5WD 3C5ZD 3C6LA 3OSKA 5GS3A 1D7CA 3D25A 2YPLA 5DJXB 2CM5A 4NJAL 1EJ6A 1X9LA 2HRPH 3K8LA 4KXBA 2ZE0A 1GYUA 2VDLB 1KLGA 3L6FB 1TCRA 3PGCA 1Q9LB 1MCNA 1FL5A 4OQTH 2BIOA 2RHEA 3DHMA 4M6ML 2NCMA 3FT4A 4G6AC 3UROR 3DROA 3P2DA 1GW0A 3U4EA 2MTPA 3D0LA 3DTXA 4XP9H 5A2BA 4GRVA 2APFA 2IPKB 3D05A 1CG9A 4GXUM 4F3FB 5T1LD 2GVYA 4OB5H 1LEGA 5BW7C 1VCAA 3RA7H 4G42A 2K3TA 2NY7H 4NC1C 5JMOC 4CVZB 4X98B 3QIBA 4EZLA 1CE6A 4YLBA 2IWKA 3E3QC 5AZEL 5IMMA 1SUHA 3RVTC 1ETZB 1IFHL 3UG3A 4WWOA 2B39A 2GBAA 4M3KB 4WW2F 2UWEF 4LPXA 1JGVL 4HIQA 3V6FA 3M6DA 2F1BA 3NCBB 3K71B 3ZO0A 4MCYB 1XDTT 2FD6L 3GJFB 4L5FL 3ULVE 3US1A 3SJVD 2IPTH 4PRBB 2YMXH 3CDZB 4HIIB 5K33A 5J9PA 3QBKA 4QIDA 5A2JH 4GG8A 2DQDH 3DGCR 2RCSL 3PU7A 1BLIA 4TUOA 5F8QC 4CU7A 4UIMA 3FU7B 3V0IA 3PXOA 3DTUB 2W38A 2FWOB 1YY8A 4AGNA 4PRHD 2EVJA 3H4HA 3QBGA 1PZ2A 2Y02A 2R2EB 3KWTA 5LWYH 3NEOA 1GZHC 1HINL 3ZTJH 5FGCB 2QSCH 1WZAA 4PJEA 4F7CB 1AXSB 2VDOH 4Z0XB 4WIQA 4TLTA 2FECI 3VFTB 1KJ2H 3T2NL 5JPMB 4PQXA 1U8PA 2DLIA 3BSZH 2VLLA 2ZXEB 5FYKH 3SDYL 3AMLA 3FTYA 3IFNL 1DE4B 4PJDB 2CQVA 2NY3C 1BRDA 4CJ0A 1MLBA 1OZUA 4CDGC 3F6LA 5INDB 3GWJA 4K15A 3CZEA 1J1PH 1KIQA 5DJ8B 2XX1A 5IHUL 4OD2A 1KCKA 4WHCA 5D2NB 4QRAA 4NZJA 5D1ZD 3VFUB 1URIA 3QRBA 3S37X 1OGAB 5KSVA 3NSCA 5ITFB 1SDDA 4POUB 1IJ9A 4YDJB 5LCVA 1A6ZB 3AABA 1CF8L 4DKLA 1A9BB 4JVWA 2AEWA 1XVSA 3VI3A 3QISA 4BA8A 1WT5A 2H1XA 3B4NA 2OL3H 3LZQA 3N04A 5IFJB 4ZFOB 5ECJE 3W11C 3NIDB 1X6LA 3MMEA 4ODSH 3DOSA 2Y1YA 2CR3A 4QMEA 3AW5A 3VXSD 3ZDZB 4WUUD 4HOXA 2HH0L 1UADC 4M00A 2VN6A 3MO1A 2AANA 4CSZA 1OP5K 5HBBA 2FWUA 1XGPB 2FO4A 4YFLF 2AJXH 1L9MA 1AGDB 5B1KA 4NYLA 4HCIA 1F8TL 1PBYA 2H6UA 3C5ZC 4LHUG 4UM9A 4HK3J 1R3IL 4D3CL 1BRXA 4OCWL 2EIKB 3PQYE 5A2KH 1DYZA 3Q43A 5D1XD 4FERA 1NUGA 5AW0B 2WYTA 3TIDA 3EZJB 1C16A 1A6AB 1BX2B 3FQTB 5ACMA 4BUHA 4U0RC 3AWGA 4ODVL 4MA1C 3COCA 2FEJA 1VFBB 3N0PB 5J6GB 5C0JB 3W39B 5MEPB 4BXVA 3T0EA 2F5BH 2ZP8A 5E7BA 2Z91B 3WNPA 1A7RL 1N8ZB 3GRBA 4M56A 4NLHA 3PNWA 1EMTH 1Z3GL 3IDGB 4LBEA 4RSVA 1IAKB 2R9HD 5HYJA 4FQLL 3U9UA 2AQSA 4AQ8A 2GB2A 2XBZA 2E4TA 5GZOD 3TV8A 2LTQB 4ZZKA 4F2MB 2KPNA 3KE0A 4XPAL 5EU6B 2WB1A 1ZJAA 2F6AA 3IU3A 3L3KB 3KYOA 5EZIL 2LVEA 4BZ2H 3PDOA 5E8DL 4GP8B 2H3NB 3GMQA 3JWDL 5EH1A 4G80A 4WEBL 2AJ3A 3C8KA 5G5DA 1FSKC 2A4EA 1WCBB 2WXRA 3DLQR 1LK3L 4UTAA 3RI5F 4WF7A 2J2ZB 2IQ9H 3WG7B 2DQFB 2KDGA 2Q3XA 2V17H 5FLUA 4HV8A 4P9ML 4GG6B 5E4IA 3C60C 3PWLB 5DMIH 1Z9MA 1A25A 1HKFA 1WIOA 3WHE1 1P6AB 3L3DA 2B4CC 4OCXH 2GFBB 4JKPL 4QAWA 4DFIA 2BXZA 3SZKC 1JPGA 1QO3A 4JM2D 2NNFA 3Q8AA 1DLFL 3T0AA 3EFOB 1VADA 3D2TA 5HDBB 3UTTA 2YIHA 3UCQA 1BFVL 2CDEB 4TTGA 4H1LA 4NHUA 4UQBA 1OGTA 5FJGA 1IQWL 3BAYA 1N9PA 2WSDA 3Q13A 4Y4FD 4F20A 1QNIA 4DW2H 4FFYL 3VI3F 1F4ZA 2DS4A 2X4TA 4Y1AB 3WXVL 5CINL 1BM1A 2D2OA 1HXMB 1RZJC 1E9QA 3R0NA 3MNWB 1NFIB 2NZ9D 1KDJA 5TE4L 5JORA 2BRDA 2WTRA 5D1ZC 3B9KB 1E4XI 3CN1A 2XXCB 4N8VA 3WBDA 4GRLB 2WQVA 4L1BA 3C08L 3EYQC 2N4IA 3WU1A 4PJCA 5JR1L 2BVQB 2JB6A 3B37A 4G59C 3LHPH 4XCYB 1E67A 2J88L 5C0CB 3IE4A 4UT7L 1DBAL 4XCFL 1NAML 3QIWB 3CVHL 3QEQD 5DK2A 4MJID 4ANXA 3WFEL 2OJZH 3NIGE 4EKXA 3ZYJA 4X5WB 5GS1B 3MGOB 1NAKL 2GT9A 1JNLH 3DVGA 5MENE 4P23B 2D4DA 4BSWA 3CAFA 3W5MA 2UXGA 2E46A 2P24A 2K45A 1BIIA 3UFIA 2L7UA 4FNTA 2HFEA 1W2KT 4LHJB 2X6CA 4PRNA 1A0QL 3B3IA 4IKLA 5EO0B 4Y19E 3WMQA 3WSQL 4UWQB 5ALCH 3TBWB 2EILB 3CMOH 2WJLA 2ESVE 4NQEB 4RDBA 4F58H 1XGRA 2VLJE 3MLRH 2MPAH 4XNYH 3BLBA 2WQAA 1UM4L 5JOFA 2Y23A 1Z0MA 2W80C 4P04A 5I30H 1Q4NX 5HGGS 5HDOA 3SSGA 4Z23A 2DWYA 2ICEB 4TNVF 1Y1UA 2CCVA 3OJMB 2B0SL 3PDGA 1FDLH 5B7FA 1G7LB 2EC9U 4ZG1A 4KY1L 1JPTH 2R9HC 4E36A 4AVHA 3ZGHA 2UUDH 2Z7YA 3ULUE 3IAPA 5TDPA 2R8SL 5C07B 4EPSA 1GS6X 2FLRT 5GZOC 3FQYA 4FPDA 1A7BA 1EFXB 2QQKH 5DD3L 5DRNA 1XCWA 4LEEA 1RZKL 2QVFB 2X7LB 3S98A 1MRCL 2V33A 4FQIL 1GYWA 3O2WH 1HHGA 3SCMB 4U0QB 2V7HA 5LGJA 3VFPA 1QSED 1WICA 4M5YL 1PYWA 4NWTL 4U6YB 4X7TA 1HDMB 1KJMA 5D71L 1EBPA 1S7WB 3MROA 5EBWA 1SGKA 1AS6A 1J9SA 3CHRA 4P3DA 5DZLA 1N64L 1I1RA 3MNZA 1YC7A 2P7TA 3O8XC 3U0WH 1AO7E 3BWUF 3T4AA 3TZVA 4S1SL 4BE5A 1NMAH 3QDJA 1KMGA 3P9WB 1L7IL 1JOIA 3MV7E 4IKKA 5FM8A 2W07A 3CBJB 4Y4FC 3ZMRA 3X12A 1W8EA 1IC1A 2PP7A 3BDXA 1HHIA 2IF7A 1MLCA 4NQSA 4RAVA 5AW1B 3QDHA 1MJUL 4WK0B 4YDVA 5SX5H 4PJCF 5KSUB 2UXVA 1OXYA 4KFMA 1NBYA 5AQ0A 2Z31C 2DRUA 4Y5VC 5FKAB 1HEJC 3HC0B 2NZ9C 4BUQA 3QYMA 3TWYA 3DOHA 5GGSY 3FQNA 4XP1H 5E4AA 2ZYIA 5C7ZA 4ZUVB 4XTRD 1X9UA 3SOTA 5EBLB 4JPIB 2HRHA 4I18A 4MZ2A 3HE7A 5FYKE 3NJLA 3QJFA 2DIEA 4HJJL 3G6JA 4RMUA 4GEJA 3DDGA 4OZIB 4W4NA 1QMUA 1BVNT 5I0DA 3RUGA 2I07B 2P8MB 3ETSA 4U3CA 4V1DD 5CIPH 1EXHA 5DMKB 1QRNE 4QRQA 3EGSB 1M2VB 3WKNA 5E95B 1DFBH 1HZXA 2WINB 5I1GH 1NKRA 3L1FA 4LDLB 5ESQB 3VVWA 1ETJA 4MJJA 2GQHA 4U31A 2PF6A 1XF5B 2VDKB 1INDL 1FZJA 5DZVA 2B08A 3IDNB 1MVUA 2QV4A 3I9PA 3VX0A 1V7ML 5H4YA 4X0KA 2GSIB 1OQOA 2MTAA 3D0VA 5TQ2L 3SQOL 4BFGA 2EICA 1IBBA 2QV2A 1YYLH 4UV7H 2CK0L 2BERA 4OZGA 5F89A 5BV7B 3BGAA 1UZ8A 2WLHA 5DA0B 3Q8FA 1WE5A 5GRJL 4HS8H 3WV0A 1D5XB 2P8PB 3H9SD 4X8JA 4KOBA 1NC4D 4KTEL 1NCWL 3VG0H 3WJMA 4AQ1C 1XTLA 3AY4C 5KVDL 1UCBL 3JBG7 5DMYA 3LH8A 1CWVA 3P69A 4XE5B 5IW6B 4XN4A 3TEXA 1FJ1B 3I6GB 3M46A 1RY7B 5KJRH 1L0QA 3OL2A 4N5ED 5F93C 3KMDA 3SBPA 1IC5H 3WFZA 4ODXB 1CBVH 3O9WD 3CFJA 2ERJC 1A8JH 1AKJB 1P1ZA 5DVPA 5AWNH 2QVTA 1OCWH 1GGIL 3AITA 5GS0H 1TYJA 1YEDA 3QBLA 1RP8A 3MYJA 3WOVA 2AK1H 4RFEB 2Y00A 5AB9A 1SF5A 4JFUA 2AV1B 5E2VL 4AQZA 1LWRA 4JGUA 5DZJA 5B39G 3UJTL 2BC4A 1V3MA 3GJFK 3QUKA 3R19A 1NBVL 3CZSA 4B50A 3B2XA 4FZEH 1R5IA 3FB5B 1MCCA 4LSTL 4EI6B 1E42A 3KBPA 1ZANH 1G7JA 4YZWA 1N0XH 1DDHB 2E59A 3I02A 4YXHH 3NCXA 5EHFA 2FEEI 3D0AA 4EIZC 5KANG 3L7FA 3NPSB 5JLZA 3AU1B 2O93L 3G6JF 4MNGA 3W2DH 5CEZD 3GMMA 3KDMA 3BPLC 4QXGH 3UYPB 5CEXA 1UD4A 2Y7SA 1KCSH 3QO1B 4QRRD 5F8RC 4E41E 2WXNA 3E0GA 3U1PA 3NA9L 4WTQA 2LT9A 1T4KA 2DQIH 4CN4A 1GS7A 3T3PB 4NC2B 3LQMA 5HHMB 5SWSD 3L95A 4K5PA 4UM8A 3RI5K 3ORJA 4FG0A 2ZAHA 3MRNA 4LLMB 5F3HA 4IRSD 5HHOE 2IAMD 1MGYA 1XCTB 5BS0B 5G2CA 3DWTA 1KACB 4K94H 1ZV9A 4DGVH 4OZGF 5FWRA 3RNKB 1HIML 2QQNH 2WXMA 3DPBA 3MRQA 3QCTL 4YC2C 3S88H 3RTQA 3NCJH 2OMWB 5K9QG 1ZXQA 2IG2H 4I9XA 1UH3A 4UQ9A 3F65A 1MW2A 2V0AA 2Q3ZA 1TKWA 4MNHB 4MDJA 2IMMA 2ZOKA 4G6FB 5JJEA 1KCUH 1GC1C 3E6FB 4ZSOE 4Z3JA 4DAJA 3F7YB 4M1DL 4NRZB 4GKZA 1M7UA 4WFEE 5DJYB 3U30B 3IXTB 3VH8G 5HGAB 1EK3A 5BZXA 4PJXB 2P1YA 2YN5A 1CJYA 2JIXB 3HA0A 5GGUB 3HZYA 4R7XA 1GXEA 1O7VA 2VDQL 1JYNA 5JYMA 3WKYA 3L3HA 4ABQA 2GYSA 4G6JH 1GYCA 1G43A 5I1JH 4HC1A 1GRWA 2Q9OA 1DQLH 4Z78B 3A22A 1U8IB 4GQPH 1T21A 3HS0C 3L7EA 4QHNB 4GSDL 3AUVA 1QTSA 3J8F7 1KIPA 4DF9A 1FORH 3MCLH 4MBOA 4OBRA 2PYFB