3S3DB

Structure of thermus thermophilus cytochrome ba3 oxidase 480s after xe depressurization
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Mobility of Xe atoms within the oxygen diffusion channel of cytochrome ba(3) oxidase.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s3dB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s3dB02
2Z55A 1A4BA 2IWKA 3HEIB 5B1JA 4E9SA 4BDVB 2GB2A 7PCYA 2AFNA 3NSCA 1BQKA 2R7EB 4YSDA 2J57A 1GR7A 1L9OA 3PLYA 5H2LA 1ILSA 1M0MA 1SNRA 2QDWA 2XXGA 2XV0A 4L35A 3S3CB 3FU7B 1PCSA 1S52A 2G87A 2WO3B 1A65A 3WKQA 3HANA 2ZONA 4NAJA 3CVCA 3NP3A 1PLBA 2EIJB 1E0PA 5BR5A 1KBWA 3N55A 2HPYA 4GP4B 4MD1A 1NIAA 1IBZA 5A8EA 3QJSB 1CUOA 2NTUA 2VSKB 4GY4A 1Q5IA 1S51A 1JOIA 3NT0A 3S3BB 1AZNA 2R4SA 3DDLA 4AKQA 2J55A 3QPKA 3FSZA 3OE6A 1IC0A 2PPAA 1GW0A 2NRDA 2PP9A 4RH4A 2OV0A 1PLCA 5G2CA 3BVDB 3T71A 1BYPA 3FT0A 1J5DA 2X72A 4IARA 1HAWA 3QJVB 3UTWA 4BWBA 1DZ0A 1NIEA 3AM6A 4DP1X 1RZQA 2MTAA 1ASPA 5H2PA 4XT1A 2GBAA 3AG3B 3REYA 4FAAB 1A8ZA 3CDZA 2I20A 5I6NA 4MBSA 4G71B 4GBRA 1JZHA 3NJJA 5J7AA 2BWIA 2I35A 3RZEA 3ASNB 5H2MA 3ZPRA 3OQRA 2LNLA 1NIBA 4E9WA 2A3TA 3NSDA 3U25A 3ASOB 5I26A 1ZDSA 2EILB 5B0WA 4HYXA 3ZPQA 2AT9A 3MBWB 2H47C 2VM3A 4A68A 1PXSA 5G2DA 1MDAA 3CDZB 1E5YA 1ZIBA 5LWEA 5AZDA 2N0MA 4OV0A 3TA4D 1BXVA 2HRGA 1SFHA 4DP4X 4KNUA 2Z73A 4JHVA 3IN2A 4KO6A 1AG6A 1PXRA 1W8EA 1BXAA 4Q8BA 4FPDA 5I6LA 2EI4A 3UTVA 4GYCA 5C1MA 3T6ZA 1WS8A 4KO5A 4WW3A 1IXFA 2PP7A 1WA2X 2XV3A 5D4JA 2ZFEA 3AYMA 2GC7C 4E9XA 3NP4A 1QKOA 5AHZA 2J5WA 2VW6A 2BW4A 4MQSA 1A4CA 1BRXA 1JGJA 3HARA 4UG2A 1EZLA 3H4FA 1ET8A 5B6VA 4N4YB 1BEXA 4DPCX 4JR8A 3AYNA 5AZUA 4TL3A 1BM1A 1AS8A 1QHQA 2IH8A 2TSAA 3FQ2A 1L0MA 5B6YA 2TSBA 2XU9A 4XXJA 1H2SA 1AACA 2VN3A 1KCWA 1FBKA 1VJMA 1NIDA 3X1FA 2XXFA 3NYKA 3VGAA 3EHBB 3QJTB 1JZJA 5A44A 1AG0A 5H2NA 2GI0A 2YAEA 3SBQA 4HCFA 3TBCA 2I1XA 1JZIA 1AAJA 4X32A 1R84A 1ETJA 4P5RA 2Q5BA 3S3DB 1SFDA 2L6XA 3QJUB 4PXKA 2YAMA 5JJEA 1ET5A 3NJNA 3PAZA 4BV0A 4HIPA 4M4RB 2FT7A 3KW7A 4HHWA 3SQRA 1M0KA 3VW7A 1M57B 2GSMB 3PDSA 2R7EA 2BZCA 3H4HA 2FWLB 5B2NA 5AKRA 5F8UA 1ADWA 3WG7B 3GDCA 4PXFA 2HX8A 3UAEA 1ZPUA 5G36A 2OJ1A 2VW4A 5I6OA 5IY5B 3VHZA 2YDVA 5I6PA 4A67A 5PCYA 5H2JA 1L9PA 4EA3A 3FU7A 2BP8A 1JXDA 4YSTA 3DKHA 3ZBMA 1XJIA 2W88A 2PEDA 1BQRA 4KLYA 2RACA 4E9QA 1BQ5A 3OM3B 3COCA 3NJLA 1DYZA 2HRHA 3NJMA 2M3GA 3X3BA 4Q89A 4YL4A 1TEFA 2MRYA 5H2IA 5B1BB 5B6ZA 4XTLA 3GXUB 3NY9A 1BRRA 5FJGA 2J56A 3JT2A 2XWZA 1X9RA 1JZEA 3PBLA 3MX0B 3X1GA 2YCZA 2WO2B 2BP8B 2UXFA 4LDLA 3DIVA 3P0GA 3ZEVA 4QKTA 4HALA 4MFHA 3VVKA 1BYOA 1C3WA 5AFAA 5G2AA 5B35A 2BZ7A 2PLTA 1WS7A 2EIKB 1NTDA 1H68A 2BP0B 1M56B 3WKPA 1L9SA 2I7SA 3IEAA 1ZIAA 1R2NA 4HZ1A 1PAZA 5D4IA 3CG8A 2X87A 2BO0A 1F50A 2ZIYA 4E9VA 4Y9HA 2R4RA 1JV6A 1JVLA 1SDDB 1X0SA 2FT8A 2F93A 2YCYA 1ZDQA 2PCYA 2Q9OA 1N70A 2PPFA 1X0K1 2YCXA 1S8JA 1KGYE 3QJRB 2Y69B 4MQTA 3QQXA 5LDUA 1J9RA 1MZYA 2H5UA 1ILUA 3OE0A 3FYEB 1JV7A 3CAPA 1CYXA 4DPAX 3AW5A 4YSEA 4DP2X 1FFTB 1OCCB 3NJFA 4HYJA 4UHRA 5B3SB 2CUAA 5H2KA 5AX1A 1ET7A 2JAGA 1KBVA 1QNIA 2YAOA 1J9QA 1IW6A 5B6WA 3QJQB 4GP8B 1CC3A 1ZV2A 3ABMB 3NJGA 1OCOB 1AQ8A 3ZDWA 2IWEA 1RCYA 4BWWA 2JKWA 4GPOA 2Y00A 3KJ6A 3FSWA 3CVDA 5ITCA 2VMJA 1TKWA 1UATA 2HX9A 5JJNA 1J5CA 5B7FA 4NB7A 3FPYA 3OD3A 2QPEB 1YLBB 1KDJA 2PP8A 4EJ4A 1AIZA 2FQDA 1JZGA 1OCZB 4BWTA 5FC9A 3FPXA 4YSOA 1FBBA 3EH5B 1GS7A 4A2GA 5E9NA 4KNFA 2LLNA 4HHGA 4KO9A 3UZCA 1TN5A 4W9ZA 2Y03A 3NS0A 4DKLA 2IDSA 4G7SB 4HCGA 2IDUA 2DV6A 3RYMA 1X9UA 1HAUA 3OAXA 4DJHA 3V9EA 4QLWA 2PPEA 3FS9A 2WJLA 3NJHA 4A2FA 2VW7A 2IH9A 1FA4A 1GY1A 1W6LA 1MZZA 1AT9A 1KG9A 1AS6A 1WA0X 2Y02A 3MBVA 5DHGA 1VGOA 4A4MA 1S54A 3HB3B 5A7EA 2JAFA 3A7KA 2X88A 2XLLA 3QBLA 4HWLA 1L9RA 1VLXA 2W8CA 2I21A 1NWOA 2FQFA 3X1BA 5AX0A 2YCWA 2RH1A 4KOCA 1XB3A 1PY6A 3EH4B 3OE9A 1IKOP 3QAPA 3AY2A 4A2EA 5I28A 5I6KA 1TU2A 4XTOA 1OCRB 4DP0X 3HASA 1E67A 1S8LA 1BXUA 1KV7A 1JERA 4DP6X 4GP5B 4W1TA 3TBBA 3EH3B 1UAZA 1Q5JA 1IBYA 5KKHA 3T9WA 3QAKA 4DP8X 4CSZA 1C8SA 3UZAA 4QI1A 4BUOA 3VG9A 5EN0A 4M3HA 2GIMA 3ABKB 2DY2A 2XYBA 2IDTA 3PXLA 4YSRA 3OMNB 1QKPA 3QBIA 3V2YA 2UXVA 5H2HA 3HAPA 2WSDA 3PCYA 2AZUA 4E9RA 8PAZA 1BRDA 1WAEA 4GYBA 2XX1A 1P8IA 3ABGA 4P5SA 3L45A 3ABLB 3NJIA 3FU8A 6PAZA 1U19A 5B1AB 1BAWA 2FTAA 4ZK8A 1AP9A 4FA7B 3JTBA 1EHKB 4K5YA 4A66A 3BQVA 3UONA 5B1JC 3X3CA 3OE8A 1NPJA 3D12B 1PNCA 3WI9A 4YSCA 4JKNA 1XB8A 5G28A 2E86A 2DWTA 3X1NA 4YSPA 4BXVA 7PAZA 4L0PB 2UX7A 2HXAA 1PZBA 2BWDA 2XV2A 3NJKA 5I5JA 2BP0A 2CJ3A 1E65A 2PPCA 2ZWNA 3G5WA 3T6WA 4G72B 1JZFA 2GC4C 4NERA 4TXVB 1O0AA 3RFMA 2AVFA 1OOWA 2HZHA 2Y04A 1SDDA 3UTYA 1M0LA 3FQ1A 5A45A 3PWHA 1E30A 5I6MA 2FQEA 1AR1B 4XTNA 2BW5A 4AI7A 2Y1AA 1AZUA 1KGBA 1E5ZA 1SHXA 1J9SA 5TGZA 4YSSA 4JKVA 3QDCA 1OF0A 3T6VA 2PPDA 1FWXA 2AANA 1F4ZA 4YSQA 1PMYA 5ETZA 2ZXWB 2YAQA 3DTUB 3V9CA 3SBRA 3FU9A 1X0I1 2CAKA 3KW8A 4DPBX 1RZPA 4X31A 1XIOA 1AZRA 3ZX1A 1GSKA 3N2JA 4DP7X 1AS7A 4YVUA 2KSAA 3FSVA 4AX3A 2VT4A 5DYSA 1PZCA 1GS8A 2BHFA 2FJSA 3AG4B 1SJMA 3TU6A 2ZOOA 3PPSA 4YSAA 1AOZA 4UANA 3PXOA 2HLEB 3GYRA 3IBOA 2UXGA 1C8RA 2I7OA 4HCIA 4DAJA 1KYAA 1NICA 2UX6A 1LN6A 3C75A 4WKXA 1CURA 5PAZA 4A2HA 5B1KA 3WNIA 1ASQA 1DZEA 1TEGA 1MG2C 2VM4A 2IDQA 4KNTA 4N8UA 3UAAA 2UXTA 3CODA 1JXGA 3UABA 4BEYA 1IUZA 1B3IA 3HAQA 1IW9A 1GUEA 1L9HA 5AWZA 5BR2A 1NIFA 2YARA 1XB6A 2H3XC 3V2WA 1CYWA 2I85A 1V54B 1RKRA 3ZIYA 3CVBA 4N6HA 4DP5X 3CZUB 3SN6R 4IAQA 3X2QB 5ITEA 2YQBA 4BK5C 4J4QA 1KCBA 5B7MA 3IN0A 5JJJA 4LDEA 2F95A 4ENZA 4MD2A 1HZXA 1NDTA 1KG8A 3PQRA 1V10A 2P80D 3FQYA 3UGEA 3UACA 1OE3A 2QPDB 2CALA 2HX7A 2QT6A 3EF4A 5EHFA 4BXSV 2NTWA 1URIA 2WJKA 4X1HA 2JXMA 1NWPA 4AKPA 4F2EA 4EF3A 2XX0A 2DYRB 2B08A 2B3IA 6PCYA 1PZAA 4E9TA 1NPNA 4WAVA 1AANA 1ID2A 2YXWA 2IDFA 1GS6X 5H2OA 4X4KA 1A4AA 3DQBA 1A3ZA 3OMIB 1PNDA 1R1CA 1F56A 3AZUA 3WNJA 4N4WA 1I53A 1S53A 1P8UA 5G53A 3HAOA 4JHUA 2FNWA 2QDVA 4HAKA 1W6WA 5B6XA 1NZRA 5D4HA 3SBPA 3VI0A 1AZBA 4KNSA 1V55B 2VSMB 5F7BA 3X1EA 5B34A 4GXFA 5AHYA 4FBZA 4AKOA 1F88A 3WIAA 2J4YA 1MGYA 1SF3A 2FQGA 3S8GB 2DWSA 4PCYA 5TK4A 4YSUA 4BVNA 3ERXA 1SHWA 1TN0A 2GHZA 3QBGA 1MG3C 4QRYA 1PY0A 3IE9A 4F2FA 2YDOA 1P8HA 2XVBA 2YAFA 3UADA 4IB4A 2EINB 2PCFA 1JFPA 4E9YA 3ODUA 3ABWA 1GY2A 3AG1B 4BWUA 4CSPA 4A2DA 1QM8A 1XMEB 3NY8A 2CCWA 3FSAA 1PF3A 4L6RA 3NSYA 4BEZA 2EIMB 2KSYA 3S8FB 1SF5A 4KO7A 2KSBA 2IWFA 4G7RB 1KMEA 1N68A 1GYCA 5B7EA 5I5IA 3OMAB 2KS9A 4UAHA 2IAAC 1ASOA 4UF7C 3EMLA 4K9JA 4WTQA 2AZAA 3QBKA 3C9MA 1GZMA 2Y01A 4LDOA 5G54A 3T6XA 9PCYA 4F7KA 5DHHA 3UTXA 4G7QB 4XT3A 4AMJA 1GU8A 1JVOA 1L9QA 1OV8A 3PAUA 4JQ6A 1QLEB 5I5MA 2DYSB 2BRDA 3AG2B 1OE1A 5TK2A 4NC3A 1QHJA 4AMIA 1AZCA 4EIYA 2YAPA 4GRVA 1M9WA 2ZZLA 4BDVA 1E12A 3UG9A 2XUWA 4G70B 1CWQA 2CBPA 4KOBA 5F7AA 1UCQA 3FYIB 2YXVA 4QIDA 1OE2A 2P80A 3NSFA 1T5KA 4AZUA 1WA1X 1PLAA 3T45A 4YVNA 3PAVA 1NINA 5ANHA 3TASA 1J9TA 2FT6A 2JFCA 1JXFA 3NSBA 3H56A 3C9LA 2OCCB 3NYAA 3D4SA 4PAZA 2YAHA 4DP9X 3WQJA 1HFUA 1L9TA 1KDIA
chains in the Genus database with same CATH superfamily
2A9DA 3BYTA 1JI2A 5C6PB 2BSED 3OKMA 2BIQA 2GB2A 1HOEA 3C60C 5IQOA 3AS0A 4KKLD 2UVEA 4JPVH 5D1XC 2OYKA 1CCZA 3HVDA 4G8FA 2F68X 1YEJH 3M45A 5CN2A 3RX7A 1MNNA 3ULUD 2G87A 5LKNA 3UTPD 1OGAD 1J05A 1ZSDA 4PJEB 3T0EA 2W0PA 1QG3A 3DWTA 4NNXB 3PXHA 4F37K 3K4AA 2K6ZA 2R2EA 1INDL 2MOQA 2G30A 2UZIH 1YY9D 5AW0B 1ACCA 3E3QC 4N22A 5EBGA 3EO0A 3NT0A 4Z95H 5GPRA 3MRPA 4HPHA 1C16A 4PRHB 1RPKA 1IC0A 4IMLB 2Q6WA 3IXTB 3SE8H 4EUPG 5JPMA 1CGTA 3AITA 1GW0A 3IDYB 4ABQA 4NYLB 4MJ4A 4H20L 1FQ9C 1T4WA 2PR4H 5L2KB 4PRIE 3KVDD 1AIFA 1JHLH 3RIKA 3A21A 4Y16D 1X4ZA 4JREB 3QJVB 1V7NL 3HUJF 3LEVH 1CGXA 3AM6A 4YHKH 4KRPC 2W9LA 1JI1A 3DI3B 4YHOL 3MV01 2Y1VA 5CCKH 2DBLH 3HE6B 5DHEA 4EI0A 2I20A 2H8PA 2AXJA 3BEWB 4JRWA 4KKLC 2VH5H 5J7AA 4MJHA 4EJ1C 5L88H 2I35A 3A6OA 1NCNA 2PN5A 5JO5B 1JGIA 3LH8A 1HI6A 3ZZLA 2BX5A 1GCFA 3PGDB 5DK2B 1D5RA 4UM8A 3F04A 1XSIA 4FQXB 3BP6B 5ISZE 2IJ0C 3IU4H 3BZEB 5T33L 5JHLH 4JFFD 3O6FA 1ZOXA 4K7PY 4P2OD 1D7CA 2FR4A 2VITA 2VDPH 1LO0L 2C26A 5HGGS 4OZGA 3VFOA 5K9QG 1MHPH 1I1FB 3KD4A 3EDDA 3NPSC 1TJXA 3QEQD 3V2AR 2EACA 2QFPA 5B1CA 4YXLH 5EZJA 3JWDC 3HG3A 3UTVA 1ND0A 1KJ2H 4D9LL 1I82A 1YHPA 4KO5A 1NBZB 3QUZD 3QHZH 4M43H 3ZN6A 1XF1A 4DGUA 3C08H 4H8HA 2VW6A 2QQLH 4ZUTA 5SWZE 3U0PA 2R23B 1I8MB 2Y7LA 4M61A 1PSKH 4BSWB 1YJDL 1NAKL 3AB0B 3G6DH 4LMQI 3VFSA 5IR1B 4W4OC 4B9ZA 2EDDA 4OLXH 1A7BA 4KK5C 3TCTA 2QKSA 4OD2B 2WXGA 4Y4KC 2EYSB 5FYLH 3WIHH 2OMBA 2TSBA 4AXWB 1AACA 5IJCC 2GSIB 2CJUL 4QCIA 2Z31A 4XMZA 1BMGA 4XO4A 4Y5XA 3HG1D 1H5BA 5D2LB 4MD5B 5T1MA 1MREH 1KEGH 2YRZA 2Q5BA 1T1XB 1T66D 1X5XA 2L6XA 1K5WA 1BVLB 1IEAA 4YHNA 1IL1B 3ZHKA 2ODHA 3PUCA 2AK4A 1UKQA 3ILDA 2H0PA 3VW7A 1UT2A 3N04A 1MHCB 1P7KA 4R0LC 1BJMA 1FFOA 2BZCA 1HN1A 4P59L 1QBLH 3WY4A 3ARGA 5B2NA 3APFA 1CLOL 1D7DA 4HC1L 1CFNA 1U8CA 4JFDA 5DQDH 1LP9E 2MH4A 3LZRA 4HBQA 5EU7C 3AXIA 5DSCA 2JQMA 4F8PA 1JXDA 2VJ8A 4GI9A 4Y2NA 3QIUC 1AD9B 3J8F7 2KUTA 4PTUB 5AAMA 4A6YB 2A6KA 3D51A 1DBAH 4JQIL 5J6GA 8CGTA 4P05A 2BHUA 5KSAA 2E7MA 4MAUL 5KWYC 3L1OL 4JGMA 5HI5D 4BCYA 1DJSA 1OAUL 5D7SL 9CGTA 2V9UA 5JLZA 4QF1B 3BIAX 5IFAH 1KIQA 2WBJD 2XWZA 2ENSA 2K78A 32C2B 3PBLA 1N26A 3QWRD 1Y07A 4NBXB 4MFHA 2XACC 3B9KB 2NTSP 3MRNA 2ZKHH 4HJJL 1TZIA 2OMTA 2Y5EA 3MN8A 4TNWK 1UZ8B 4AT6B 3BAEL 3WEBA 1J1OH 5EWIH 1U8MA 1P2CB 1YMHA 3QG6A 3ARFA 4TNVK 4P9HL 2F53A 1K8IB 3IETA 3UPCA 1IQWL 1J5OH 3E2HB 1CDHA 3KPPB 1HINL 1IKFL 2NY5L 3KWWB 4HKZB 2MSPA 1SVCP 3JWOL 3FUNA 1JK8B 43C9A 2C4XA 4LU5H 4XCNB 1NGWB 4JFXA 4HPYH 2HMID 2OTUB 1FFTB 1DR9A 1PZ3A 4KZ0A 2SODB 1G7HA 3EOTL 2FB4L 2YAOA 3ISRA 4ZAKA 4ZTPH 5H94B 4XRCA 2ATPA 5A43C 5B6WA 2CR6A 3QQNA 1TETH 4I3SH 4D94A 1YQVH 5GGSA 3I9AA 4LCCC 3V55A 3UX9B 4ZMQA 4X9GA 4LVOB 4ODUA 3FSWA 1CPUA 4KJPD 4LBEB 4X6BB 1PJ9A 1RURL 4XMWA 1P53A 4HIHB 5LB1A 4M7KH 5CD5C 5JR1L 3TNMA 3FPYA 4P4KC 5DFAA 4X5LA 5D70H 4J3OD 4BWTA 2X4RB 3A0OA 3GJEA 2DWDA 2WLZA 3POCA 2ZUSA 3ZZSA 4HOMA 3VD2A 4LHQB 3OAXA 1SEQL 1T1YB 4HBCL 4XNZB 4QT5A 4LEXH 1JZ2A 2R1YA 2IH9A 4FHJA 2Q8AL 4H1LG 4PJDE 1A47A 3DV6B 4YHYB 3ES6A 5GS0D 5CS7A 5JDJA 1RK1B 1GZQB 2ESVB 3ETTA 4Q9QL 1S54A 3FB7A 1UCBH 1YAIA 2I60H 2EZ0C 2YJLA 4PJBE 5LHDA 3QFJB 4AEFA 5KJ7E 1G4RA 1F8TL 1TSRA 3C5XA 1EO8L 3D52A 1OK0A 5I6KA 1J1PL 5GHWH 4Y5VC 1YMMA 3ZDZE 4AMXA 1QTPA 2A4ZA 4P2QA 1IM3D 4PMEA 4QOKA 5ID1B 2V7NA 3KEDA 3K81A 5EORL 4JN1L 3JV4B 5HI3C 4KHTL 3BWUF 5BZWB 3DX6A 1R3LB 4BUOA 2XPZA 4L4JA 4GSXA 3VG9A 3ALWA 4J3OC 2XA8L 5E6YA 1OIOA 2BNRA 5F6IC 4LLUB 1XR9B 3CQQA 4G6JL 3D1MC 4LCUB 4OF7A 3FU8A 4ACPA 4OTXL 2FTAA 3B4NA 3BWUC 3BLBA 5I1GL 1KYUA 3HE7C 4MDIA 5CJOL 5FM5O 2A9NL 2WCSA 3D12B 2DQCL 2FJHB 2IFGA 4RA3A 1U95B 2WXRA 3D25B 5JOFA 4IRJB 1OWRM 1UGNA 1UXWB 3I9IA 2J3SA 4HIXL 3X1NA 4C56D 1DQKA 4WFGD 5I76B 4ZRGA 3V7AE 4E42A 3MLTB 4OGYL 2NX5E 3B5TA 4G72B 2PO6A 1NOLA 4WWKC 1SJHB 4G7VH 3QS3A 1O0AA 3L3OC 1KEMH 4JHZA 5IVXE 4NEHB 3OKDB 4Z7OF 2AXFB 3PWHA 1NAML 3MNWB 2K4AA 4U6XA 5DJDB 4V1DA 5IHZA 5KSBB 1H9DA 3AQDA 1CD9B 5DD3L 3KHOA 4NBZB 1QBBA 4JFTA 4FS0A 1MFCH 4I18C 3KWUA 3QPQD 3SDCD 4P5TC 1JHKL 1FWXA 4RSVA 1I1RA 2V4LA 2ZXWB 4KUZH 3RWJA 4KY2A 4PRPA 2IPKB 3NABH 3QYNA 3N1FC 5TH2A 5J6HB 1DBJH 4PGZA 4A38A 2WLLA 5FCSH 1GA2A 3N2JA 4E0RA 4YVUA 3VWJC 3WTTA 1O7VA 1PEWA 5TJWK 3IB4A 2G2PA 4W4NA 1WG3A 1R5VB 2FJSA 3M1BA 5E4OA 4F1ZA 1G43A 1D5MA 3BKML 4LLVB 1AGEA 2CDFB 3QIBB 4MNQA 4O58H 4Y2DA 1F41A 1NLBH 3ARXA 4G6FB 1B0RB 5CFHA 1T7ZA 3I2CH 1OSYA 1OANA 1IUZA 2WXLA 1KLFB 4FI7A 3GSVA 4JM2A 1J0YA 3CLWA 4Z78A 1L9HA 1EX0A 4ZTOH 2GBUA 3ZE1E 4DP5X 1I7TB 1DQJA 2P5WD 2VLJB 1DSFL 3P73B 2XG5B 1YUHB 1CL7I 2MQ3A 1A6WH 2Y4SA 3SDCC 2NY0D 3UP6A 5EIIA 3BKCL 3MRHB 1UOLA 4GXVH 3QIWC 4W9LC 4P5KA 3ZYJA 3D0LB 5DC0A 3EW3B 1P4IL 1J5HA 2WJKA 5DO2D 1Z0MA 4PS7A 4PHZA 3KPRA 4Z5RA 3EHBC 4XH2A 1ZKAA 1GS6X 2NXYC 4R97B 3RWEB 2B0SH 1EEUA 1N6UA 5C6TH 4HOZA 1MW3A 3D06A 4DJMA 4M7ZC 5HI4D 2YLKA 1B6UA 3D2TA 1AGBA 5KVGE 4HKBB 4L48A 5F1SA 3FF8A 1W9XA 3SDDA 4OF5A 4I0PC 1QVOA 1WCBA 4RVBA 4FMVA 3RWHA 4Y4FD 4LLQA 2M26A 2Z91A 1YEWA 3MZTA 3OAUH 1DANU 3P69A 4Y9FA 2IALB 5AG8A 1L3WA 4TVPD 1SHWA 4IRZA 4XBGA 4XO5A 5D8JH 1TN0A 3WE1A 2DMCA 5IB5B 4XP9H 1CT8A 5E1QA 3HG2A 1KXVC 1JFPA 3VI3E 2V5TA 5DQJB 1YDPB 2L7EA 4NFCA 1OAKL 5EPMB 1QM8A 3KCPA 1DBBH 1K4DB 4I1NB 5CZXD 5J13C 1UWFA 2WQAA 2CCWA 3DX3A 4K94C 1YA5A 4ETQB 5CP7A 1SF5A 3DX2A 4KMQA 3ULSA 5L4MA 4XR8C 3EJQA 3LTVA 2Y07L 3MV11 4KQ3H 5F0PB 4LLAA 2WC7A 5GZOC 3TP4A 1VA9A 3R8BB 2IMMA 4FI6A 3WIFA 2Y01A 4PRNB 4G7QB 1L9QA 1JVOA 3CSFA 3ZRFC 1NGQH 3H85A 4TKWA 3T8VA 2VTFA 4FQLH 2GVYA 5TK2A 4XOCA 1CR9L 3TPUA 4KQ4L 4PYHA 5KW9H 1KF9B 1J8HE 2V3DA 4NPYA 1FVDB 4AE0A 2Q10A 4U49A 3KYAA 4RAUA 4NO0A 3FB8A 2PETA 1XDTT 1N9PA 3BH9A 3VD0A 1T5KA 1WA1X 4ODSL 4AVJA 5CSZA 4W9EC 4R2GD 1OD7A 5BJTB 5I30H 4DVBA 4OM0L 4R96A 4HZLB 4NZ8A 2WZPA 4J4PC 3UCRA 2B16A 5E23A 3VYOA 2PF6A 3TZVD 4YN3A 3LKRB 2J57A 5CZXC 5F3FA 4NFDA 1E28A 3QNFA 1A02N 3K4ZA 2WLHA 4GMSL 1HCZA 3IFOB 3C6LA 5HYQB 2DW5A 1U41A 2WLNA 1DLFL 1GIGH 4FXTA 5B22A 5CBEB 3HW7A 4I3RL 4QXGL 1KN4H 3MUZ1 4TQHA 5IGXL 3MV7B 2FIKA 1FHGA 1FAIL 3ARTA 5IHWA 4U4BA 1MCCA 1ODAA 3H3PL 1JD9A 1TCRA 4OF8A 3FT4A 2X89A 1S51A 5I1JH 2YPKA 5LGHL 1RPQA 3ESNA 3DDLA 1QD0A 2WXMA 4GQQA 3H2PA 3LCYA 3AMKA 4ODVH 4XN1A 5KS9A 1TMQA 5F7DB 4JHWH 1DEEB 1FGNH 2FEJA 4LLWB 3QDMA 1PD6A 3VVWA 5E8PB 5HP5A 4CILA 2DTML 2CLVA 1YNLH 3FMGL 1NBYB 4PJGE 4R2GC 1NEUA 2NW3B 2X72A 5LAXA 3UTWA 4BWBA 3MOAH 2X4PB 2ZKMX 4RFOL 3HIZA 4OCYH 1YEIH 3OPZL 4YUEL 3RWFA 2R56H 4L37A 5FO7B 1GYVA 3H53A 2Z4TA 3NFNB 4J7RA 5JHBA 3VD4A 4GRWE 4A6YL 4NP9A 2VXQA 3TZVC 1JZHA 3NJJA 1WIOA 1Q9WB 4QHLA 4YZWA 1UA6L 2DLHA 1X4YA 4LKXB 3NSDA 4UMSA 3U25A 4OUUA 2X2IA 2BVUA 4OZHB 3O3UN 3Q5YA 3TWCL 2CCVA 1W0WA 3IGLA 3HZYB 1MY7A 4WI6A 4NN6C 4FA6A 4S0HA 1WQVT 1U8QA 3B34A 1OM3H 5IB3B 1I85A 5G2DA 2VSCA 1MDAA 4LCYB 5B38A 5K5YA 1ZSHA 1A0QL 2AJVH 1ZIBA 1V7MH 2YKKA 1UB5B 4MAYD 4ILDA 3SDXF 4F7PA 4DZBA 4YQXL 3WJMB 1WDAA 2WNKA 3H7BB 2AITA 3B7RL 4UV4L 2CK0H 1F4XH 3EDFA 2D7OA 2Y9RT 1VGEL 2LHAA 5CGTA 1BZDA 5GJSH 5HHNA 4L8BA 5T1KD 3VDBA 3GS4A 4H26B 4NRYA 3N1MC 4ZFZB 3JTTA 4WW3A 1RULH 2BOBB 3MV9E 3QYCA 5EN3A 1BMWA 5E6IA 4JBSA 1P7HL 4NWTH 1TIUA 4LSVL 3IDJA 1FNHA 4AW7A 3QUMA 4I85A 4HPOL 1BRXA 5D5MB 3SGKC 4KRNA 4NXSA 1HCFX 4I7ZC 4Z7UA 3V0JA 1H15B 3E8UH 3QQ3A 4MLIA 2LT9A 3RGVB 2A74B 2COVD 2G0LA 1AS8A 1WSST 4JZJB 4QRUA 1GGBL 1PQZA 5FYJD 5AB9A 5I16B 1FH5L 3S37L 4UTAH 1K5NA 5BUAA 1OQXA 1F3JA 3X1FA 1TQWA 4XXCA 4APQD 2ADFL 1UJ3C 3KM2A 1PW3A 2XWBB 1J10A 1G7PA 2XPGA 4XPTH 3LNDA 3VJ6B 4NO3A 3I6KA 2NY7L 1L5GB 1DTUA 1QQDA 1DDHB 2CDGB 2C4FT 2YEZB 3P02A 4PJ8C 1FZKB 1FNLA 3CXHK 2MFNA 2XJLA 3GTVA 2WXJA 3MRQA 3H4HA 2JB6A 3GMOB 2FWLB 2AQSA 4OM1H 5F8UA 1ED3B 1N7ML 2AXHA 4PGCB 1N2RB 1NCBH 4MJIA 2P3YA 2WLIA 3IU3A 2GIYA 4LSTL 3LIZA 4NQCE 3WD5L 2JK5A 1U8LB 2RACA 5EO1B 1JPSH 3H9SB 4RGMB 3MA9L 3G7TA 4RGNC 4ZTEA 1O9WA 2OMZA 2JJVA 1TEFA 5I0XA 3HPJA 4L3CB 2VISA 2FYYB 1JFQL 3JT2A 5TQ0H 4GFXA 3LRGA 4J27A 1XF4B 4TSBH 3DIVA 4TM9A 2JB5H 4HALA 2Z35A 1F6FB 3EO1B 5G2AA 4QRSA 5SX4H 1HSBB 4IBVA 4YPGB 3P11L 3CFKA 5AD0A 3SPGA 1L9SA 4ONGL 3L3KA 1XH0A 5D4IA 1T2XA 3CG8A 3OR6B 3RP1A 3OLIA 4U1NB 4OGZA 3WEXA 4MB3A 4ZUVB 1RV6X 1C5BL 3K7UA 2AK1H 5E94A 3NIFF 1ZV5A 5J0BA 2GSGB 2LAGB 1UM6L 3C60A 3V6OC 1X0K1 2YCXA 1I8KA 1KGYE 1QO3B 1X5LA 3FRPA 4O9HL 2Y69B 1SLXA 3MACL 1LWRA 4N0UB 4NKQB 4HUVA 3GRWH 2IQ9H 3NCXA 1ZWIB 2FLBT 3ARBB 3LJ3A 4OZIF 2QSTA 1X3DA 4BFIA 3AW5A 3K8KA 4HU8A 4OF3A 2DD8H 5H2KA 5AX1A 3GHEL 4POYA 3NCYP 4NZUH 5DMGD 3RY6C 1JGEB 3MNZA 1MQKH 1WFUA 2Y06H 3BUYB 3HZVA 4F8LA 2UWEF 2L0DA 2CLRB 3FTZA 4M62L 4MD0B 4ZBJA 5KVDL 1KTBA 1A66A 3KJ6A 2MNUA 4Z7QB 4KK9D 4ABWA 4WU5B 2AMGA 1WWBX 4JFHD 3G6AA 4Q74A 4OKDA 2R2HA 2X42A 2D7QA 4YSOA 3EH5B 2XVLA 3O6ML 4ELKA 4S0TD 2LLNA 3F05A 3LKNB 3RYMA 2RGSA 1BMZA 4YXKH 5T5FA 2BSEA 2F8OA 3WU1A 2Q86B 3ZKXC 5DMYA 1TKWB 3MRBA 4MSWA 3MRFB 5ECGA 1ZVYA 5KYYB 5MHSD 2BHYA 3T0DA 1MRCH 3AY4C 5K1NA 1ACXA 3TIEA 4TUOB 1W6LA 2ZOUA 4GLRI 3IPEA 4OAWB 4K7PL 1UKSA 4UIKL 4FZ8L 3QFGA 4MX7B 4WKZA 4DESA 2HRPH 1XGQB 1JS4A 2ORBL 4YH6A 3ALXA 5A7EA 4I2XB 1XZ0B 4KKPA 5F9WB 4E41E 1E4JA 4RFNB 2UY6A 5DMGC 1QLFB 2XWJA 5FO8A 1URZA 5MEOB 2RH1A 1FYTB 3DJZA 1TZOA 3FJTA 2RFXA 3WDIA 4MKTA 1T83C 5KG9A 2EEDA 2WVTA 1ADQH 1UAZA 3Q8AA 1VEPA 2B4CH 5IEKA 2DWXA 4LPVA 4KFZC 4U6HB 4DGIL 4L3EE 3N85L 5IUCA 4Y1AA 5ANMA 3EF7A 4WEMB 2DQUH 5AYUH 3ABKB 3L4CA 1EVUA 2QELA 3H6JA 4GAYA 1JDDA 4MQ7A 3BCFA 4PV8B 4YNYB 4M3JA 5E9DA 3N06B 3EFOB 2HFGH 3BP4B 1MVYA 5ENWB 4Z77A 4YJZL 3NJIA 2WO4A 4XBEH 3ZE2B 4W4OA 1SVZA 1QSFB 2OJEB 2MKWA 4GKZB 1KB3A 1HCYA 1O9VA 4Y4KA 2X05A 2XFGB 3TBSB 3VD5A 1BQLL 4QXVA 2XQ0A 4MA7H 3UJIL 3LHAA 5DLLA 3VFVB 4Y7MA 1BEYH 1XB8A 4RX4D 1RHHA 5KZCB 4L4VB 1VZIA 5FM8A 3GBEA 4R84A 3GSQB 3I50H 4P2OA 4OV6F 4EI6A 1RU9L 2C1OA 2D03L 4Z8FL 2KH2B 3EYVA 2AVFA 3PFQA 2YUWA 2GAZA 5I75B 2CO2A 2OULB 3MOBL 3V5KB 4GUCA 2A0LC 4R0LA 5C0AD 4FQJH 4QRPE 3PWPD 4MCZA 3KPSE 4NRZB 1RQ5A 1V3MA 3DROB 4NJ9L 4YDIH 3GHPA 5F9JA 5TGZA 4IK6A 4XPGL 1SXNA 1UUSA 3DX0A 5FHBH 2YPVA 5C08D 2EXTA 5C09E 4M5ZL 1AC6A 3MRMB 3Q8EA 4ZYKB 3VX1A 1AE6L 3D4CA 1X6LA 3I6LD 3S9DB 3P0YH 3F2LA 1MFVA 3RDJA 3HI6L 4RIRA 1FFNA 4JO1L 4NI6A 4HQQH 2W65A 3FAXA 5DVMA 1NFDF 3B2UD 4R5XA 4X80L 1M7DA 5CR1A 1LO2H 4IU2A 4AX3A 5DYSA 1N0LB 3DTXA 4UI2A 3QPXH 5BS0A 2HT3C 2UXGA 4K8RL 4XC3L 3L9YA 1XIWD 3S5LB 3ZL1A 3QEGL 5BQ7B 3QAZB 1YN6B 1A6AA 3C75A 4QJ3B 3C5JB 4B9GA 4MA8L 4HIEA 4KAQL 1P4LB 4PVBA 4Z6AT 1TDQA 2VM4A 1KTRL 5IVZA 4UM9B 4K9EC 1CFSA 4N5UA 4ZZFA 1NUGA 2BNQE 1QSZA 2D9CA 4BEYA 1W0VB 5AWZA 3PNWA 3HS0B 1NCDH 1H3GA 1RSYA 2KLSA 3QT2A 2FLRT 1I3RA 1I8IB 2QVKA 2UYLA 5K59F 1HWGB 5FKAB 5J1SC 2JELH 3FQUA 4Y0GA 4LDEA 2MJWA 2I9TA 5EZLA 3BMWA 1IZJA 5ICUA 2J7LA 5KBPA 1KC5L 3SE9H 2CALA 4OFDA 5FGSA 4CMMA 4N9OB 4WHTA 1I75A 2LTQB 3REWA 2DYRB 3L9RA 5E5UB 4UQ3B 4DVRH 4RA0C 1NPNA 2HRLA 4YE4H 4KZDH 4GRLB 4IBYA 2LAAA 3JV0A 4NQDA 4Q9BA 3QJHA 3STBA 1WV7T 1QA9B 1BQHB 5I0YA 4LCCA 4NKMA 1AHKA 5L6YH 3FQWB 5SWSD 3QWRA 3S35L 4GAFB 4OD3H 1P8UA 1A4JB 4MXQD 3IWVA 1RIHL 3KLAB 1XIWC 2FNWA 5KSUB 1NCCH 1RK7A 5DYOB 5D4HA 4P4KA 3B2PA 4UTBL 4AIXA 2CO7B 1HQRB 1U42A 2HWZL 1LQBC 2H6PA 4CL7A 4Q97A 2J4YA 4U1GC 1ZLWK 1VZHA 4OV5A 3M88A 1T21A 5DZ9A 1FZJA 3NCWA 3DX8B 4NCC1 3BZ5A 2N7BA 1P8HA 3QO1A 3TEXA 3VXMB 5E08L 1N12A 2F7PA 2VERA 1XMEB 1E6JL 2R1XA 1FF5A 3NSYA 1VRSA 3PU7A 3VGGA 4IMKC 5C1MB 2KSBA 1CICB 1YZZA 1F3DH 3QH3B 4CA4A 1F6AB 1MJ7L 4NZTL 2G4EA 2N7AA 4G3YH 3RWDA 3MCG1 3QO0B 2H2SD 3TCLB 2GUOA 4Y5VA 4LARH 2CKBB 4GS7C 4QR7A 2E76C 2O5YL 1KG0A 2FZ3A 2QQNH 3GBDA 1OV8A 3V5HA 3PAUA 4JQ6A 4ZFFA 1ZXQA 4NC3A 1AFVL 2VN5A 5HVHB 3EJYD 3K5SA 2Z0UA 4MXQC 1F0LA 4TSCL 4D3CL 4JFQA 1NKGA 2CK2A 4NM4L 1M9WA 4BDVA 2VC2B 3II3A 4Y2OA 4YHPA 1QR1B 1MFBL 1NEZB 2XUWA 5BRZB 1JYNA 2DJMA 4QIDA 4KTEH 3TM6A 1E3FA 5I18L 2EDFA 3PAVA 4UZGA 5L9DH 5HVGB 4LEEA 1EZUA 1N6VA 1A7NH 2WD0A 2YC1B 3TV3H 2RQEA 2WIMA 4AM0Q 3NYAA 1LJMA 3ECVA 3KPNA 3VXUB 3IJEA 3EGXA 1DFXA 3HE7A 1IGCH 1GGTA 4RRPA 2ERJB 3CZFA 1FIGL 5I8KL 3WY2A 1A6TA 1A5FH 4JRLA 1B0WA 1LO3L 3L3GA 4R6UA 3V9FA 4G5ZH 1C5CH 2N59A 4WSGA 5IHHA 4HGWB 3P3TA 4WWKA 2BS71 5K9JL 3U48A 3KDMA 3L3OA 5IM7A 3V8CA 1D9KD 5J1AB 5HGBA 3L5JA 3QJSB 2YK1H 3IKCB 3MGTA 1NPUA 3BPNB 3MODH 4ZMAT 3H9HA 3AT9A 3TO4D 1JOIA 4I18A 2JI2A 1RY7B 3PWLA 1IMHC 3FSZA 3K3QA 4RDQG 3UTSD 1UWGH 2TAAA 1J05B 3GC3A 1UFGA 1ZSDB 2NRDA 3T0EB 5L0QC 2CIIB 4PCKA 4RH4A 1KOAA 2UUDK 2FX7L 1EXUA 2N0KA 3VXQA 3T4AC 4C8XA 3CZLA 5BZDA 1ID5I 3EIFA 3FHQA 2R4RH 5IEHA 1LO4L 1IEBA 1LGVA 5HPOA 4LFHD 4X6DE 4LOFA 3EO0B 4X5PA 4IDJH 1JGUH 2E7CA 4L1BA 3VWJA 5BVPL 2Q7YA 3QYMA 3UTTE 3MRPB 5HHOA 1C16B 4DAGL 5JPMB 2NXZB 4QMEA 2OP4L 5F7FA 2VCOA 1S78D 2W0LA 4AEIL 1JWSB 2G3ZA 2KZBA 5D6CA 3KLSA 4O02L 4XNYH 2A2QT 3PWUA 1XMWA 2BIHA 2LNLA 3WS6C 2A3TA 4LVNC 1HX0A 3QUYD 5FV2A 4QRFA 1RZJL 1P5UC 2BVPB 4KMTH 3Q9QA 2HT2C 4UINL 1QW8A 1S7XB 5JXED 4H40A 5IROD 4B3VA 2PYED 4OV0A 2B4CC 2OW7A 1KJ2A 4PJ5A 1SFHA 2DLEA 2V0AA 1HI6B 3TO4C 1AXIB 1ZLDA 2Y36L 3GMPA 4LK4A 4UM8B 3SDCA 3CFUA 4DGYL 3Q06A 2VO5A 2CDEA 3DX4A 4CJ0A 2VRQA 3QIWA 2FX8H 2F7RA 3FOLB 5I66A 5L8JB 3Q6GH 3E9UA 4DKAA 5FF6A 5T3XH 5JOPE 3FCSB 4XMTA 3QVAA 4TOYH 1BZEA 2FR4B 1TTBA 2VITB 4PCSA 4D9QD 3HA0A 3VFWA 2J5WA 2R29A 3VFOB 1NCAH 1TZAA 4FMKA 5KBNC 1F45A 3QG7L 5DMIH 4KK6D 2E7BA 2LR4A 1WBXA 1MAMH 1SY6A 2IANE 4YFLI 1E8XA 5C7XL 1XT5A 2VN3A 5MP6L 2EH8L 4I0PA 3U30C 3SGDI 2LLGA 2YAEA 3V0EA 3QUYC 3GB7B 3U0PB 4OFPA 1N5AB 4UNVA 1KPRA 4ZW5A 5I1EH 4UOW0 4PBXA 3MRJA 3VFSB 2YD1A 5GGVH 1I1AC 3ZKMD 4FGMA 3EOAA 3NIGB 1C08A 3TA3C 1G7JB 5IROC 3ZSTA 3K5RA 2P5WA 1UM4L 1KXVA 1LDPH 1RJLA 5CCHE 3KR3L 1MCKA 3V5DB 3HC3L 4AIOA 3KMDA 2Z31B 4Y5XB 1N64H 2AQ2A 3T0VA 3ZL4H 5D7LD 1H5BB 4OVUA 3RB7A 5AZEL 4PXFA 3GK8H 5CLWA 4BZ2A 1FDLH 1W72H 4OIAA 1IEAB 5GZOA 4YHNB 4LO9A 2BP8A 4NP4H 3ZBMA 2BFGA 4LF3A 2E9JA 1AHMA 4U0QB 3LZFH 1JNNH 5IQ7H 5DTFB 4GUQA 3COCA 2DM3A 2Y7SA 2ZWYA 2EIEA 3ARGB 4AQ1C 1QTYT 3L4WA 4QHNA 4HUKB 5D6DC 1U8CB 4JFDB 3VQ1C 5L8KB 1FVCA 5DWUH 3U2IA 4Q2ZB 3WEMA 4RGOL 3BGFC 2DAVA 2XY2A 1NC4D 2R69H 4PJIB 5GS1C 4YGVA 1ZLSH 5DSCB 5T3ZD 5KVEH 5AFAA 5J9PB 4TNFA 1CFVL 2GY7B 5KSAB 1D6VH 1NFIA 3EJTA 2C9VA 5FA4B 4JL2A 2ZCLH 2FX9L 3AMLA 4GSQA 2Y6SD 4AVHA 3K74B 1Y18B 2ZIYA 3FQRA 3MFFB 3BD4A 5EZIL 3FUIA 4J4PA 1LEGA 5D4QA 1PCXA 2HTKD 2PR9A 3GMLA 1KSRA 5C0DA 2Z4QA 1TPXC 3MRNB 4ZD3H 1RP8A 3VD9A 1H9VA 4HH8A 4G1EB 1DBKH 3TYGL 4FQIL 5JW3H 1TZIB 2OMTB 3BN9C 3SKJL 3ULVD 3OE0A 5DGRA 3X12A 2Y1YA 1NMCC 5DA4A 1CG9A 3UJJH 3ARFB 3IETB 3FH5A 4KXZI 2A6DB 1Q8MA 1ZK9A 3NTCL 2XVKA 5JR1H 4QDGA 3QQDA 1MI5E 2XTSA 1BM3L 2B59A 3BVNA 3O6LH 4Z76A 3X11A 4A55A 5EF1A 2IDCA 2C1PA 3BSZL 3Q8CA 1XL6A 1E90A 4PJHA 3WN6A 43C9B 5I23A 1U6AL 3R19A 5HYFA 2VNCA 4IM8A 4PBDA 5FOJA 2VMFA 4AQAA 2WZ0A 4CMHB 1Q72L 3M07A 1ZLVH 1G7HB 2DDQL 2QTEA 4CSTA 1BQUA 1HEZB 4NQED 2ATPB 2XKNA 4AENA 3QDHA 1JZGA 3FPXA 3BE1H 4QHKI 4DHLA 3B37A 2Y6SC 2D7TH 1EJ6A 2CLZA 5I71B 4PWKA 1E8WA 4PWGA 3QUGA 1OZUA 1HAUA 3FCTA 1JNLH 5C0BE 2X4UB 3TZVA 4PGJA 1XZWA 2ZCHL 4OLUH 3R8QA 3U2JA 2LVEA 1PX8A 1Q0YL 1YEEH 3GJEB 3Q8BA 2D3LA 3ULVC 1KFAH 5I82A 5DHGA 2R0WH 4F5CA 4J1UA 4TUKH 1VLXA 4M1DL 3FH8A 3DV4A 2E8YA 3VYPA 3X1BA 2FEEI 1RZ7L 3KHQA 2VDMH 3GEWB 2R1YB 1BZQK 3B1UA 5DUMH 3GHBL 4NUPA 3ES6B 1TU2A 2V37A 2VDLH 3DXAE 3E1F1 4JB9L 3T3PB 4DP0X 4XNMB 1U92A 1J48A 1YEHH 3FB7B 1HIMH 1S7VB 2L4OA 5EU5A 2QHLA 2VDNH 3VXPA 1KCRL 3Q6FA 2P7TA 3NA4A 3O2DL 2WQSA 1IU1A 3OB0H 4HT1L 3K91A 2XYBA 5DHVA 2WHVA 4CSSA 2DQJH 3OZ9L 4X7DC 4E9RA 3SGKA 2FECI 2WVVB 1YPZF 4LPTA 5CGBA 1TJGL 5D96B 4KVNH 4WI9A 2V7NB 2XVGA 1S2EA 1NUFA 3DJ9A 4QXWA 3ASWA 5B1AB 2DS4A 3TBYA 2G60H 3FUEA 2EXYD 5C9JB 1HDMB 1NH6A 3VG9B 5HYIA 3WNMA 1UJ3A 1MCFA 3FO0H 5CJ8A 3VFPA 4YSCA 4LPYA 1XXFC 2IPTH 5G28A 4LKCB 3TJHC 1SJEB 2BNRB 3L7FA 4M7JH 4YX2L 5C9KA 2VJXA 4IEFA 4XC1L 3KPLB 2BP0A 4G6AC 3Q8FA 2OSLA 1TJIL 2E9WA 4HDIB 1SM3H 4UQAA 4PJ8A 1SDYA 1A22B 1X5IA 4HCRH 5JOFB 4XTNA 5JQIB 2WKLA 4RWYH 4X9BA 5KJRL 2H6UA 2C3VB 4E42B 1MIML 3F01A 3FULA 2GQHA 5GISL 3L95A 4DN3L 2PO6B 1QEWA 3T6VA 5IW6B 15C8H 5BUPA 3LB6D 3T3MB 3QS2A 1YG9A 2H6OA 1VERA 2Z0BA 3D0VB 3Q1SL 5IHZB 4DGWC 3EBIA 4U6XB 1JPEA 4V1DB 5JXAL 3KYKL 3VM7A 4MQXD 1UA3A 1T4KA 2HH0L 2EXYC 4PIBA 4IBZA 4JFED 4EXPX 3PPSA 3CZNA 2ZP8A 4WNJA 5CJ5A 2CKBL 3RWJB 2CMRL 4MNGA 4PRPB 3QWOA 1NMBL 2K6YA 3L17A 2PXYD 1MW1A 3MRKB 4EMZA 5ITBL 1USZA 3MV8D 3US9A 1KN2H 2WP3T 1O7DE 4HS8L 5FUZH 2NPLX 1WWWX 2ZF8A 1XSJA 1FG2A 4HX1B 4MJ6B 2Q8BH 2CBOA 1AGEB 1QFWM 2EDMA 1CYWA 2IOIA 3NCJH 1OB1A 4PI2A 3V6OA 3ZIYA 3UPAA 4MNQB 4JRYA 4JVPA 1ZV9A 4IAQA 3U7WL 2PTTA 1KCBA 5F6HI 4L0ZA 1SDAB 1YECH 1H3PH 1EEYB 4G8GB 3FQYA 4PWHA 4JRFA 4R83A 3U9PH 4JM2B 3GSVB 3LB6C 3WKMH 3CVHL 4PB9L 3F7YA 3B56A 1FO0H 2XX0A 3RY6A 2XTJD 5DJYA 2BLFA 3BLKA 3CK0L 5JIKA 3W0WE 4DEPB 1TTGA 2X6CA 4Z7WB 1ID2A 1KPUA 1JRHI 2ZYRA 3UTQA 3S36X 3WEOA 4XPFL 1MHHB 3K6IA 1WBYA 4TPRL 2WQXA 1A4AA 5FHAL 5JW4Q 5LXVA 4OZIA 1PNDA 1G9NH 3GJFB 5FO9A 2A6IA 3WNJA 2E5EA 1MCWW 1TQBB 4P5KB 4RNRB 3ATDA 5DRXA 3ZHDA 3P0VH 1OZTG 4RMQA 4KNSA 5A16B 3Q2VA 5F7EH 1JHTB 4Z5RB 3KPRB 4I77L 1MRFL 4XH2B 3MYJB 4HJ0C 4D8PA 2UWEA 2XN9E 1NCGA 3S8GB 1E4XH 1MCOL 1XAUA 5E5MB 3VXSE 3B9DA 3DBSA 3TO2A 2VLKE 2OXHA 4XHJD 3SZ6A 5IREA 1MG3C 2CSPA 3QHFH 1AGBB 3ZE0F 3J7HA 1U8HA 4CJ1A 3AY4A 4KROB 4XI5D 1T03H 3B6SA 3AQXA 3RWHB 3V4VA 3NY8A 4LLQB 3VSUA 2Z91B 4MVBD 4LL9A 3V8OA 3B7SA 4HMCA 4XBGB 3TEWA 4GXUN 1XFPA 4NX0A 2XTJC 3ZZ1A 3WO3B 4EBQL 3DBXA 1KBBA 1B4JH 3SKMA 4NT6A 3KCPB 3T4YA 4G9FE 3CPUA 2WAHA 5H37H 1UJTA 1BZ9A 2GKIA 4ZOEA 3AM8C 1OE1A 3ULSB 3G9VA 5CP3H 3WFDL 4EIYA 3QRBA 4F9LC 1FZMA 1EV2E 2F1EA 4WTXA 1E12A 5D7KE 1BAFL 4Z7VF 5F7AA 2EDJA 3FYIB 4W9CC 3GTNA 3X3FL 5D7HA 1OL0A 4AVKA 1R24A 2IG2H 3MTXA 3WIIH 4XHJC 4AUYA 3WQJA 3S5LG 4KY1H 4PG2C 4WWPA 3WLBA 4NPYB 3CHSA 2FCBA 3CSYA 4XP4H 4XO9A 2XQBH 4NO0B 3FB8B 5EA0H 2AFNA 5H2BA 3RBSA 5GSVA 2OTPA 5KYXA 4Y8DC 3BH9B 2YZ8A 2J1WA 2HB0A 1D5BA 4R96B 3U1SH 1AOHA 2QQKL 3T65B 1SHSA 1CWVA 4XMLH 1PCSA 4NHCL 1KBGL 3WELA 4AM0B 3G6JF 3VDCA 1KLGA 2K9UA 4M48H 4QO1A 1YYLH 5AQ0A 4Y89A 5ISZD 3UG4A 1G7QB 1YEFH 3VFTA 1E28B 2C9SA 1GGCL 2AJSL 1JK9A 4OZ4A 3PL6C 4FQ2H 3C6LB 4M6OL 3RIFF 4Z0BH 1QFWI 5DFVD 4X7TA 1CO1A 4F2MB 4NUGL 1UUNA 1ZHKA 1AH1A 3IS0X 1U8OB 12E8H 1BQHG 2NY2D 2ZX6A 1NGXA 2EDLA 1FLRL 3B8YA 2HUHA 1TCRB 1NJ9B 3TLRA 3FT4B 4MXVF 2YPKB 3ZDYF 5KVMC 1PD0A 1ZA6B 4J6IA 1X5YA 2K3HA 4M02A 5KS9B 4LHUD 4B0MM 3DVNB 4LNVA 4PRDA 2VXSL 1AKJA 3SDAB 3QDMB 3R1GH 4RX4A 1IC4L 3G9AB 4ICWA 4MRCA 2EDHA 4WUKL 1MCBA 3GMMA 4ORGA 2LLLA 3FQXA 1OLLA 1NFDA 3LHPH 5D2LE 5LAXB 5I26A 3W11D 4D7PA 5JQ6H 3SBWA 5B0WA 4UT7H 1H3VA 1PXSA 3ARQA 4L37B 5CEYB 3CFCL 1A2YA 4K3JL 2A6JA 4XZ4A 3MNVA 5LWEA 3P9WB 1Q1JH 4ZW8A 4C55A 2VXUL 2F8IA 2VQTA 4LCIH 3FU6A 5FYKL 1P6FA 4OUUB 3KG5A 1W0WB 1M4KA 2X9XA 1U8QB 3CLFH 2QV4A 2WNWA 4X4XA 5B38B 1IM9D 4WI0A 2XV3A 2NY2C 3NMEA 1OAQH 4DZBB 4F7PB 5LQBH 5L7XH 3MUJA 4W9DC 5IMLA 4AZ8A 3E9TA 3PV6A 4OGAD 4FQHA 1BEXA 1MVFA 4LMQE 3FFOA 3DVGB 1NEZG 1XIWA 2X5PA 3OJ2C 3JTTB 4ZMTA 1D7BA 1UT1A 4O5LL 4GBXD 4YHLH 5E6IB 3HMXH 3ZKND 3OKLB 3QUMB 2J25A 5CNHA 1HKLL 3W11C 1JZIA 5ELIA 1B0GA 3QDAA 4N0RA 3DO7A 3OBAA 5J8OA 1OT2A 4Z7UB 1UD2A 5D7JD 3QQ3B 3HLKA 5KVGH 2J21A 2XWEA 1PQZB 1FGVH 3MJGX 4WTZA 1K5NB 3SD2A 1F3JB 3NSXA 1ONQA 2XPGB 2Y25A 4HS3B 3BI9X 2J8UB 1QRNA 5A2IH 4IMKA 2NZIA 3GXIA 2AI0L 3I6KB 4KKBC 5E6SB 4BUGA 1WZKA 2MCPH 3KEHA 2W0FA 3THML 1CXLA 1QQDB 1HQ4A 3FU7A 4YSTA 1IKNC 3TFKD 5CLTA 3NZHL 3I75A 3MFGB 2WUCH 3QCTH 1ES0A 3U6RA 3JWNG 3MRQB 1I4FA 2JB6B 3NJMA 5SWSA 5A2JH 1OARL 5B4MD 5H2IA 4AY0A 3VI4F 4BEIA 4ZT1A 2WLIB 2J1ZA 1TITA 3IU3B 2CO6A 4FEMA 2YCZA 2CBQA 3W57A 3OAYK 2HLFD 3P0GA 3D4YA 3VVKA 1P1ZB 2J1KA 1HH6B 2JK5B 3CSTA 3LH2L 4IS6A 5DQ9A 4KX8A 2ZUQB 5KTEL 2DQTH 3GRWA 3D07A 2CQVA 4Q7DA 5I0ZA 1E5BA 5CKGA 5I6XC 2Z35B 3W9DA 2WYTA 3VUAA 4LL4A 1MWAB 1QTSA 2KI6A 1GGIH 5BW7C 3BHBB 3GSRB 5C0FB 2QVTA 3IDNA 5BOJA 1HJCA 2BZDA 5TE6H 4C4KT 3WEXB 3TFKC 1S5HA 3RRQA 3QFJE 1G9NC 2PNDA 3QNXA 1PEZA 1T2QH 3C60B 4FD0A 1CXEA 1IGIH 3UJTH 2JQZA 5D1XB 5I8EA 3I3DA 1AQKH 4HS6A 1H0DA 3B9AA 1KXTB 5B4MC 5F71A 3RI5K 1E4WH 1AR1D 5DMKA 3MJ9H 5JW4M 1LTXA 2HLFC 2GI7A 2OMXA 1B4LA 1WAAF 4MZ2A 3T4AA 1Q38A 3MNZB 2NY6D 3GSUA 1MFAL 1SLWA 4QRRB 2XZQH 4AUUA 1FBBA 4BFOA 3ILQD 4OKVA 3EO9L 1T1WA 3CSPA 4HHGA 3NCYS 4S1DD 3ARZA 1P5VA 4I87A 5AKSA 2OZ4H 3PWVB 4HXBL 1GTFA 1QWUA 4QJ5B 1F97A 2ITCB 3FH7A 1BREA 4I8DA 5C0EA 3G6AB 2VXTL 1IJNA 4HWBL 3WS6A 1S7RA 5DHYB 2NNFA 1SXSA 4S1SL 2O6EA 4YWGL 3TC9A 1P4BL 3PNRB 1YC7A 4ELKB 1BM7A 1P5UA 2VUYA 2DJ4A 3STLA 4KRPB 3UBXA 4B0MB 1Q9KB 4R8WL 2P28B 3SGJC 1MH5A 3QBLA 3K6DA 3SE4C 2W91A 2ZT9C 3LNIA 5KVDE 4I1PA 2IXQB 4OGXH 1D9KA 1ADQA 2Y2TA 3QJFA 4MSWB 4X7FC 2AJYL 2ZXDA 1QUPA 5KSBE 3OE9A 1T0MA 3NN8A 3WLWD 3TIEB 5CZVL 1ZCRA 2I25N 2OYMA 3TO4A 4AGLA 1E67A 4A7VA 4B9CA 1U4FA 1YEKH 3HUJB 4JO2L 1EANA 4WKZB 1KCUH 1AXSA 2ZUUA 1R3HB 4X5XA 4KPHH 4U1MA 2FEDD 3UTSA 4UU9A 4OJCA 1KENL 1JWUA 4PJ7A 5FOBB 4G1MA 1CL7H 1BLIA 1F90H 2UY6B 1UKTA 4ANUA 3DA0A 5FO8B 2R1WB 3LN4B 4MB5A 4W6YB 4AGPA 2H26B 4KK8C 2RFXB 3WKYA 4N85A 3CFQA 4F7EA 5KG9B 4S1DC 3V0DA 1VZGA 5FW8A 3HBPA 4JZNA 3IFNH 4G6KH 3QZOA 4PFEA 4GUPA 4IDLA 3V6BR 3UONA 4Y1AB 5GSRA 5ANMB 4NQVA 4ZUUB 2DIBA 4RRPM 4LP5A 5EZOL 2YMXL 4GAYB 4XVOA 3QUYA 4MQ7B 4UMGA 5CO1A 4KKRA 4U1JA 4YSPA 3M7FB 5E9DB 4ZSOB 3R4RA 1R3IL 2G3XA 4Z77B 3SY6A 3MU3A 1MCEA 5I5JA 2Q2LA 1E65A 5E51A 3MXWL 5JXEA 1I1AA 4WFEE 4NERA 4Y4KB 3MTRA 5J12C 5IROA 3TA3A 3KXFD 4AYBA 4ZXBD 3MLRH 3OF6A 4NHUB 3WLWC 3HC4H 3VGHA 1M0LA 2HN7A 2VLJE 2KHAA 3BKYL 1RHHB 4AI7A 5D1QE 1S9XB 2JJSA 3MBXL 4HAGA 1WZLA 4UYPA 3L13A 1XBRA 1PMYA 3DVFA 3EYVB 4OQTL 3V9CA 1HYSD 1X0I1 3KW8A 2VKXA 3D9AH 4N6RA 1KXQA 4XVSL 2QSCH 4R0LB 5I74C 3TFBA 2A9ML 4MCZB 4FQ1H 3M86A 5D6DA 3DDGA 3CDFA 1AHWA 3DI2B 2BHFA 3RZCC 1MVUB 2ZICA 3P4MA 3QIUB 4XPBH 4NO2B 2GEQA 3PABB 1NICA 2E4FA 1LN6A 1JRHL 4WW2F 4DKTA 4UIMA 5IMMA 2VRKA 3ZMNA 6TAAA 4JRXB 2MPAH 3KL3A 1TO5A 5C0JB 2R8SH 2W65B 2GJ6A 4F57H 5TQ2L 4Z7NF 4ANXA 1JGDA 5DZNA 1U93A 1M7DB 4IU2B 2MOVA 5AENA 5BS0B 1I3GL 1CFQA 3GIVA 3DUUB 1Z3GH 2D9QB 3DK2A 1R47A 2NY4B 1A6AB 5G4MA 3SQOL 4HIEB 3FTVA 5D7LA 1J9CT 3L4VA 1F42A 5GRJH 4EVNA 1S7QA 2WSPA 2F95A 4UNIA 1NEPA 1NDTA 5HPMB 2P80D 4RMWA 3UGEA 3HC2A 5B8CA 2GK2A 5EOCH 3PNWB 1SYSA 4EN3C 1QKZH 3ARSA 4PJXA 3ULUE 1PZAA 2X44D 1OGAE 3CCHA 2FNBA 3V0GA 1G0XA 2A9AA 3OKEB 4Y4HB 1WEJH 3OMIB 2I9TB 1ORQA 5EZLB 5BV7H 4B9FA 3CXDL 1JPTH 4G8EA 1BIIA 5E1GA 5G53A 3HAOA 4I48A 4WGVB 1OGSA 1F5WA 2IH3B 1SMDA 3ESOA 1DLHB 1OSZA 3L9RB 2O61A 3BSGA 4H88L 1AGFA 2X10A 2VSMB 5F7BA 4GKLA 4ZFQA 5FWQA 4NQDB 3M7OA 1XGYL 3QJHB 4LCCB 4NKMB 2FQGA 2EC9T 3S34H 4P57B 5G55A 2GHZA 1ZK5A 4MNHA 2XVBA 4YR6A 4P4KB 2FBJL 2K70A 2ZCZA 3V4PB 4CSPA 3E1ZA 3QE5A 4A2DA 2OK0L 3OAZH 2MIZA 1VFMA 5CMAA 1T1ZB 4BK8A 5TF1H 1UACL 1QNZL 4A7UA 1KPVA 2QADD 3MV7E 5IQNA 3VU1A 1TQVA 3QO1B 2Y7OA 3HRZA 5JMRA 2YD7A 4N2AA 2H3NB 4JFFE 3LPFA 4R3SA 3E7JA 2NYKA 1IGFL 1GU8A 1BG9A 1PX3A 3EYOB 3GWJA 2BSBA 4IRSD 2VXQL 1LO5B 2EYRB 3BUTA 2NNXA 3QEQE 3CX5J 4BUHA 3RWDB 1TJHL 1ITCA 1FFPA 2GUOB 5IJKC 4NQEA 4YXHL 1U3HD 1IGYB 3BQUD 3D48R 5DEFA 2QPUA 3PPEA 3NSFA 1MF2L 1KG0B 1KB9K 2FZ3B 5TPWH 3V5HB 3NSBA 3SIKA 1QFWL 2NSXA 4XCFL 2OR9L 1SPDA 2MCG1 4ERSL 1WD8A 3CHRA 5ES4B 5HYJB 5ITFA 2IWKA 4BDVB 3ABZA 3NG5A 4YHPB 25C8L 4DIXA 1IBGL 4L4TA 3UBGA 2VN7A 5CFAA 1D6EA 5F6IB 2H0FA 1XEDA 2EXSA 3QXDA 1EERB 1Y7VA 4MMXC 4NCDA 4NC0B 4OZHE 4BJLA 1VESA 3PS6A 4G42A 1PIGA 4XMPL 1S7UA 4MKMA 5D1XA 2Y22A 3KPNB 2QADC 3IJEB 3EGXB 3HE7B 2NY1C 3DK0A 4HAFA 4LQFH 4P3DA 5T1DH 3TNNB 3CZFB 4YMPA 3MRCA 4DEWA 1CK0L 1DQDH 2Z92A 3CVCA 3JBG7 2OMUB 3QUML 2FDBP 1IB5A 1E2ZA 2KQMA 2LV4A 3L3GB 3N55A 1QHOA 4H2AA 4L1LA 3TF7C 5ALCL 2APBA 1CLYL 1OGPA 4IRSC 3WS3A 1SBSH 3ME0A 2EVFA 3B8SA 2B8OT 4WWKB 4JG0H 4JFUA 3OE6A 4QY8A 5ICYB 4HIQA 3FCUB 2PPAA 1FNFA 2X4QB 3KDMB 3L3OB 4JPWH 2PP9A 3BQUC 5IM7B 5HGHA 4YL9A 4XN8A 1V3KA 4X6CF 2QSVA 5GGQH 2Q1EA 1UZ6E 5IMOA 2AQQA 3RUGA 1S7WA 1EO7A 2WWKO 3DYPA 1OAZL 3MGTB 3UBFA 3H9HB 3L3HA 3CH1A 2J5LC 4JY4A 1RZQA 3WY3A 5ACLA 3PWLB 5INCA 1A1MA 1WO2A 4P5TB 3DIDA 3F83A 4TL4A 1IBFA 2X40A 3BUQA 5IT2H 4EUPH 4NWUH 4AJVA 3Q2WA 2KQNA 3VXQB 5EF3A 4Z7OB 5BZDB 5JHDB 4P23B 3ZPRA 2J6EL 5DJXA 1O0VA 1AXTH 5IEHB 1S3KL 1IEBB 3DURA 4XVJH 5JA8B 1IGML 5TE7L 3VWJB 5CN1A 3MBWB 4S10A 2Q7YB 4IHOA 2YKLL 2VM3A 4UUJB 5HHOB 4P2RA 1N19A 2IEPA 2Q3ZA 4BGLA 2P5EB 4AOFA 2AABL 3MRDB 4HWZA 5IG7A 4FNLH 1N10A 1CI3M 1C9SA 5F7UA 3K0YA 4JKWA 4DO5A 4AGNA 2EEXA 3PWUB 2QJDA 4DP4X 2Z73A 1QLRA 3A67L 4XP1L 1AG6A 1N59B 1PXRA 3KZ8A 2VDPB 1FORH 4WU7B 2DQDH 3KGUA 4YEFA 1DCLA 1WRFA 4HZAA 3HNSL 4TYUA 4GW1A 2MQ0A 4LAJH 2OYLA 3SN6N 1MWAL 1KJ2B 3DMMD 1NGPL 3IDUA 1MLCA 4O2FA 4PJ5B 4MQSA 4PQXA 2QVFB 3H4FA 4ZMXA 3NAAH 4JAMA 3GMPB 4N4YB 4NQCD 3EBAA 2CDEB 5I66B 2N56A 3QIWB 4DTGL 2V7HA 4NAQA 5DUBA 5FF6B 2F54A 2XU9A 4XXJA 3BO8A 3ETBJ 2YBRA 1ZGLA 1K9TA 2YGPA 5E4EC 3EHBB 3VFWB 5A44A 1R46A 5EBMB 1FPTL 1KXHA 1E7UA 2VQ1A 2NXYB 5GRXG 4EDWL 1OM9A 4AIEA 3RKPA 4MS8C 1T7WA 4M7ZB 1R84A 4OCLC 2J2ZB 4P8QA 2ZQKA 5D55A 5DR5H 1Z9SA 5AOJA 5SWQA 4UYQA 2PCPA 3NJNA 1ORSB 1LNUB 1T7VA 4I0PB 5EU6A 4B96A 2DMHA 3E6FA 2JKLA 3LPWA 3BDYH 2PMZA 2KDYA 3KJ6L 1KPRB 5AKRA 3HBQA 3N9GH 3UAEA 4XPAL 2A1WH 3BAIA 3IK2A 3MRJB 2KBGA 4HLZH 4JFOA 4GLRH 3KAAA 1C08B 3LD8C 5AB2A 4XNQB 1XJIA 1RJLB 2XWTA 5JUEL 1LK3L 2GJZB 3PGCB 2R69A 1MCWM 3BUIA 4KKNA 3AM8A 2YSTA 5T5FL 2CNZA 3WNKA 1L7IL 3FT3B 4LRNL 4F9LA 3P9MB 1E9QB 2X6AA 2BP8B 3ZEVA 3CN0A 4LF3B 5FCUL 4M9PA 3BH8A 1EJOL 5E2TH 1WS7A 2EIKB 2XXMB 1BBDH 3NUKA 2WGNB 1MJJB 4HKXA 5IESH 5IHUL 2HG5A 5CHNA 4QHNB 3S8WA 4PG2A 2E9IA 4Y9HA 1FVCB 1LL1A 2ICWA 1SDDB 35C8H 3MKGA 5E6ZA 2AAVA 1FL5B 2NOYA 2DQIL 3O3DB 4YGVB 4Z7VA 1MPAL 4BH8B 3VXTA 1S8JA 2CH8A 3HFFA 1OSPL 1BZ7A 1L7TL 1NFIB 3CMOH 5DZPA 1LDSA 1NCWH 2OMWA 1VB9A 5CU9A 1JUFB 3NFPB 4C56E 5JNYA 3NDZE 1JTPA 4Y19B 1LLAA 3FQRB 1HK6A 1T6VN 3CUPB 1LEGB 4ONHB 5BV7C 4FP8L 1FYTE 1S8DB 2EVGA 1KBVA 1U91B 2JWYA 4N1EA 4E41D 4AW4A 1MWOA 4M9OA 4BKLA 5C0DB 2ITEA 2DQHH 2HKFL 3PL6A 4WI3A 1M1XB 1Q1PA 5GRUH 2IWEA 3QNZA 3V0HA 5DWPA 4BKSC 1M7IB 2JSFA 3FUHA 3MJ8A 2V5YA 5E4IA 3UGXA 3X12B 1UD6A 5I1CH 2VMJA 5ACZA 5JJNA 2WUBH 2YRPA 4FERA 2NUTA 3EDEA 5HHMB 3HI5L 4NB7A 4CMMB 5GGTA 4KC3B 1CVRA 2G2NA 2XWDA 4IJTA 3CHOA 5IZ7A 1OCZB 4PRIA 1NA8A 2B59B 4M1GL 5FC9A 2JIXD 4Z76B 2OFQA 3X11B 5ABZA 3QUXC 1TN5A 1PLGH 3EBHA 1UADC 3IMBA 1QATA 4R7NA 2IDSA 3HFML 1JPFB 1X9UA 1SOSA 4JE0A 4QLWA 3J07A 1O5PA 3WUWA 3U4AA 1A6VH 4GQ9H 3FO9A 4HETA 1X5AA 1GY1A 3KPQB 4Q0XH 4AENB 2HKHH 5K93A 3EYUL 1KG9A 3TESA 4JKPL 2H1PL 4GNKB 4L4VE 3DPBB 4A4MA 3UEQA 4P9ML 1QI4A 1NMAH 4U0RC 5F1KC 3RL1A 5H35A 2IV9A 2FQFA 3FCTB 3M1CA 5ISZA 3ZOAA 5IOKA 3BW9A 2ZJSL 3AQZA 4MWFB 1DQMH 2RMNA 3ZT7A 5AL8A 4WFFE 4MASA 1J18A 5F3HA 3MO1A 4HJGA 5EUOF 4NN6B 1FV1B 2HJLA 3KLDA 4J1UB 5DJAB 3T9WA 3LQAH 2R0KH 2CXGA 3KNBA 5DJ0A 3DV4B 3KPSD 1HEHC 1RZFL 3EYSL 3FHAA 3KLLA 3ZGIA 3IRCA 4EI5D 3QEUA 4AEEA 2A73B 1QKPA 4PY8I 5C09D 1BGXL 2AZUA 1BRDA 1P8IA 5E8OB 3QRGL 1U92B 4AC2A 4LHUA 4JM0A 5SWZA 3RGBA 3OHXC 1U19A 3TGXA 4I88A 2R59A 4X42A 3VXPB 1S9VA 4JG9A 3Q6FB 2P7TB 3BQVA 4FKKA 3ZU8A 3OE8A 3WI9A 3SDXB 5LBSH 4LVEA 3AU0A 1DVFC 4G59C 4PSPA 2QHRH 2BRRL 1ESOA 1XSKA 1T22A 5FXCH 1ZHLB 3L4ZA 3EJSA 4XP6L 1OPOA 3TBYB 3VFUA 3RDTB 4CDHA 1B6DA 1RFDH 3DUSA 2VLME 3N6YA 4EOWH 2DM4A 3UTYA 4TNGA 1KELH 1SQMA 1UOVA 1UJ3B 2P4AB 2WLJA 1E30A 1I9RL 1AI1L 2O5XL 3IPBA 3L7FB 4R7XA 3ZTJH 4DGVL 3S98A 2G9HA 3A5VA 3POHA 4Z7QF 2ILLA 3B83A 2E27L 2OSLB 2GJRA 2IGFL 1IKNA 3U0WH 5EEXA 2F7IA 2BM3A 3V4PL 4PJ8B 3IJYB 4IKNA 4O2EA 4PJCF 3O9WB 5T5NG 4D9LH 4A7GF 4B9PA 4HUCA 3P9LB 1RZPA 4M5SA 5AAPA 3K71B 3Q0HA 5CWSB 5FYJU 3ZX1A 1DUYA 1RJZA 3Q7JA 1KIUB 1NAKH 1QEWB 1ZVNA 3VWKC 3MDJA 1IFRA 3RILA 1I8LC 2HLEB 3LQZA 1KYAA 3CC5A 1Q9LA 2ZWKA 4WKXA 3S36L 8FABB 3VQ2C 2ZCKH 3WNIA 1DZEA 3Q9PA 4RGNB 4JQXC 5T1LA 4ES8A 4AGOA 3LEXA 3FN0L 1T4KB 4M1CD 4KDTC 3CPLA 5KVFH 3OXSA 5DC4B 1MFDL 1NIFA 1S7SA 3RG1C 4GIPD 3B2VL 4N6HA 5A6LA 1J0KA 1M71A 1ZEAL 1T04A 3MKKA 4J4QA 4TL5A 1NANI 3CQPA 1E4KC 4CW1A 5BW7A 1NSNH 4WO0A 1E5AA 4MD2A 2OW6A 3L54A 5KYUA 1PZ2A 3ILPA 3GI8H 2NTWA 3I9GL 4WO4D 2C7FA 1BBJB 4EF3A 4HYTB 2EUWA 1OB1B 3CXHJ 1KT2A 1B2YA 4JRYB 1NCOA 3NZSA 2PTTB 2YXWA 4JPVL 3QQ4A 3TH4T 5FECA 1PL3A 3BESR 2DH3A 1IGJB 4WY7H 5EIVA 2VZ3A 3NIFB 4JHUA 3F7YB 4ZS6D 3O45A 4JDZB 5BRZE 5DJYB 5CF3A 2CUIA 3Q01A 1PPIA 1KPUB 1YNTF 3CDYA 3UTQB 3LSOA 4HJJH 2UZIL 4OY9A 1WBYB 4PP2A 5EO9A 5LCVL 3WIAA 4OZIB 3OGOE 2DWSA 5I2IB 3BAEH 3SE8L 1UWXK 1FFRA 4YBLC 5DRXB 4ACTA 1WAAA 4IB4A 1ANUA 4WENB 1U3YA 1NFKA 3T2NH 5BXFB 3Q5OA 1JHLL 4KU1A 1PF3A 2UWEB 3WUZA 4KRLB 1ETB1 1OTSD 4GAGH 3SGJA 3SE4A 1YYMH 2H3KA 3EZJB 1J0ZA 3TO2B 2MQCA 2OXHB 2VMCA 3TVMC 5CCKL 1D5IH 2WXHA 3ZKXB 3WHE1 4Q9RL 1KLUB 1NGYA 4F33B 4UAHA 1P7QA 2XFXB 1U8HB 1M6UA 2O30A 5A2CA 4K9JA 4X5WB 1QLEH 4PJBA 4FFWD 1GZMA 3FOMA 3TT3L 3UTXA 1GOGA 3RPKA 2BRDA 1ZHNB 4YBQD 3RVVD 3JWNE 5G5DA 4X5QA 3GKZA 1J8SA 3TN0D 1QHJA 3IU4L 5E4AA 4ZS6C 2Z9TA 5JHLL 4U3XA 2ZZLA 4RAHA 2VDQH 5DRNA 5FLVA 4P3WA 1UG9A 4G70B 3DUHA 4CGUB 4K5OA 2VDPL 3SKMB 3UYPA 4NT6B 3B5GA 4A2MA 5F7NC 2AKRA 5I19H 4UWQB 4W93A 2VLRB 1BZ9B 1WFNA 1OGTA 4L23A 4UQDA 1AJ7H 4YXLL 5A7BA 3VXRD 2CE6A 3MLZH 2VDRH 1FZMB 1KJ2L 3A6CH 2CGRH 3QWQB 4AIZA 3QHZL 4RESB 5KN5B 3FO2A 4YSDA 5FYJE 2R7EB 4LCWB 3UTTD 4Q58C 3C08L 1C12A 1QSEA 2BFVH 3FUFA 3QDJB 2QQLL 3IJHA 4BQCA 4MJ5A 1PSKL 2XV0A 5J3HD 1R24B 4Q9QH 2BERA 3C5ZC 3QA3A 1DQQA 4BSVB 2NYYC 3VE0A 2NT0A 2BSRA 2WW8A 3WLBB 5EB9A 3WIHL 2NX5A 5LLIC 3FUKA 4FFWC 1EFXA 2EIJB 1F8TH 5GSVB 5F88A 5KYXB 5M94B 2E0PA 1KNOA 3BPCB 1UVQB 4ISVA 4YBQC 5FWRA 2DQEH 3GUFA 2R4SA 3D39D 2OYPA 3TN0C 4Q6IC 1MREL 5GRVL 2B2XL 3P40A 1KEGL 1MSPA 1SEBA 2D7NA 3AADB 5CIPH 3W2DH 4UDTA 4KHTH 1KLGB 1FNEA 1HL4A 3CSBA 5DEGA 4FFVC 1PLCA 1VFBA 5G2CA 5CGYC 3VAEA 3C12A 4M8UA 4OIBA 4WV1B 5TFSH 4GINA 5JOPD 2XA8H 1DZ0A 1NIEA 1QBLL 3K2IA 4CN4A 3FQTA 4RISH 3INOA 2TRHA 5LJYH 5DQDL 3RZCA 3ZMRA 2WTRA 1QBMH 2P26A 3CDZA 3EKCA 5D2NB 5I6NA 1M05A 1ZHKB 5CJOH 4EZLA 4MQTB 1ZLUH 5HD8D 1MLBB 3WAKA 2IAND 5HDBF 3HZKA 3VTMA 1DBAL 1TOXA 4P46C 3KBHE 4PGDB 4HIXH 4KUCD 1P9MC 2DN7A 2Q2EB 3ZPQA 3A22A 3BPLC 4D0CA 3MLXH 4A68A 3NIGE 1IE4A 2N01B 4XX5A 3IVKB 4OI9A 4FF9A 1CGVA 3DGDA 4PRDB 1AKJB 3FN3A 2QLVB 3LQAC 2GY5A 5EU4A 2C7UB 1NAMH 4ORGB 2ZKHL 3I6SA 2OM5A 2CPUA 3FQXB 1NFDB 3UAFA 4B9JA 5DD3H 3OLEA 4FN0A 5IBTH 3OXRA 1JYXA 1H8LA 1J1OL 4PJ9D 4QNPF 5EWIL 5SX5H 1QI5A 3QUKA 1A2YB 2HSIA 4EN3A 2GC7C 2A83A 4HF5H 2BINA 3GSOA 3KLHD 2EUVA 1IBBA 1J5OL 1A4CA 3HMXA 2WSKA 1N8ZB 1JNHB 3K2KA 4WTWA 3MBED 4JFDE 4LU5L 2W80C 3LNFA 5BRPA 4R7LA 4PJIE 1QX1A 4X4XB 2VOTA 3RVUD 4FXLA 5CINH 1RZKH 1JYVA 3D85D 4AG4H 1TZHA 1PY9A 2WYZA 3V4UH 3KM1A 4O00A 4TN9A 3GO1H 5FYKE 3QWNA 1C7SA 1TETL 4FX5A 2IAMD 4I3SL 4JFHE 2YUXA 5SX4I 5LWYH 5A2AA 2HJKB 4NUJA 1PBYA 4ZFOA 3TBTB 4HEPA 1QPKA 2W95A 2ZWSA 5F7KC 3SQRA 1PY4A 3NESA 4M7KL 4YZFE 4GW4A 5AKVA 5AVZB 1INQA 3SO5A 4F7TA 3NEEA 1X6NA 2F15A 3ZJAA 3JYCA 3AREB 3Q44A 3VI3A 1B0GB 3D18A 4U1GB 3DO7B 1SQ2N 4RRPG 1AO7B 4ONFL 2XYCA 4PJ9C 3LAFA 5H2JA 1L9PA 3BKCH 5GIRA 3WFCH 4RMRA 2DLIA 1M2VA 1UD8A 5JW4N 1P4IH 4NOFA 4ETYA 3TIDB 1BQRA 3U9UB 4LEXL 4XN7A 5A3IC 4LNRA 1ZXKA 3FUDA 3NJLA 3LPPA 3B7UX 1QRNB 1SUJA 4N24A 3MBEC 4TULH 2DQMA 1K6QH 4QJ4B 2FBRA 1JXKA 2CPCA 2H9GB 1MI5D 2I60L 3RVUC 4OLEA 5ALBH 3S96A 2FGWL 5IJKA 1J8HA 1BPVA 1PDKA 3I75B 4GS7B 2PLTA 1ES0B 5DD1H 5GHWL 3U6RB 2IAMC 5FM4A 1F1AA 1I4FB 1DN0A 1AR2A 5L4JA 4MDJA 1SXZA 3WL9A 1QRKA 4WF7A 5AYQA 3P0GB 5F9DC 3T0AA 3WFEL 4DNLA 4OJYA 3VD3A 1V3LA 4IS6B 5LXGH 4LSPH 4MMXA 2W38A 4RMTA 2XHNA 2WNGA 3PDDA 1U3NA 2W92A 3O3EA 5CAYB 4YSEA 1VEOA 3NJFA 3PE9A 1OP5H 2Y07H 4DPRA 3AJ7A 3P3YA 1H6FA 4JHAL 4OZGF 3MJ9A 2W94A 5IB4B 2E47A 4OLWH 4EQ2A 1EBPA 3T3PE 2NLJA 4AYFA 1OHQA 2XRAH 4IRSA 3UBXI 1AQ8A 2QPSA 1RCYA 4QXTA 2JKWA 3IDNB 4GPOA 1GKEA 1LM8V 2HJFB 3PWPE 3DXAD 1CR9H 4KQ4H 4L8SC 1TFPA 2XQYA 1EHLH 3BQUA 4G7VL 1E27B 3CH8A 3QNXB 1KEML 5C08E 4OCMC 3KBEA 2PP8A 2OZ4A 4DUXA 3I6LE 2F2HA 3ARDB 4EKJA 1K2DA 2D0FA 4OJEH 4PJGA 4HSCX 3CFBB 1OP4A 1MFCL 2QL1A 3D33A 4RZCA 3HG0A 1BX2A 3ZGHA 3D69A 3NS0A 2DZEA 2Y2WA 4WHCA 3FF7A 5DMKB 3GZKA 4BGDA 5L0QB 1QI3A 5K33A 4P2AA 3NCMA 5ESQA 1UA7A 4D7BA 2NDFA 5IJBC 3NABL 5AWNH 3GLEA 2BNRE 1DBJL 3HJ0A 2NY3D 2Z93B 1W16A 4PI0A 4RBPK 2VR5A 4TUUA 3KVQA 2QSQA 4HV8A 3HKFA 1EAJA 1DLFH 4CVZB 1NWOA 4W9KC 2MOGA 1J1XH 4I3RH 1EDYA 4QXGH 5IGXH 2CD0A 4KVCH 3VSQA 4R4BA 3AY2A 1A9BA 4LVNB 4O58L 1S7RB 5AW8B 4DP6X 1NLBL 1KCVH 2L8AA 1P5UB 3UBXB 4BA0A 4XNDA 2LABA 3MGOA 3I2CL 5LGHH 1MH5B 2BVOA 1R75A 1A6UH 1FG9C 4OZFA 5LDSA 3UZAA 1HXYB 3QJFB 4LSRH 2ID5A 4M3HA 3L16A 4OF0A 1T0MB 3MV9A 1R3JA 5H2HA 2D4FA 3FMGH 2OI9C 2A4CA 4M8QB 1AXSB 1J11A 1JV5A 1A6WL 4X5XB 6PAZA 3PP3H 4UU9B 3FQNB 1JWUB 4GXVL 5LN8A 4G1MB 3LRSA 1D2OA 1DVZA 5B1JC 2X2HA 4LVHC 2HVKA 2DQGL 2E74C 3WN5B 5KOMC 1BVNT 2DEWX 2CJSA 2WXNA 4F7EB 2IV8A 2FJUB 2W9DH 2OA9A 2B0SL 2CJ3A 3T6WA 2WWOA 5C6TL 3SYPA 2OZNA 4AYSA 4JZNB 1WUZA 4GUPB 3SKOA 2CO4A 2IQAB 3FL7A 5GSRB 4HUMB 3DO4A 1A0QH 3U30B 2DYPA 5I6MA 2EE2A 4YQXH 4G8GE 2HKAA 3WXWH 1KGBA 1DVTA 1MRDH 4X8CA 3P54A 4J3VA 1I1AB 2Q3XA 3TA3B 4JM4H 1R6VA 4KXAA 1DHKA 3U7YH 3DTUB 4XP9L 4XMKH 3FU9A 4HJUA 2HN7B 3MCLL 2FUTA 1FN4A 4Z7WE 4YDVB 5EV7A 1UH4A 4LSVH 5DJ2B 1F4YH 1DBBL 4NQCA 5EEZA 4HPOH 4JANA 2VR4A 2KSAA 3RA7H 4JCMA 2PW1A 3QZNA 1MCQA 1RK0A 2Y3AA 1BD2D 4QRAA 1GGBH 1C8RA 4U05A 1JTOA 3JQOB 1Q0XL 1CLZH 4N6RB 5B1KA 4APXA 4AQ1B 4GO9A 1NGQL 5CUSH 1TO4A 4PGBA 4ELME 3RWCB 5KW9L 1O7DC 3BGFB 5GS1B 3CHQA 3W5MA 4N0YH 3P4MB 3V2WA 2XN9D 4IBSA 3BZ4A 3OL2A 1I9JH 5FV1L 4UIMB 3QORD 1PZSA 5IW1A 3HN8A 2OMYB 4HFWA 2GJ6B 4XWOC 2WWMC 1A21A 4J3TA 1JGDB 4ZQKA 5I30L 4QTIH 1JCKA 4KXBA 3IFPB 4LSSH 3TYFA 4AJYV 3HPLB 2DQ6A 3GIVB 4FCHA 5J11C 4GSRA 1R3KB 2X3BA 3B43A 2B3IA 3BWAB 4XTRD 3VCLA 1VADA 2D8KA 2AAAA 4R5TA 4DOHB