3S3DB

Structure of thermus thermophilus cytochrome ba3 oxidase 480s after xe depressurization
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Mobility of Xe atoms within the oxygen diffusion channel of cytochrome ba(3) oxidase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s3dB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s3dB02
4DPBX 4HHWA 1PZBA 5B6VA 1WA0X 2PPCA 2YCWA 3PWHA 3FSWA 4BWWA 3T6WA 1NWPA 3ABMB 1JXFA 2VSMB 4GYBA 4QIDA 4A2GA 4AZUA 2BP0B 4KOBA 3NJJA 3CVBA 5H2PA 4DP4X 2P80D 1FFTB 5B6XA 1PLAA 5B6WA 2P80A 3ODUA 1E30A 1OOWA 5IY5B 1SHXA 2ZFEA 2ZXWB 4HIPA 1A4AA 4YVUA 4UG2A 2J57A 2AZUA 4YVNA 1KMEA 4DJHA 4E9VA 4CSZA 1GS6X 3AYNA 5D4JA 4AMIA 5J7AA 7PAZA 3VG9A 1AQ8A 3FSZA 3MBVA 5ETZA 3UZAA 1BAWA 3ZBMA 3QBIA 3COCA 4IARA 4MQTA 5AHZA 1EHKB 5JJEA 1L9QA 1QLEB 1L9TA 4FPDA 2IDTA 1GUEA 4FBZA 2WJKA 2KS9A 4N6HA 3REYA 1JOIA 3U25A 1XIOA 2BW5A 3HEIB 1NPNA 2GIMA 1JZGA 2XX1A 1JGJA 3ABGA 5B7MA 2BP8A 2WO2B 2BP8B 1BXVA 2RACA 3EH4B 1GS8A 1M57B 4A2HA 5B7FA 1KG9A 2VMJA 2I85A 2FT8A 5AZUA 1J9QA 1A8ZA 2YAQA 4A67A 4AX3A 5I6NA 1V10A 1M9WA 2FJSA 4J4QA 3IE9A 3X1NA 1PXSA 3WIAA 2QPEB 4Y9HA 3TASA 2YCXA 4K5YA 1AZCA 5B1BB 1L9RA 4GYCA 1BQ5A 2YXWA 1R84A 2X72A 1ILSA 3FU8A 4G7RB 1NIFA 4YL4A 1IBYA 2H5UA 5KKHA 2UXVA 3V9EA 3DKHA 2Y00A 4QI1A 3EF4A 3PLYA 4AKPA 1PMYA 2NRDA 5I26A 1PF3A 4HCIA 4F7KA 3PQRA 4CSPA 3UABA 2JFCA 2CALA 5AWZA 3QJSB 2YAEA 4HALA 1FWXA 3UTVA 3SBPA 3NY8A 3QJQB 4TL3A 2XU9A 3VVKA 1ZPUA 5AZDA 4BV0A 1OV8A 1RCYA 3CVCA 3PAZA 4DP0X 1JERA 4AKOA 4KOCA 2XX0A 4GP8B 4YSUA 2ZWNA 4OV0A 2DYRB 4N4YB 2JXMA 3S3CB 1PNDA 4GPOA 4XTNA 3HAOA 1H2SA 1ASOA 1WA1X 4UF7C 3NSFA 2EIKB 1BRXA 1NIAA 3GXUB 1TEGA 3QQXA 4UANA 3SN6R 3H4FA 3KW8A 3OM3B 1JXDA 2GB2A 3P0GA 4KNFA 1OE1A 1GW0A 1F50A 1XMEB 2I35A 2N0MA 3UGEA 4E9TA 3HASA 4G7QB 1NZRA 2YAFA 2PLTA 4BWUA 2OCCB 3ASNB 3IBOA 3UACA 2AZAA 4DP5X 5G36A 3OE8A 1IKOP 3CODA 3BQVA 1JZHA 2AFNA 1S54A 1AACA 5G53A 3AW5A 2YXVA 3H4HA 5EHFA 2YQBA 4YSQA 4JKNA 4NERA 1SJMA 3QBLA 5LWEA 4E9WA 2UX7A 1XB6A 2BO0A 4LDEA 4BDVA 1IBZA 2XUWA 5G28A 1L0MA 3ASOB 3MX0B 1BXUA 3CG8A 4UAHA 4BDVB 1AP9A 1L9OA 2FQEA 2IWKA 1PAZA 2R7EB 3RFMA 1NWOA 2R7EA 2YAPA 5B6YA 2OJ1A 2ZIYA 4HZ1A 1OE3A 4PXFA 3ZPQA 2FWLB 5H2LA 5DYSA 2VSKB 1IUZA 1NPJA 5A44A 1PNCA 2GI0A 4N8UA 3X1GA 5B7EA 3FU7B 1QKOA 4MD2A 3QPKA 3AYMA 2HX9A 5I5JA 1BEXA 8PAZA 1E65A 4X31A 3X3CA 1ZV2A 4YSPA 3SBQA 1X0K1 3QJRB 1JZFA 4L0PB 2NTWA 4JQ6A 3RYMA 2UXTA 2J55A 1JZIA 2ZZLA 2FNWA 3UAAA 1GS7A 1ILUA 2BRDA 2IWEA 4LDLA 3PDSA 2BWDA 3KW7A 4XTLA 1OCCB 1PZCA 2QPDB 3CAPA 3OQRA 2XVBA 5H2NA 1F4ZA 3PAVA 2PPDA 1J9RA 1QNIA 5JJNA 3UTXA 1E5ZA 2PCFA 3S8FB 2PPAA 3NSCA 2PPEA 3HB3B 3NY9A 3UONA 4QRYA 3IEAA 2Y1AA 1N70A 1AG0A 2FQGA 4HAKA 1KCWA 4LDOA 4G72B 1IW6A 5ITEA 1A3ZA 4MQSA 2VW6A 2H3XC 3NJFA 3NP3A 3HANA 2JAFA 4W9ZA 3ZX1A 4XT1A 2GC4C 2UXGA 2XWZA 3X2QB 3X3BA 2FT7A 4DP8X 2XXGA 5DHHA 3S3BB 4YSDA 1L9SA 5I5MA 2IDSA 1NICA 1NIBA 4JHUA 6PCYA 3OE0A 4DP2X 3V9CA 2LLNA 1S8JA 1J9TA 5B6ZA 2FTAA 2F95A 2Y02A 9PCYA 3TA4D 3EHBB 1ET7A 5TGZA 2XV3A 3DTUB 3S3DB 5D4IA 4L6RA 1AAJA 5B34A 5A7EA 3D4SA 1TKWA 1NINA 4XXJA 1M0KA 1VJMA 2Q9OA 1BXAA 1YLBB 5JJJA 4DP6X 4KO6A 2PP8A 3UAEA 1A4CA 5I28A 4KNTA 3NP4A 2DWTA 3PPSA 4RH4A 2R4SA 2VW4A 5AHYA 1AT9A 2W88A 1Q5JA 1E5YA 2XLLA 1MGYA 2PP7A 3OAXA 4HWLA 5EN0A 2PPFA 1SFHA 2JKWA 2HXAA 1N68A 2BHFA 1NIDA 2MRYA 1P8HA 3ZEVA 5F7BA 5B3SB 4IB4A 1AZUA 6PAZA 5H2HA 3S8GB 3X1FA 4BXSV 2KSBA 1XB3A 2OV0A 5I6OA 3T9WA 4P5RA 1HFUA 3HAPA 1A4BA 5AX1A 1KCBA 4AI7A 3ZDWA 1FBKA 1CYWA 4JR8A 4BWTA 4DPCX 1AIZA 1HAUA 2ZONA 3BVDB 2IDQA 2B3IA 4TXVB 1MZZA 4A4MA 5TK4A 4M4RB 3PXOA 1PCSA 1MZYA 3WI9A 5B1JC 4BK5C 4YSRA 3FSVA 4A2EA 1JVOA 2IDFA 4YSCA 1AOZA 1ZDSA 4DKLA 2HZHA 2TSAA 1W6WA 1ASQA 2FQFA 5I6PA 5F8UA 1GY1A 2I1XA 5AX0A 3AY2A 2PEDA 2CJ3A 1L9HA 4X32A 2RH1A 1KGYE 1M0LA 1SF5A 2VW7A 1F88A 4X4KA 4YSAA 2YARA 1PXRA 5LDUA 1E0PA 1TU2A 1HZXA 1KGBA 2HX7A 1PY6A 1KDIA 1Q5IA 5DHGA 2IWFA 4NB7A 3T6XA 2VT4A 1X9UA 1ASPA 1RKRA 2CCWA 4G7SB 1BYOA 5PCYA 1CWQA 3WNIA 3QJUB 1R2NA 3QDCA 3D12B 4W1TA 1NIEA 1SNRA 1BQKA 5PAZA 1SHWA 5AKRA 1DYZA 2X87A 2UX6A 3PXLA 2IH8A 2I7OA 1S52A 4PXKA 3VGAA 5A8EA 1S8LA 2EI4A 4P5SA 2WJLA 2EIJB 3DIVA 3QAKA 3AG1B 4HHGA 2HLEB 3C9LA 1UCQA 2Y03A 4EJ4A 3GDCA 3H56A 1ETJA 1JVLA 1AR1B 1NTDA 2J56A 1JV7A 3QJVB 1UAZA 4AMJA 1IW9A 1KG8A 1RZQA 2YCYA 3IN2A 1OCZB 2I21A 4IAQA 1J5CA 4KO7A 1XB8A 2PP9A 4DP9X 1M0MA 1PLBA 3VW7A 5D4HA 3T6ZA 1QHQA 3UZCA 4F2FA 3FPYA 3ABWA 4EIYA 3QBGA 1VGOA 4UHRA 1AS8A 4BXVA 5H2KA 4EF3A 3DQBA 1QM8A 5B2NA 1M56B 2ZOOA 1KYAA 2YAMA 2VM3A 4A2DA 4GBRA 5H2JA 1CC3A 3NSYA 2LNLA 4FAAB 3WNJA 1AANA 1MG2C 1RZPA 3CVDA 2Y01A 5C1MA 3VHZA 3V2YA 3WKPA 2GBAA 4GP5B 5A45A 3NJGA 3FPXA 5G2CA 2EILB 4YSTA 4PAZA 4WKXA 3L45A 1KDJA 1NDTA 3CDZA 4HYJA 3CDZB 1MDAA 1LN6A 3ZIYA 4BVNA 4MFHA 4BEZA 4KO5A 1OCOB 4NC3A 2UXFA 3X1EA 4F2EA 3PBLA 1MG3C 1AZRA 4X1HA 1SF3A 1WS7A 4ZK8A 3C75A 3FS9A 2L6XA 4A66A 3A7KA 4E9SA 4E9RA 2BWIA 3ZPRA 3DDLA 2J4YA 1BRDA 3FU9A 3IN0A 2BP0A 3N55A 4HCGA 2M3GA 4BUOA 7PCYA 1X9RA 1C3WA 2AT9A 3OMNB 3VI0A 4N4WA 4A68A 1X0SA 3TU6A 1R1CA 4Q8BA 3FYIB 5G54A 3EH5B 2F93A 3UTYA 2GHZA 3NJLA 5FC9A 3UADA 3WKQA 1OCRB 4ENZA 1BQRA 1P8IA 2AANA 4JHVA 4K9JA 2KSAA 1W8EA 3KJ6A 4MD1A 1KBWA 2NTUA 1SFDA 3C9MA 3FQ2A 1X0I1 5ANHA 1WS8A 4A2FA 4JKVA 1L9PA 1CURA 3T6VA 3FQYA 4G71B 4KLYA 2YDOA 1AS7A 2HPYA 1BM1A 1QHJA 1A65A 1SDDA 2CBPA 3JTBA 4QKTA 4YSSA 1SDDB 1F56A 4KNUA 1ZDQA 1GYCA 1DZ0A 2Y04A 4HCFA 3SBRA 1PLCA 1O0AA 2W8CA 4WW3A 1GU8A 1V54B 3MBWB 2EINB 2IDUA 3OMAB 1EZLA 1B3IA 1JZJA 1S51A 5H2MA 1ID2A 2HX8A 4DP1X 2QDVA 3HARA 4L35A 3NS0A 2H47C 3AM6A 3QAPA 3NJKA 3NJIA 5B35A 4YSEA 4G70B 1CUOA 2QDWA 5B1KA 1H68A 3NJMA 1GY2A 1V55B 1QKPA 4Q89A 2JAGA 1URIA 2DYSB 1E12A 2Z73A 2I7SA 2IH9A 2YAHA 1BYPA 3WG7B 4KNSA 5G2DA 1W6LA 2DWSA 3OE9A 1OE2A 3FQ1A 1C8RA 1HAWA 3OE6A 1FBBA 1WA2X 2DV6A 2B08A 1AS6A 3FYEB 1GSKA 2A3TA 4GY4A 4KO9A 4PCYA 2FQDA 2XV0A 3AG4B 1T5KA 4DAJA 2HRHA 5B0WA 5G2AA 4BWBA 3ABKB 1I53A 3NT0A 5I5IA 3FT0A 3NYKA 1ZIAA 1GZMA 2VM4A 4FA7B 4AKQA 4GRVA 1ZIBA 2BZCA 2WO3B 1UATA 1ET5A 4MBSA 5H2IA 3NYAA 3QBKA 1ET8A 1JXGA 1KV7A 2MTAA 3PAUA 5TK2A 4EA3A 1AG6A 1KBVA 1FA4A 3WQJA 2Y69B 5BR2A 4WAVA 3FSAA 1JFPA 2KSYA 2Z55A 1IXFA 3ERXA 1J9SA 2Q5BA 1PY0A 2I20A 1E67A 4WTQA 3NSDA 4BEYA 1DZEA 2E86A 4E9XA 3AG3B 4NAJA 4M3HA 4E9YA 2CUAA 3NSBA 2EIMB 3NJHA 1OF0A 5I6MA 4XT3A 1U19A 3JT2A 5FJGA 2PCYA 1WAEA 2XYBA 2G87A 1IC0A 5E9NA 5B1AB 5AFAA 2BW4A 2HRGA 5I6LA 2FT6A 1P8UA 2J5WA 3RZEA 3GYRA 4GXFA 1J5DA 2BZ7A 2GSMB 3G5WA 1TEFA 3UTWA 2TSBA 3T71A 3PCYA 3N2JA 3TBBA 5ITCA 1AZBA 1BRRA 1JZEA 2IAAC 1CYXA 2WSDA 3NJNA 4YSOA 4E9QA 2DY2A 2X88A 1S53A 3OD3A 2AVFA 3CZUB 3V2WA 3SQRA 3EMLA 3T45A 2XXFA 3EH3B 2R4RA 1ADWA 2GC7C 4GP4B 3QJTB 1PZAA 2QT6A 4XTOA 1VLXA 2XV2A 5F7AA 5B1JA 1AZNA 1GR7A 5BR5A 3FU7A 2YDVA 2YCZA 3X1BA 3HAQA 4DP7X 2VN3A 5I6KA 3OMIB 2YAOA 4DPAX 4HYXA 3AZUA 3UG9A 3ABLB 1JV6A 3TBCA 1C8SA 1XJIA 2CAKA 1TN5A 3AG2B 1TN0A 5H2OA 4QLWA
chains in the Genus database with same CATH superfamily
2YEVB 1E5BA 4FHJA 5E1IA 5F6HJ 2KLRA 1TTBA 1RJYA 2FYYA 3C12A 1ACZA 4QTHA 4ZSOE 1A7PL 4L8CA 3QAZC 4C56A 2J20A 3NK3A 5F89B 2V5SA 3BWAA 4ATTA 1M6UA 1EEYB 4G6KH 3WTTA 1ZLWK 1FFTB 3ZTNL 1J05A 1MPAL 1B88A 3G5YA 3ES6B 4Y2DD 1QR4A 1MFVA 3ULVC 3EUUA 2R2BB 1UZGA 2XKNB 5FF6A 5HHPA 1GIGH 1TFPA 3A6BL 4Y2LA 4NHUA 3T0EB 4HEPA 4NC2B 3KH4A 1LO2H 1F1AA 3V4VL 1YY9C 2KZKA 5EO0B 4U1LA 1YECH 1L9QA 1M7DB 4EDWL 3AUVA 3ZDXF 5AAWC 2MPAH 2EACA 4TNFA 4P2OB 2BHYA 4XOAA 1DEEB 3J8F7 4F5CA 4GRMB 4NDMB 1C5DB 2CR0A 4KDVA 5HGDA 2X89D 1I9RL 3VXRE 5EPMA 2I85A 4A67A 5I8CA 4QHUA 4HETA 1BD2E 3VXSB 1XGUA 4H20H 1J8RA 2FNBA 3ML8A 4PWEA 2Q0ZX 2NSXA 5D1QC 3ZHFA 2WINB 2QPEB 2BVTA 4NT6B 3DRQA 3KYAA 4ACPA 3QIUB 1EVUA 1BQ5A 1SQMA 5JQ6H 2XRAH 1IBBA 2Y24A 1SDYA 5L8KB 4YL4A 2NXZC 5B22A 5IOKA 3Q48A 1CIUA 5GGRB 4JFDA 4QRPB 1TO4A 3HG4A 3HE6D 3INOA 2ZYRA 2JJTC 5I26A 3DJSA 5E8EA 5GGQL 2JIXD 4M9PA 4CVZA 3VGHA 1FL3A 2RFXA 4XMTA 2PYEB 2XTLA 5AZDA 1OV8A 3VXPA 4GRWE 3HKZA 5GISL 1CXKA 1XGTB 3EG9A 4FHBD 4I0KA 4AKOA 3D4ZA 4N8VA 4X9YA 5CCGE 1CGTA 3KVPA 5E6SB 3ARGA 5GRJH 4G1EB 3UO1L 1T7WA 5DWPA 2OI9C 2PR9A 4FXLA 4K3GA 4NBYB 3MRJA 3WNKA 4J3OH 4W9IC 4HJJH 2W94A 1JUFB 5HDQL 5E94A 3O2WL 4HEMA 4YHZH 4DW2L 2F19L 3P4MA 3X12B 2I35A 2BPBA 2K6ZA 5HHMD 3O9WB 1HH6B 1N2RB 4YE0A 3UTSE 5KUMA 1JNHA 1JK8B 1MCLA 1FE8H 2NX5B 4FQQB 4S1RH 3K71A 2BDNL 1SEQH 4M6NH 3CODA 3RB5A 1G4MA 3VAEA 4FZ8H 1P7KB 1DZBA 4MXWH 2YXVA 1U95A 2X3BA 1RHHA 1FL6A 2C3HA 2J5LC 4B95C 5LWEA 3VWJD 1J0HA 4AEIL 1CLZL 3E1F1 3HE7D 3TZVA 4G8EA 2Z0BA 4OI9A 5E2UL 5AYUH 4UQ2B 3WNNA 1UADC 4NIKB 1JWMB 1OE3A 5FA3A 4PXFA 1JNNL 2ZJSL 3B7RL 4J1UB 1T66D 4H7VA 5E99H 2NOYA 5GZOC 3BT0A 4I9XA 4KRPC 5CNHA 1AGEA 4JBSA 3FN0H 1X0K1 1UM4H 2BIOA 4N0YH 1RIUL 3NEEA 2EDKA 4QRRD 4X5WA 5E00B 5B3JE 2YC1A 3QQ4A 4AIZA 4FFTA 1KENL 2EDOA 1JZ7A 5AZEL 1NBYB 3QSKB 5H2NA 3WIFA 4KUZH 3CN4A 1DLFL 2R4SH 1SJHA 1XT5A 3UTXA 2KQMA 2ATKA 3L5XL 1CL7H 1RU9H 1WK0A 2ZPKL 4ONHB 1HXMB 2ZWYA 3ME0A 5ETUB 4FF9A 3LDBB 3MVSA 5DRXB 1JYXA 4HAKA 1NFDF 1FFQA 2WWKO 3C2SA 4B0MB 2JELH 2GUYA 1E0OB 4PJ5A 5CHNB 1Y7VA 2JAFA 3DUSA 3GIVB 3OKLB 4W9ZA 5I17B 2HVKB 4JHAL 5I19H 2IFGA 3X3BA 2MKLC 4XWGL 4L5FE 2XXGA 1YA5A 4QXGL 5BVPH 3SDAA 3L1EA 5C0NC 3O8XD 3FB6B 3KGRA 5HHNB 1CGSL 1U3HC 3C8HA 3IXTA 4F5CE 1A0QL 2WYTA 4DSYA 3VJ6B 1FF5A 3VTTA 3MRPA 3ZKMD 9PCYA 2GT9A 3CFCL 4GIAA 2L7UA 2QVFB 2A74C 3PL6B 4JNXA 3CFNA 3PHQA 3VFGL 2XG4B 4GAYB 4ZX6A 5C8JA 2O6CA 2EVHA 5CSZA 4DN4L 2KDYA 3W0WA 3HRZB 3MXWL 4PGBB 1A1NA 1HCVA 3VFTA 8FABA 4KDTA 5J57B 3POHA 3DETC 1JWUB 3EJTA 3OWEA 2BVOB 3PG2A 5C0RH 4U33A 1GGBH 5HI5C 3DGGB 2W07A 3ENEA 4HOMA 5J7CC 4WK4B 4XCFH 3B3IB 2VW4A 1JHTA 1Y07A 2C4FU 3NCEB 5FWQA 4KJWD 2VDKH 2XN9D 3OXRA 3GHBL 4GSUA 5C09A 3ULSA 3QHZH 2JKWA 4PV1C 5T5FL 4MD4A 1N68A 3W9EA 5AOJA 3P3SA 1MKFA 2HFGL 3PYCA 2WP3T 1ZLDA 4EI5A 1SMOA 4HKXA 3MNMA 4OZHB 4PHZA 5B3SB 4PUBL 2LU5A 5LXGL 2WXOA 2NXYB 4R4BB 3QUMH 5HHOE 1ZEAH 2XTJE 3P9LB 4S0SD 2CH8A 5ESAA 4IGBD 2Y36L 1EJOL 3BKYL 5GRUL 2QMKA 5EA0L 3HVNA 4JHWH 2CDGA 2E6JA 3BN3B 3LRMA 4A2EA 1V7NL 1JVOA 2WD0A 3PGDB 1QFUH 3PJSA 3S4SA 3BX7C 2K9FB 4KK6D 1N0XL 2EXYD 2RHEA 3CC5A 5KSBE 1LP9B 1GY1A 3DOSB 3IB4A 1R3LA 2CJ3A 2BSRB 3FRPG 4F7PB 2YA1A 4KMTH 2EVGA 2FO8A 3CDFA 2ZWKA 1OAZL 1TU2A 3JTSA 4K5MA 3SKJH 3L9BA 1PY6A 4NB7A 5ICXA 1X9UA 3HG2A 3MCKB 3PHOA 4GW4A 4ELME 3DX9A 2VNCA 4GINA 2WQAA 4I77H 4ELKB 3ALPA 2H2SC 2NY7L 4JB9L 1BJ1H 3ZT5A 1LO0L 5PAZA 5FGBA 3L4TA 1OGPA 4LLAA 1FH5L 5F3HB 2W9EH 2XIDA 1E3ZA 1E5CA 5JW3L 2AV1B 5IMKA 1LO4L 1RZGB 3QDME 2KPWA 5KJRH 3NH7L 3JWNH 3GDCA 4KITB 4KDWA 1USZA 3OAWA 1WZ1L 1W16A 1RLBA 3RL2B 1EGJH 3GI8L 1IGML 3LKQB 1A4KA 4DUXA 2GJZA 3BEVB 3H6JA 3ARVA 3EFFA 4WHDA 5CU5A 3T3PB 1EDQA 4D0CA 2HJFB 2XTSA 3LD8C 3FUMA 1OCZB 2JKSA 2Z35A 4V1DD 1O9VA 3VFWA 1JBJA 4XGZB 2HKHH 4CA4A 2NPLX 1PLBA 2EDJA 1WG3A 2XY1A 3K5RA 1J8KA 5TF0A 35C8L 3K4AA 4EIYA 1VGOA 2ZCKL 2E0PA 3GSNB 4X4MA 4ZUUA 1R46A 3DQBA 4EF3A 3P0YL 5B2NA 1R5IB 2G75A 3MACL 2YD5A 2YAMA 1ZHBB 4EIZC 4ODBD 5I24A 4DQAA 4Q4IA 5JO5A 2IF7A 3VHZA 1YNTA 4PJ5E 2ITEA 4CBZA 1SEBB 1EV2E 3TO2A 1EDHA 1N8ZB 2FD6H 5DUBA 2VDQH 3L45A 3VXNA 2OL3A 5EN3A 3QUZD 3ZE2E 4AEFA 1JSYA 4ERSL 4FZEH 2CXKA 3RU8H 5AG8A 4Y7MA 4XNAA 3SE3C 1NUDA 2NLJB 2UXFA 1MVUB 3X1EA 4F2EA 5JZ7D 4TSAH 3TT1L 4NP9A 3TURA 1UB6B 4GXVL 3HI5L 1ERNA 4WUUD 4NQXB 2J4YA 4CW1A 2F6AA 4PJDA 2MCPL 3ARGC 2XFGB 3G6AB 5JHDE 1GJWA 1AQDB 1QSZA 1M1XB 2WYHA 5DUPH 5D7IE 4AW7A 4XXWC 4W93A 1F4WH 2NYZA 3G7TA 1RAMA 1JGIA 3ESNA 4PR5B 4V2BA 3BP7B 1BAFH 2IMNA 2IG2H 4TSCL 5I0ZA 4QR7A 5JDJA 3FUJA 1SVCP 2AANA 3OAYK 5DJAB 5ID1A 1W8EA 1OHZA 2WZAA 2YKLH 3LZQA 2BNRE 1IGYA 5ANHA 3WUWA 3NCJH 3L4UA 2E74C 2C9QA 4KHTL 1C16A 3MRLB 5CBEA 2IALA 3DDFA 3JTBA 4QKTA 4XVUD 5SWQA 2YSSB 5BV7C 2CDEB 2YK1L 5DFVD 5I1DB 5D6CA 2EXWC 3SZKC 3SBRA 1PLCA 2XPYA 4R7DA 5CJOH 2HG5B 1A66A 1EZLA 4H2AA 4LPUA 3TZVC 4I2XB 2VKXA 5FFOA 4H8WL 1IGFL 3FHQA 5B1KA 4MMXA 1SY6A 1I7UA 3UL4A 3LS5L 3W2DL 1U9KA 5F96L 4AITA 3WTVA 4P9HC 1BYPA 2ZQKA 1EZSA 5C0BB 1PX8A 1ZTXE 1NM4A 2D2CC 2O6FA 2HTKD 2NQ3A 2DV6A 4JFTA 3S5YA 4K0OA 1ACYL 3T77B 1UXWA 4Y88A 1C08B 1TZ8A 4NQCA 1D5IL 5EUOA 4YO0B 3NT0A 5AAMC 3ZKNC 2OA9A 3BZ4B 2R8SL 2VQ1A 4FQ1L 2VM4A 1A14L 1FI8C 4AKQA 4F7CA 2YGNA 1CGVA 4G11A 1ET5A 1KPRA 1XIWC 4EA3A 2ENQA 3ZYZA 1MJUH 2H0JA 5I66A 2Z55A 2BVUA 1GC1C 1AXSB 3GSVB 4FQHB 3BZ5A 4LRIA 1EHLL 1P4UA 3UP1A 4J3TA 1QNZL 4NO2B 3TBSB 1U8OA 1MCBA 4KPHL 4DZ8A 5IESL 4R96B 3GSOA 3UEZA 3MRHB 3SDAC 5FJGA 4MDIA 2PCYA 2VH5H 1FG9C 1B0RA 4AL8L 3CQPA 1XF5A 3WL9A 2V4LA 4EI0A 2Z31A 2CLRB 1R5VA 4JM2B 3ULVF 2WCGA 2X53A 3T0VA 3QQ9D 3G5WA 1FZMB 1W8NA 4UINL 5DJXA 5IBUB 4X4ME 3BH9A 2FUTA 3QJFB 4NNPH 3CSYA 3LXAA 1C8QA 4V33A 1H5BB 4M7JH 5E5MB 4OKVA 1KFAH 3SJVE 1NLBH 1Z9SB 2J1YA 2ZKYA 4ONGH 4KDTC 2GY7B 1Q1JH 4O5LL 3B2MA 1QMUA 3QUGA 2DPKA 2FGWL 3MV8A 4YXKL 5JHMA 1RUKL 1MY7A 2H32B 2DJ4A 4JL2A 1F3JA 3RL1B 3X1BA 4DP7X 2ADIB 5IG7A 3UG9A 3FRPB 1T20A 3BFOA 2R1YA 1F58H 1U3NA 3Q6GL 4AEHL 5FIEA 4LSVH 4EI5C 5C6PB 3L4CA 1TETL 4JO2L 3VRIB 4JVWA 4Y1TA 2YO3A 2GIYA 2OMVB 4CJ0A 3C6SA 3QHFH 1JXFA 1G5GA 2PWHA 3F7VB 3NIGF 2VXUH 2N59A 3V0DA 1BW8A 4BUGA 3BW9A 1Q0YH 1NLDL 2DBLH 4LLMA 1CXLA 3EKCA 5B6WA 3QZPA 3PWNA 5DVLA 1UWXK 4HMDA 4ZPVA 4A7GA 4IRZH 4K7FB 1I8MB 2ZUSA 1KNOB 2PWEA 4JRFA 1G1OA 2ESVA 5FKAB 3RIFK 1TTUA 1PLGL 3D69A 1T7YA 1NMAL 4N1EA 3FSZA 4KK9C 1FNGA 4C59B 5E8PA 3A5VA 4HWNA 3U7YH 1R17A 1JDDA 2P5ED 5IJVB 4IHOB 3TTYA 5FGBC 2WKOF 4GSQA 5CD3A 4GBXA 5F2FA 1BXVA 3C60D 1GS8A 3GXPA 1EERB 5AZUA 3MNWB 4ZMYA 2XWCA 3L4WA 2VDLB 4BGLA 1JGUH 3QH3A 1SOKA 4J4QA 1O6SA 1YSOA 2WVVA 5B39G 3PABA 4XWOD 2ZOLB 4M93B 1J0JA 1LEGA 3GSRB 2TAAA 3CFUA 1CT8B 2Y06H 2WTRA 2X72A 3FU8A 4F58H 3K46A 2VXTH 5EU5A 4X6DB 5E8DH 1AP2B 2JCWA 1UWGL 1VPOH 4ZW8A 4JKLA 5EUOE 3DKHA 3R1GH 5GHWH 1INDH 4BJLA 3LX9A 2LU7A 2VDRL 3EO0B 5DURD 3ZTEA 4PJ8A 5F7KC 3KWWA 3PAZA 3KCPA 1KIRB 4N90D 1XCTA 2KERA 1U8JB 2ZCLL 3ILDA 1HXYA 4NKDB 3V55A 4DJMA 2Z6FA 4M1CC 4MBRA 2IH1A 4L9DA 4EIUA 4QRSB 1BP3B 3MOAL 1CZ8L 2BNQD 4UF7C 1ASOA 5B3NA 2XZQL 2CLVB 2AQPA 5KTEH 1SVZA 1TEGA 4GKNA 1YPZE 1ZT7B 1BVNT 3TN0B 43CAB 1YEKH 1T2JA 1B4JL 3CX5K 5KVGE 4JUTA 2ILLA 2FZ3A 5GGTH 3LKOA 4LKXB 3CDGB 4MCYA 3VCLB 3BO8A 1MJJA 4HCRH 5IHWA 2KQNA 4GRLA 5FEBA 3Q13A 4W9EC 4ODHH 4WFFE 1ED3B 1NGWB 3H3PH 4CMHC 4XNUH 5JPMC 1HZLA 1NKOA 3OE8A 5MHSD 2CJUH 1CJYA 1DSWA 1QHPA 2A6JA 3FONB 1DJXA 1KB5H 2D3LA 5ESVA 1SJMA 4HMEA 1N64L 3ASOB 4R3SB 3RGVB 2NZ9D 1HYSC 1OPGH 4D3CL 4XVSL 1UACL 3ATBA 1ZLVK 2IV8A 2OPCA 4MWFA 4RISL 4LHUD 3RZCD 4GRWF 5AQ0A 1I8KB 1DBMH 2ZIYA 5FDWB 1K2DA 3MLZL 3MRKA 2FO4B 2FWLB 3MNVB 3V7MA 1IUZA 5C7ZA 3BSZA 2I32A 3BD4A 4AXWA 4DVRL 1AJ7L 4F20A 3VXTB 1NCAL 3K1DA 4AM0A 1UEYA 4HOZA 4NQQA 2XJLA 3SBQA 5FO2A 1E6OL 1Z1WA 4PJBB 4L0PB 3QUYD 5HHVH 1IQDB 3A21A 1JZIA 4X6FA 1KJ3H 4ABVA 4OU3A 3QEUB 4H88H 4QHKI 4R2GB 3EGSB 2HP4A 2YPKB 1MCIA 5JIMA 3FCBA 4Y5VA 2UY6A 2QPDB 1H15A 1F4ZA 2VZUA 2VR6A 4MMXC 3V0EA 4K5PA 4MAYB 3S8FB 1E6JL 2PPAA 3WU1A 1U8HB 2P24A 3K6SA 1XF2B 3FMGH 1KFGA 1CD1B 1HHHB 3TA3D 3M17B 2X4SB 2XSKA 4HUUB 5AVUB 2X1PA 2ESVE 1RFDH 4Y1SA 1IW6A 4GOSA 4KX9A 1S9YB 3VMOA 4L4TB 4N0CD 3ZX1A 1MQ8A 4S1QL 1RZFL 2OSXA 3PHAA 4YSDA 2WXHA 3WHXA 3UBXA 1YUKB 3W39B 4AE1A 5D93C 4BELD 3VFMB 4JHUA 3THMH 1R3KA 3TCXA 3FH5A 3QEQD 4EUPG 1B4RA 1AD0B 2HT4C 2OSLA 3P9MA 1B6DA 1CDYA 4L3CB 4OT1L 3U0TB 2PNDA 3LZLA 1FGVH 4E5XA 5DQDL 2R0LL 1VGEL 5HYSB 2G9HA 1FAKT 4OZGB 1S7VA 2NNFA 4L6RA 1IKNA 3QFDA 5B3JF 1VFMA 1ZHLA 3QRLA 4TOYL 2AJUL 2C9SA 3WCYA 3IDUA 5L7XL 4JEGB 3IETB 1MFNA 1HEHC 4DP6X 3EYVB 3Q5OA 4KO6A 3B2VL 3CUPB 3UAEA 1ID5I 1Q72H 4M1DL 5E5LA 1X6LA 3T04D 1D6EB 1Q9LA 5HPMA 4P2OD 2V9RA 5J4MA 4N0UE 1Q5JA 2F74B 3MV7A 1S5HB 1A21A 3CMGA 1TPXC 4LLVB 4HS3B 5KVFH 3ROOB 1ITBB 1AE6L 4JUSA 3ZEVA 4FCHA 4Z7WB 1AZUA 3C6LB 4QT5B 2QSQA 5HYFA 3HVDA 1E2VA 4KNQA 4LMQE 2Z7UA 5I8OH 3GSWA 3BJLA 4PTUB 2NDFA 4QHLB 1GCYA 3BVDB 1BOGB 3TEUA 2UYLB 2WIMA 1T5XA 1CPUA 3PXOA 4YBLC 1U92B 4JJOA 1BDYA 1YEIH 2IDFA 1ND0A 2Y5TA 2Q6WA 3ULUH 1C5BH 5EZLB 3RILA 2E46A 1YQVL 5AW1B 5D1XE 3D85D 1G7LB 2WQRA 3D51A 3MLSL 4QWWC 5AYTA 2A0LD 3TO4A 3DX6B 4JFFB 4PJFB 5GRWA 1KWGA 1R6VA 3L08A 4ESKA 5JUEH 1JMZA 3UDWA 3U30B 2KDGA 2BSBA 4G9FD 5JYMA 3PFQA 1Z3GL 2H32H 4WUKL 5JHLL 4CC0A 1CWQA 2DIBA 4M48L 3BHBB 4TQIA 4R7LA 2UZPA 1OM3H 3F7YA 1TF4A 1A9EB 1T04B 1DYZA 4HK0A 4OFVA 3U2JA 5CEZL 4PXKA 2G60L 3H3BC 1COBA 2QADD 2EIJB 1HCZA 3WBDA 1ZY9A 3JSSA 4HWEH 4R83A 2XFXA 1JVLA 3HLAB 3SN6N 3R18A 4MA7L 5FLUA 5EN2B 3MLVL 2I60L 2OLDA 5FOJA 2EIEA 2F7OA 1ZXQA 5KSBF 1KIUB 1H8NA 4MJ2A 1UC6A 4MNQD 2E75C 4M3KB 2XNAB 1NGQL 4M43H 1M0MA 5E2WL 4RFEB 3OHXB 1BOYA 4WVRA 4RDQF 2BIQA 4OBSA 2PW1A 2LTQB 5DGRA 1QM8A 5CMAA 2V17L 4UDTB 4ELMF 1RZJC 4Z0BH 4X9IA 3BSZL 3VE0B 5CILL 4PGDA 3DRTA 1A7OL 2E9GA 3T3MB 4OZIB 5A45A 4XAKD 5FYKE 2YBRA 3E9TA 3FPXA 1VGKA 5DMIH 1KB9K 3K80A 1FVCB 3FO1B 2OYKA 5IW1B 2CRMA 5TH2B 3QDHA 3CDZA 3V0VA 2VDLH 3QEHB 4W9HC 4BVNA 1PEWA 2A7BA 2FSEA 4CMMB 2HT2D 5GS2H 2QHRH 5C08B 1CICB 4MNHB 1ETZA 3PDOB 4PJ8C 2P8MA 2DJSA 4ILDA 4RAVB 1MAML 5H8DA 4HSQA 3FOMB 3L3JB 4YIQB 3QNXA 3V0WL 3KPRA 5ILTL 5F7LB 1BJ1J 1GXEA 1QSFD 2O5XH 2DKSA 1FQ9C 1LL1A 3KPQA 3MRNA 5HJDA 5HGGS 5D70L 1R1CA 3FHAA 4IBTA 5GSRA 1XV8A 2EDEA 2R2EB 1TKWB 2P47B 5EZIH 5FM8A 4RGMC 5F9JB 1JIBA 4WTWA 2J1WA 5I9QB 4X6BB 4BUHA 4RRPM 5D1XC 1GHFH 3CPLA 3TPUB 2N7BA 4WI3A 1EUTA 2KUTA 4MMYB 1H6FA 5FHAH 2RGSA 4JKVA 2E7BA 4GRLC 4HKBB 4FFYL 4PRAB 4BQ6A 4AENA 3RTQB 3PL6D 4ZUWA 5CCKH 3WFEH 1F86A 4G42A 4MLSA 3ZE2F 1TZIA 3VQLA 1EO8L 5IUCA 4WJKB 1BA9A 1BVLA 3MREA 4ZXBD 1ACCA 5CP3A 1UOWA 2NCEA 2IPUG 4WW3A 1MFDL 3OPUA 5HI3C 1RI8A 3BISA 1C9SA 2DMCA 2W9DL 2VITB 5F1NA 3II1A 4POUB 3I3BA 3EBGA 4OSUL 3DV6B 4G70B 2ZKMX 4X2UA 2DQDH 4BHUA 2XWXA 3CCHB 4LL1A 3RY4A 2WV3A 2YFOA 4J3SA 3O81A 3K2KA 1XTLA 3VG0L 4O02A 1WFJA 4QRUB 4JFXB 5L0QB 3DXAB 3HZ3A 4P23D 5D7IF 1SN5A 1OE2A 1PD0A 5CIPA 3VM5A 4F57L 2I24N 4RFOH 4XNDA 4WENB 2FQDA 3SQBB 2AXFA 5EO1A 2CBOA 3M6DA 3FFCD 1RP9A 4JFED 2X0UA 5DZAA 1X5IA 3L5HA 1UQSA 1VKXA 1ZD6A 3IDMA 4JFOA 4DAGH 4LCIH 4EUPB 2YS4A 1WICA 1P6FA 3JV5A 2BZCA 5HDBE 5FCSH 3KYMA 1G6RL 3NQIA 1XHHA 1IM3D 2X6MA 3PP3K 5HBBA 1AG6A 1B2YA 5BR2A 1UWEL 3QORA 5J56B 5ENWB 4TNVK 1FPTH 3IGLA 4QO1A 2W60A 1E67A 1FCCA 2MKWA 3R06A 3R4DA 3AT9A 2ISDA 2VB5A 2D31B 4R4ND 1MFBL 5ECGA 4IBSA 5DZLA 1TVDA 1QUNB 3AQZA 3O6FB 4ODUA 3KPOA 4MQXD 3EDFA 3JT2A 3L3HA 3NDYE 3ARDB 1DDTA 5E7FA 4N2KA 1IC0A 1PZSA 3DVNB 3S5ZA 4H8QA 1WFIA 3U4KA 1CBVH 3RZEA 3N43B 5I1HL 3NGBB 3MBXL 1NJ9A 1PZ3A 4LASL 2VLKB 2DJMA 2LQRA 1IKNC 3CFDA 2Y7NA 1JPTL 3CFEB 3Q6FB 3FT1A 4HBCH 4M7KL 1CYXA 2DDQH 4G2AA 3QJOA 4P4KB 5HGBB 4FLQA 5A6MA 5I1EL 5J12B 1DQVA 1ROWA 4YWGL 1L3NA 5GS0L 1BWWA 3G5XB 1WGOA 2UVEA 3GRWA 3QJTB 5FLVA 4GFTB 5J1AB 1LK3H 2VO5A 2VR3A 4U1MA 2YSTA 4P2QD 3AGVA 2QBWA 5F1IA 4AQ1A 2FHBA 4XR8C 5EDXA 4QTIH 5I18L 4G8IA 3VA2C 4EJ1C 1MLCB 3K5SA 2YXFA 3KPRE 5DMJB 1CFTB 4N0FB 4PYGA 4LSQH 5H37H 4UV7L 3OKYA 2NUPB 5B6VA 3L6FB 4G3YL 4P4RA 1JCVA 4JPKL 2BHUA 3K7UA 4BWWA 1D6VH 1N6VA 2RQEA 4J8QA 1L4IA 2NR6D 3HAEG 4OGAC 4UQ3B 4BZYA 4C56B 3MA7A 2HMID 4HP5A 3BMVA 5CCHE 3NOIA 4O2CB 3HZVB 5H2PA 4NUGL 2GTZA 3JV6A 4POZC 2OTUB 2ARJQ 1TQUA 3GJFH 3BMWA 5EU7E 3IPEA 3ABZA 3G5YB 3OPZH 3FQNA 5FUZH 3IS0X 4A6YA 2PTTA 3LKNB 3QEGL 4BA0A 1YNTF 4XMZA 3AWGA 5DK3A 5FHBL 3Q8EA 3UDWC 4YHIA 1MJ8H 4NRXB 3RB7A 4Y4KA 1BGXH 2P5EE 2Y4SA 1XGRA 3M1CA 3L5JA 3RWJB 3VFUA 1GUEA 4N6HA 5TE6L 2YZ8A 4UT6H 3EZ8A 4YEFA 4Z7IA 3TESA 3GBNL 3HCVA 5FYJE 5B7MA 2ATAA 4JR9H 4UUJA 1KG9A 2YLKA 5A3ID 4I7ZC 1P1VA 4UOZA 5I8CB 1LLAA 4QHUB 4OJAA 1RY7B 3V6BR 2OSWA 1FBIH 1XGUB 3O6KL 1INEL 3TASA 3BEWA 1B0GB 1E3XA 4GYCA 4KXBA 2CIKA 4AY0A 5KYUB 1D5MA 3D1MC 5BRQA 1KACB 1A1OA 3KLLA 3TEWA 4XMPL 4JFDB 3V10A 1KPVB 3V4PH 3F5WA 1MCWW 2F18A 3P4OB 4R8WL 1UXLA 4YEEA 3FH7A 5ABZA 4QXUL 1CFBA 1ZSDA 3SSGA 1HNYA 4PG9A 5DJ8A 3EOTH 2ROYA 3N42F 3UTVA 4HALA 2ZKHH 2LVEA 5ITBH 3QDGD 4LLUA 2OMZA 1HKLH 3VDCA 4LF3A 1PZUB 4GXUM 3VXPB 4O02L 4JCWA 3APDA 3QDJD 4GP8B 1ONQA 5IB5B 4YSUA 5C0BD 4ZMVA 2OAAA 5INDA 4LE8A 1HOCA 4N2LA 5KYYA 4N4YB 3CXHJ 1H2SA 2XPGA 1BRXA 3WAKA 1U6AH 2FIRT 3QQXA 5DEZA 4GT0A 5IQOA 2P52A 4N9GA 2JB5L 2FIKA 4DWHA 3MSPA 1LO5A 4RMBA 4Y4HA 1MEXH 1QSVA 5AW8B 2P48B 3P4MB 4G7QB 5DXWA 2D7QA 2R0ZL 4HU2A 3ASNB 4L9LC 1A22B 2ATPA 3SPVB 3ARYA 4PY8J 5LGHL 1JV2B 5EUOF 4LLWB 5EOTA 3BQVA 4QOKD 1NCOA 3ZTNH 3H4HA 5L8LB 1MPAH 3FTGA 4F1SA 1LHZA 1K8IA 3KH3A 4D9QE 3OG4B 1RHHB 1DJGA 4FNRA 4AQEB 2YPVH 4NO3B 1L0MA 2K45A 1BXUA 1Q0XL 1YCSA 4WWID 5JIQA 1Y1UA 5MI0B 1R3HA 4H44C 1YEJH 2D7PA 1ADQL 1TITA 1GOGA 5H2LA 5C0EA 3LZRA 1A8JH 1BQHG 5F88B 4EDWH 3FU7B 2H6UA 1HIML 3C5ZB 3JXAA 3AYMA 4QHMA 5F0MB 1YEFL 3APNA 1E8XA 3VXUB 2W38A 5E8OA 2UXTA 4NZUL 1YPZF 4X5WB 1YN7A 4CC4A 1UM6L 3TWCH 1I9RH 3PIQB 4OUUA 4OQTH 4PRIA 1FNEA 4TV3A 2C1OA 4P05A 2NQDA 1RZ8A 4WWKB 3SO3C 3TNMB 2Z92B 4YE4H 3WIFB 3ZOAA 1MI5A 4OAWA 5I1CL 1XO8A 1LVEA 3DO7B 2ATKB 1IEAA 4WEUD 4B53A 5IIEB 2YUZA 2M1KA 2I25N 3VMPA 4XP4H 3TOPA 4F15C 4I9WD 2VXVH 4HFUL 3NP3A 1YEEL 1MHEA 3WFBH 2H3XC 1K4CA 5I8EA 2UXGA 2GC4C 1JPFB 2X4TA 5GGQH 3V0GA 3UZQB 5C70A 5FUOL 1QX1A 2R23A 5IM7B 4NXKA 1NIBA 3L4ZA 1X5AA 3V9CA 1E9PB 1T1YA 5GISH 2DD8L 2WAQA 3GMLB 2IAMD 4UBDD 4APQD 5JYLA 4G1MA 4ZO9A 3EHBB 3U7AA 4UYQA 5FYLL 3UO1H 2F7IA 1TJGL 2IPTL 4K7PX 3PHQB 3QORC 4NQED 5AB0A 3VXMD 3CSPA 5B34A 3Q0HA 4XNZC 4GH7B 4KKCD 4O9HL 5A7EA 5C8JB 5E95B 1NFAA 3MJ7A 3W0WB 3O3AA 4NENA 1QLEL 4AE0A 3KPLA 2HTLC 3FU6A 2F19H 2XZCL 1H3GA 2V9TA 3HZKB 4BFGA 3TH2T 4A7GF 5KS9E 1JHTB 1U4EA 2PP7A 1IKFL 4JO4L 4NN6B 3W38A 2BDNH 3ZTDC 3OXRB 2R83A 5C09B 2VWEC 1XSJA 4EZJA 2DQFA 4NPKA 1CFSA 2FEJA 2V2TB 4GKZB 5KBLA 5I2IA 4HKXB 4LK4A 1J1XH 3BGFC 4AEIH 4AH2A 2MTPA 1A6ZA 1HFUA 4NUQA 3UGUA 5AX1A 1TYRA 5ESAB 1WVZA 1CYWA 1TQBB 3HW7A 3SYQA 1MZZA 2WHVA 3WI9A 1JNNH 2ZJSH 1KTJA 2CDGB 1F6AA 2W81C 4JFVA 4LT7A 4YSRA 2YJQA 4OJYA 2F1AA 2JXMB 1NCNA 2JWYA 2Z64C 3CC5B 1CE1H 2J25A 3AY2A 3B9DA 1A2YB 1IILE 4AQ1C 3CMOL 1RIUH 3VD3A 5DD3L 2JQZA 4WDIB 2MCAA 3NRQA 4Q6IB 1F88A 2ERJB 3DVFA 4HC1L 5DRZB 1BCIA 5T3ZL 3ZSTA 4NO0B 4P07A 1TU2B 3GWJA 3JTSB 5AZEH 3RFZB 1QLRA 1Q0EA 3ATFA 3S36L 2Q87A 2WQWA 1DLFH 5KW9L 3S5LA 2MQ0A 4AMKL 3I9GL 3L5XH 1DBKL 1O6VA 4M29A 1OF2B 3D12B 4HX1A 3OAZK 5FW7A 1BQKA 4ZW7A 2WZPD 4N5EC 3P3YA 5EUKA 3FUNA 2HN7A 4WTZG 3L95A 2SEBA 3P11L 1KYFA 1DANT 1X5FA 3NPZB 1AY1H 2NYYD 3I75A 2AQRA 4ZFOA 5A8EA 1S8LA 2VDOL 5DU7A 2FBJL 4OV5A 4JHAH 4PRHA 1QASA 3CIQA 3IMUA 5I6XC 3C09B 3ZRCC 3QJXA 3QI9B 1MWAL 1UXSA 2HRPL 5AG9A 5J1TC 4Y4KC 4BFBD 3B2UD 3T65B 3S3JA 5IHZA 3V6OA 1N0LB 3F8UB 1ZK9A 4D0CB 1UTDA 3CFCH 4OM1L 2LGNA 1RUPH 4ORGB 3VFGH 1AGDA 3MA9H 4Y9BA 4DGIL 5AVYB 1MI5E 4OIIL 4LIQE 2NY3B 1P5VB 3MXWH 2E7LA 3ILQC 4AWJC 2CDFA 1ZA3B 3P77A 4YBHA 4ANVA 4XAKE 3ZW3A 4DK5A 4WIQA 2XY2A 4ZX4A 5JO5B 1HK6A 3VO0A 5DUBB 2WLIA 1JYNA 1JI1A 3G6JA 3VXNB 5E4EB 1XCXA 2D3VA 4X6EB 4Y9CA 2Q86B 1N9PA 2ZUWA 4XXCA 2BNUB 4PUBH 3WAJA 1X5XA 5LXGH 1W0VA 3ZE0E 1T6BX 1MG3C 5EU3B 1CGXA 5C07E 1ZS8A 1QSFE 4MAYD 1X4XA 4JPWL 3DV4A 4QRTA 1IFGA 1EJOH 2X70B 4IOSD 3FN9A 3F7PC 2BWIA 5IK3A 5EA0H 4LB8A 3IMWA 2J8UB 3H9SB 3CHOA 1BRDA 2HLAA 5H94A 1V7NH 5CKGA 5DA4A 4HJ0D 5JW5A 5IB2A 4KH2A 1N0XH 4R7NB 2W0KA 5DO8A 3PWPA 4A68A 3LQAL 1DSFL 5EU6D 1OD9A 1AHWC 1JD7A 4KUCD 3UG5A 2YMTA 1AKJA 3MRMB 4N1HB 2DLGA 3QFJA 4M5YL 3PGCB 5D2NA 1MHHA 5FC9A 2F54B 2AXJA 1OAZH 1BQRA 4MZ3A 1U2HA 1SFDA 1EZUA 4JZJB 5HY9A 1BQHB 4RLDA 1QFWM 3K0YA 2YDOA 1R0AL 2HPYA 2NY7H 5F7YC 1UYWL 1SOSA 4JB9H 1IAOA 1LO0H 1C16B 3ZYOA 5CBEB 2IALB 4KNUA 4MSWB 1FH5H 1ZDQA 5J6GA 2H0FA 3ZVVA 3O4OC 2W8CA 2APTA 2Y7LA 4H1LA 5HI4C 5JW3H 4L4VE 4R7DB 4M7LL 2OMBA 2Q7NA 1I7TA 4DP1X 1CO1A 3NCMA 3NH7H 4WO4B 5SX5K 2VDRB 1WZ1H 2QL1A 2JAGA 1OVZA 4PW9A 2Z73A 1G5AA 3GI8H 1IGMH 4M9OA 2HPTA 2DJUA 1CLOL 4PJEE 4EN3A 2N1TE 4WCYH 3P2TA 5G2DA 3V7AE 2O6PA 2GK0A 3FFCE 2EAEA 2VDPL 3HPJA 4GW1B 1AD9B 1IGCL 4CC4C 2EJ1A 2Y9RT 3IDGB 3GTTA 4P99A 4FJ6A 2WBJD 5CLXA 3RJDA 4BWBA 4K71B 5I5IA 4K5NA 4NSKB 1TNNA 2UV3A 4IRSA 3PWLA 4Z7QB 2OX5A 4P9HH 1A6PA 3L7FA 4MJIA 3AREB 4F7CB 1UH4A 4RESB 5IVZA 2F08A 1TENA 4JRLA 1WUZA 1NGZB 3CE1A 3PWVB 5LB1A 5LQBH 5SWZB 4XPFL 2DMGA 2MIZA 1K5NA 1MUJB 1MELA 5I66B 2CGRH 5JR1L 5LDSA 1M6OB 4PGZA 4PWJA 2F53E 4LU5L 4ERSH 4HDIB 1U8OB 2HVBA 4M3HA 3KYOB 1LQSR 3B5HA 4ZW3A 2W0PA 4IBQA 1G9HA 3GSOB 3IDJB 3TT1H 3US9A 3V6OE 3ZL2A 1WAEA 2X6UA 2XYBA 2G87A 2AMUA 1CQKA 2OMXB 1B0RB 2AK4A 3HI5H 3WL9B 3ZQXA 3JWOC 3EO1B 4TKWA 4B9FA 1X7SA 3GRGA 1GC1H 4OCSH 2Z31B 4KI5D 1R5VB 4PJGB 3QG7L 2BZ7A 1DDHA 5EBLA 2MCPH 3S37X 3RWCA 4HIXL 2PETA 5DJXB 3EJYD 3BH9B 4G6ML 1QW9A 4P2RA 3TBBA 2IPKA 4PP2B 2CK0L 2IAAC 5EOCJ 4TSCH 5EOQL 4DGYL 2Y5QA 4ZTPL 2X88A 3OD3A 1ZLSL 3NZUA 3QCUL 5ACLA 3I50L 2R4RA 5HDBF 3V9FA 2GC7C 4AUJA 3MRBA 2QT6A 3N1PC 4Y4FA 4XTOA 2DTMH 1I7RA 2NY4D 3KPPB 5CBAB 4UYPA 4ZMOA 1NCDH 3HAQA 5TE4L 4L3ED 5GJSL 3OMIB 5I6KA 3AZUA 5DI8A 5J6SA 4IKKA 2V37A 4HJIA 5IG7B 2VR8A 4XE5B 2YK1H 1UFUA 4KC3B 1KXTB 4WJ5A 1KELL 1S9XB 2XWEA 3L3DA 5JORB 1G9MC 4HUVA 1IGFH 1URZA 3VI3A 3LNEA 4JVPA 1I1AA 4PRNB 4YS4A 3LS5H 3WTWA 2CE6A 3C6SB 2IIJA 1WAAA 2H1XA 2XQBL 3MUGA 3QA3B 4IDJL 4KK8D 5F96H 3DIFA 5DJDA 2Y7MA 5GRYA 3VXOB 4XCCL 2QSTA 4I0PB 2RB8A 1N5AA 1U58A 1NBZB 1OK0A 5GS3A 3SYPA 1D7CA 4FTVA 1R5WB 4Z9KB 3Q2CA 1ACYH 2BK8A 2NW3A 4A2MA 4X7TB 5JXAH 1ZVHA 4E9VA 4D8OA 1XXDC 3TF4A 5JXEC 4I48B 4KROD 5IVNA 1AHKA 3VG9A 3MBEB 3GXNA 3MBVA 3KPMA 5BQ7B 3BN9D 3UZAA 2WKLA 5FECB 2NY6B 1A14H 3ILPB 2F5AH 1ZWIA 4G7VH 1JOIA 5D2LB 4H0GA 2WNWA 2YPLA 4O2FA 1R75A 4GBXB 5DSCA 3LNGA 2E8ZA 3FTUA 4EEEA 2FT8A 1QNZH 3OSKA 4KPHH 5AVQB 1FV1A 1AI1H 4D0BA 1O6SB 4G6AD 1QWHA 1FSKB 3OJDA 2EE9A 5J13C 3S9DB 1AZCA 4BH8A 1N4XL 4HA1A 4YNYB 1L5GB 2N7AA 1SM3L 3V6OC 5EEZA 2QSCL 2CO4A 5KYXA 2CR3A 4U1NA 4AV0A 1QEXA 1KC5L 1PMYA 1X5KA 4OLUL 5HDQH 3QDGE 1Y1DA 2EYTA 3MUZ1 2Z4TA 1EPFA 2YAEA 4QXVA 4PJ8B 2E7LC 1EMTL 2AJVL 2GSIA 1M53A 3GXMA 3WO4C 1Z2KA 2FYVA 5CJQL 2HT3C 4I13B 4PRPB 4O5LH 5C6TH 1WCBA 3BPOB 1Z66A 1TJIL 2XJKA 3PNWB 4R5XA 3FF7A 4YXKH 3OAUL 3NSJA 1NMCC 3A47A 4BKLB 1PKQA 3F83A 3N5AA 3TL5A 2XG5A 5F3FA 4DKFH 3NSFA 2UZXA 3Q6GH 5C0CD 3OKDB 5KYWB 3U2IA 4AEHH 1FZKA 3H4FA 4XXCC 4UOW1 4DH2A 4X4ZA 4XN5A 4JO2H 1OTSD 3BCFA 1TTRA 1XMEB 2HKAA 3BO8B 1MJJB 1UJ3A 2YR3A 4IKNA 5AVRB 5C0IB 3STLA 3VU1A 2QV2A 2F1EA 1T3FA 4KGJA 4BWUA 4J4PA 2R59A 5BV7L 5IOPA 3WE6B 2W65B 4JKPL 1BMZA 3QJHA 5AL8A 5AW4B 1QA9A 3OLIA 5JIHA 1XQ4A 3REWA 3G08A 3PWJA 3C5JA 3N85H 3BZDA 5FGCB 2C7UB 2X9YA 4OUOA 1XB6A 5AOLA 5D2NC 3LPWA 4HUWA 4FQXD 1IM9D 1PLGH 3QC5X 4MWFB 5B6YA 3EFOA 2OJ1A 3OHMB 4KKAC 4YDVA 3A4FA 3WHE1 2WQ8A 5A44A 1NM9A 2UZYB 1IEBA 1ZAGA 3QZWG 2ETWA 8PAZA 2YMOA 1E65A 4X31A 5K9KB 1Z9NA 3RYMA 4XRCB 4M5ZH 3STZA 1DQMH 1XXFC 4X6FB 4QTFA 4Y19B 3ZDXB 5I15L 2BRDA 4RMTA 1A6AA 2GJ6B 1AGFA 4P3CL 4Y5VB 3FN3A 5CZXC 5DJYB 1FYTD 2XVBA 2F0CA 4AG4L 5JHBA 1BVKA 3PAVA 3WXVL 2H3KA 3NCFB 3OWRA 2B1HL 4S1DC 3K8LA 5HVHC 3CVHL 4I9WE 2AKRA 2WBXA 2VSDA 2EDWA 3P73B 2R29A 1H0DB 3RDTA 3O4LD 3K6SB 3MV01 5A2FA 3SODB 1AG0A 1UWGH 4JANA 3LKPB 4JQIL 5K5YA 3QUXD 3DK0A 2AQSA 1HWHB 4Y2DA 4P2CG 2VDRH 4WW2B 1SY6H 5KSUA 1QATA 4PJ9C 1RK0A 2E27L 2D9QB 2XVGA 2VR7A 2YPLE 4LVHC 1TZHA 4XPGL 1WTGT 1J9TA 4HJUA 4B41A 3ARFD 1F02I 2Y02A 2OSLB 3VXME 3V79C 1MIMH 5BZDB 4K7PH 2C34A 5TGZA 4LOEA 1S7XB 1CZ8H 1VAHA 3FB7A 3KGUA 4NXSA 2XZQH 4ONFL 3QFDB 4ZS6D 5KSAD 4RAUA 1ZHLB 4DKDC 1WC7A 3D2UD 4GSRA 3D8MA 1RERA 4FI7A 1B4JH 4Z7UA 3NN8B 5KZCB 3NPSB 4A37A 3H42L 4OGXL 4JFZL 1Q9LB 3DOHA 4BKSC 1MREL 4NKIL 4LLDA 1TZGL 2AI0H 3LH2L 2V7NB 1SFHA 3X13A 2GEEA 2MRYA 1FFOB 5HXMA 1Q9OA 4IB4A 4TUJA 2H4EA 5H2HA 4F8NA 2O4EA 4KMQA 5KBKA 3L3IA 1N64H 1Z9MA 2RCSL 4PCSA 4D3CH 2J2ZA 2IBGA 2EDFA 4RISH 4TXVB 4HIHB 1HE7A 3G04B 4GQQA 2ZX8A 5F9AC 4P5TC 4Y4FC 3MLZH 4K94C 3WLBA 2ED6A 3GGWB 1IGJA 1KBGL 1SZNA 1SBBA 4UDUB 5BZXA 2V6HA 5E23A 1ZDSA 4KJPD 4NFBA 1ND0B 2YQ3A 2Y6SD 1NCAH 3UROR 1G6RB 2I1XA 1ZTXL 1X5LA 2EDQA 4PLOB 4TNVF 1NUNB 2L3BA 5DJ2A 1TZOA 3TO4B 5LDUA 1YNLL 2FB4H 4MDJB 3TYGL 4GJTB 2XBZA 2IWFA 2AAAA 1NGYB 3FHEA 1RKRA 1NMBL 4YDIL 3CIAA 3W9DB 1I1AC 5KS9F 2X2UA 4F2MA 1J11A 5K9JH 2ZWSA 5IW6A 3F7YB 2H2PC 3FXIC 4ZFGL 4HK0B 3IAGC 3WY4A 2I69A 1ZGLP 2VLLA 3WIHA 3VGAA 1RURL 3KPSD 4NQVA 1NCIA 2VN6A 4JHBA 4U6HB 1J48A 1DL7L 4TSBL 4CADA 3C9LA 1P6AB 2GUOA 1EFXD 3HE7A 1NFDB 4S1QH 4BSVA 1G7QA 4F3FA 4IRJC 9CGTA 2XFXB 1AXTL 1J8HD 1SOXA 5T1LD 2WXQA 4BM7A 2HFEA 3G5VA 4YHKH 5A2LH 1T03H 3O6ML 3DMMD 1NUFA 3IGAA 4IAQA 3NA9L 1VGEH 5DQDH 4K3EL 3DSFH 1UD6A 4PSRA 5D4HA 2VLJD 4JRXB 3W11C 4TOYH 4XBGA 2Z3FA 2AQ1A 4HU8A 1HCYA 2VZOA 2OYPA 3QO0B 4MKTA 3QIBA 3DBXA 2YN5A 5H2JA 4OFIA 3ZO9A 1MQKL 2CPUA 1W72L 5FFLA 5JMRA 1KJMB 5TQ2L 3EW3B 3U4BL 3VXUD 5CD5C 4AUUA 1TCRA 2EYRA 3VFSA 43C9A 3SDXA 3EH2A 4LPCA 1OCWH 2JKTM 4LOUD 4WK2B 2YRLA 3CDZB 1AE6H 5BZWB 1HEZB 2AEQL 4WWKD 1BQLH 1RZJH 3JWDL 4I4WA 1ULVA 2DYPA 1DQJA 1ETZB 4YDJA 3ZHNA 3MZTA 3D30A 2D7NA 1OQOA 3LNIA 4HXAH 4M6ML 4L8SA 3NUKA 3DDLA 1CFVH 4EKXA 3N55A 1XWVA 1MCHA 2ICWI 4QF1A 3OB0K 1AYOA 3HOGA 5G55A 1YQVH 4Z7UE 2H1LM 4P46D 2BMKA 2J1XA 2PCPA 5G54A 1T1ZA 2XC8A 3FYIB 2KC0A 1OB1A 5GSRB 2PO6D 4U3XA 1XMWA 1EO7A 3BIAX 4ZQKA 3VWKC 3RY5A 3IAPA 3ZT6A 4EBQL 2EEFA 3ZQWA 4BK4A 2DWEB 3VTMA 2NTUA 1U3ZA 2NY0C 1X9LA 3Q5TA 3UTPE 1UGKA 5E03A 1WS8A 2G9KA 4Q2ZB 4AYMC 1UJ3C 2R0KH 4X6CE 3QZWB 2HVJA 3U83A 5BZZA 1PQZB 4M48H 4J4PC 4BGDA 1TQCC 5D1ZI 1JCKA 3K6FA 4M6OH 2XN9A 1F56A 3TIEA 4CDGC 3D18B 3REVB 5ICZB 4E41D 5CEZH 4PJAE 4HCFA 2EICA 2Q2EB 1YN6A 1AGCB 25C8H 3MBWA 2G60H 5CAYB 5JOPE 3RRQA 5DA0B 4ODWA 3ZE0F 2HX8A 1K3IA 2HWZL 4XMUA 2QDVA 4L35A 2BCKA 4PJ7B 3AM6A 1BV8A 2B77A 3V6FA 1FDLH 5B35A 1CDHA 1CUOA 1KJ2A 1OEZW 4PLKD 4MA7H 5IB4A 4Q89A 2BZDA 4X9BA 2I60H 3B5GA 4X7DC 4O02B 2OM5A 5GGUA 4ATWA 3QPQC 1NGQH 4JREB 5J6HB 4DAJA 2AXFB 2A2QT 1E9OA 5EO1B 3ISRA 3QW9A 1A7QH 3DTXB 4HT1H 1UQSB 3S98A 4JFOB 1LE9B 3BSZH 4UU9A 5CILH 5IMMB 3DGCR 3L2LA 3LY6A 3MFFA 3QJZA 2OR8A 3S34H 4DO5A 2KHAA 3NYAA 1A7OH 2P43B 2B39A 2OXHB 3RDTC 2VRAA 2WTPA 2XKSA 5JIIA 4JFHD 4Y1AD 4WI0A 2G2RB 3UTQA 1M7UA 3RAJL 4BSJA 4JFQA 1XAUA 4BEYA 3IFOA 3K4ZA 2ZUQC 4P8QA 4NAJA 5E6IC 2L04A 4Q9CA 1FH2A 1RD6A 2EIMB 4BZ1A 1QFHA 2I9TA 1QRND 2AGJL 4ODUB 1WDAA 3SZ6A 1UASA 5TF1L 5JMOC 5KVGL 4XXDA 1MAMH 5C2BH 3FB8B 1NEPA 5E9NA 1LWHA 1KG0A 4JRWA 4TLTA 3LKRA 1A7NL 1OP3H 4PJEF 4BFNA 3S37H 4LPYA 1Z32X 2ZXBA 3K0WA 1KTBA 4MJ5B 3AGWA 4OD3L 3DNKA 1GAFL 3MX0A 3BUYA 4G43A 3V4UL 4E9QA 1PX4A 3QI9D 5H35A 2C4FT 3IAQA 2ARJA 2K6WA 3ARBD 4IU3B 5HYEA 3HG1A 1NEZG 3SDXE 3ARQA 3GF8A 4PJCE 1U41A 4JQXA 5BRZB 1V05A 1NGXA 5FX3A 2BFVH 4WNQB 1ACXA 1T1XA 2GCYB 3RNKB 4UQ9A 1EO8H 4L23A 5F1IB 5LBSA 3C2AL 1WPCA 1UOLA 1FNSH 2OMNA 1TN0A 4NJAL 4YHOL 5L2KD 1MFDH 3AU0A 1KGUA 3QISA 5D1ZA 3U0WL 5AD0B 2W9DH 4ZAKD 3QIWD 3VD9A 3UTTB 4DN3L 4P4RB 4OSUH 5ISZD 3T6WA 1SMAA 1CTMA 4X4XB 1J5OL 4PJIB 3MA7B 5IHBA 4U3SB 4YR6A 4NQDE 1N3NA 1KTDA 4DP4X 2P80D 5B6XA 2X4UB 3JV6B 5DF0A 1SHXA 4ZBJA 4YLQT 3S35L 3FQNB 5BS0B 3QNZB 5E4OA 1IQWL 4HUXA 2PTTB 3MOBL 4DJHA 5ERWB 3GINA 5D4JA 4PIBA 5CZVL 2H1PL 3MNZB 5DJCB 1AQ8A 5ETZA 3U6XS 5FO7A 4U6YB 1QLEB 4DERA 3AS0A 3LTVA 1G6RH 3F64A 1P7QD 2NY2C 2HLFD 3DX2A 4JDZB 1R3IL 2A5UA 1PCXA 1L6XA 5EZJB 1PG7L 3MJ9L 3U0PA 3HCVB 4NQTA 4IOIA 2RACA 3II3A 5TFSH 1RZIA 3B2PA 2DQGL 3AS2A 3HI1B 3GT6A 4RGND 2X4OA 3VGAC 3FOLA 3FAWA 1QD0A 4ES9A 3CHRA 2X28A 4GS7B 4PCKA 3O3BA 5HP5A 3W37A 4GIPD 3HE7C 3TP4A 5C0JA 1U42A 1PXSA 2X10A 3EBIA 5ELIA 3FT3A 3WEXA 3BEWB 3U1PA 4B9GA 1SJEA 2GFBA 1YMHA 4YAQB 1W8OA 4F9PA 1X7QA 1QFPA 1MRFL 3VFOA 3TEXA 4UILL 1CDGA 2J43A 1XVSA 4LASH 2IDCA 4W68A 3CN0A 2NSQA 3MRRA 1PF3A 2F5BH 3OKOA 2FJGA 4M7KH 4WO4D 1HH9B 4MAUL 5DJ8B 2CMRL 3C8DA 3N40P 2B0SL 4PYHA 4LLUB 4YWGH 3QIBC 5GS0H 2F58H 1JERA 1V7ML 1NBVL 4LF3B 2XX0A 1FIEA 3N50A 1ONQB 1LWRA 5E9DB 3T08A 5DD5L 2A9BA 1HOCB 1MXDA 1WIUA 1HT6A 4J3WA 3EXJA 2HFFA 1DJSA 3MGTB 1VACA 1S2EA 4YOKA 1J5HA 3GXUB 1OM9A 4BKTC 4JCMA 1C5CL 3BQUD 2V5MA 5DEFA 4S1SL 1DJYA 1VB9A 4LSPL 1GW0A 2DLHA 4UV7H 2DI9A 2VDOB 4N24A 4Y4HB 4G3YH 2AC0A 4JPKH 1AYRA 1U8QA 4L8SC 4Z0XA 2QQLL 1MWAB 2BOBB 1F8TL 1LEKA 5CLYA 3V5DA 2VL5A 3ZT7A 1S7RB 3HUJA 5KVDE 2NY1B 3DURA 4NUGH 4RMWA 2UY7A 3I6LD 1IIIA 4E9WA 4ZDHA 3FCTB 3QO1A 5BJTB 4OF0A 3PY9A 4HLJA 3QEGH 1WZAA 1AR1D 1L7TL 5FHBH 1OSZB 3QXUA 2OS7A 1KGCE 2JKNA 1QYGL 1R3HB 4HIJB 3ZPQA 2VSKB 4FS0A 4Z3IA 1FVDA 3BP5B 4N8UA 1G9NL 5GGVY 4HLZH 4ZTOL 2HX9A 4QHMB 5TE6H 1ZT4B 4PLJD 3PQYD 1P6WA 4EQ3A 4JAMA 3SDCB 1P1ZA 3GBNH 5LJYH 4JQ6A 4PCTA 3TBWA 1FJ1B 4KKLD 4U0RB 5SWSB 1WD9A 2FBOJ 3WIIL 4DZBA 3T5WA 1ILUA 4OUUB 4PS3A 2Z93A 4MRBA 1KCUH 3KW7A 1FNEB 4NKMA 1TNMA 5F9WB 3CAPA 3PRZA 3O6KH 5D7JB 4FQLL 3FT4B 2AXGB 4N6RA 3O4LE 3CN2A 3Q06A 2PCFA 4KZEH 1IO4C 3N6YA 4LCWE 3NEXA 5CP3H 3ZZ1A 1I1YA 1KCWA 1U93A 4OLZL 4ZMZA 3GUTA 1LGVA 2GEQA 3D4YA 4R8WH 2ALAA 5CU9A 4QXUH 4FFZL 4Z8FL 3AB0C 3QXVA 4KTGA 5DHHA 3AQYA 4HV8B 4U1GB 4ZUVA 2HJLB 4DUWA 1S78C 2R23B 3UX9B 4DP2X 4HJSA 4O02H 1T1YB 4MDRA 4I3RL 2P5PA 2X1OA 2Q3AA 4MCZB 4I0PD 5CIPH 2OFQA 4RDQG 2Y3AA 3RBSA 5I0XA 4P04A 3EJUA 4XZUA 1GJUA 3E8UH 3GMNA 2VXQL 1WHPA 2XWJB 3D3VD 3C60A 1M0KA 1T0NB 3QNFA 2ZUUA 3MJ7B 3LVEA 3RX9A 2PP8A 3O3AB 1NEZB 4B3VA 3BVXA 4MNGA 1EK3A 4PWGA 4KNTA 3FUHA 3PPSA 4KZCA 5DMKA 1BD2B 2R4SA 5L88L 5IZ7A 1UZ8A 1MGYA 3OAXA 4GAAA 3IWUA 2A6IB 4AYFA 1DBJL 5LGHH 4ZYKA 2HXAA 4DGVL 3DYOA 3LEXA 4JZNB 5CEYB 1XR9A 2X12A 4Z5RA 4BXSV 2AEWA 2OW7A 4BRJA 3KLHD 4K8RD 5AOIA 1Q0XH 2VDPB 3LXUX 3ML9A 1MHPL 3PAYA 3SDDA 3WKYA 5DHDA 1AIZA 3KLAA 4XBMA 1LQBC 4E36A 3BT2L 2QGBA 4JQXC 2FEEI 1BF2A 3OZKA 3B9KD 1HU8A 2X1XR 1YEFH 5AX0A 3PP4H 1RIVL 1NL0L 2G5BB 3OSVA 4G8GB 1SF5A 4ETQA 2OMYA 3EJSA 4J8RA 1KDIA 1Z5LA 2JNZA 5D1ZC 2D4FA 2AMGA 2ZAHA 4HOWA 4YK4C 5GGSA 4GMSL 4HYTB 3FB5A 2HUHA 3QJUB 3S5LB 4A55A 4JPVH 1IT9L 3RIKA 3NVQA 3Q43A 2K6YA 1QUPA 3SKNA 1RP8A 1JTTA 5T5NG 2BS8A 1YEEH 2V8LA 3KXFD 2R56L 5ICYB 4TQHA 1X5YA 1YC7A 2FAUA 3F7KA 3I75B 4WI5A 2IQAA 3ZYJA 5AB2A 3QAKA 3AG1B 4ALAC 4EJ4A 4PB0L 1SXNA 4CU7A 4F92B 1FNLA 2NW2A 2WLNA 2APSA 4K9EL 5I75C 1ZJAA 4I3SL 4NZRH 4DUVA 2DD8H 3RX8A 2A1WL 5C0FB 4LVNC 2D8KA 1QSED 4UTCA 4ZOCA 3SB3A 1TQWA 1MHCB 1XB8A 4NUMA 1QEWA 2ICEC 3QUYA 1H19A 4O9HH 4MA1C 3I6GA 4Q9BA 2WQXA 3BDYH 2YIHA 1BJMA 2FJFB 1QLEH 3MYZA 2XWBB 3P77B 1XEUA 5ID0A 1WTLA 5D7SH 1C7TA 2Q76A 5A2JH 4YFLI 5EDSA 5LGKA 5C0AD 1MDTA 1MW2A 3CFMA 3L1OH 4F9PC 5G2CA 2ZNWA 4QXTA 5E08L 1N26A 1NDTA 1OGSA 2WLIB 4JE0A 3TA3A 3C9NA 3WUZA 2QQNL 1B4LA 4JLRA 1OCOB 1ORSA 5B8CA 2XA8L 3MLWH 1EH9A 3MUUA 3FS9A 5EF0A 3RWDB 5F89A 3HG5A 3U7WH 5CGYC 4YGVB 4IKLA 2YGPA 1EGJA 2KMWA 3HN5A 2K4WA 1CF1A 2MNJB 1TO5A 3TH4T 5JW5B 1HSAB 4L1BA 3TU6A 3ES6A 3PWPB 3RX5A 5I8KH 5CLTA 1DVFB 2J4WH 3CMOH 4LGRB 5DD3H 1MLBB 2R2BA 2XKNA 3QFJB 1YYML 5EO9B 3WKQA 3ZLQC 4ENZA 1R9FA 2HKFL 4JDTL 4LARH 3T0EA 3QCVL 1D2PA 5AWNL 3GLDA 1LEIB 5EO0A 4LVEA 1HHGB 4FRWA 3ZUCA 1JI2A 2GBUA 1M7DA 2XVKA 3S36H 5KW9H 3ARPA 3L2MA 5KANG 1AS7A 4P2OA 4AMKH 3I9GH 4E41E 4G6FB 5IB1B 5IEKB 3OR7B 5IVOA 4UTAA 2JKRM 1VCAA 5GJTL 1SDDA 4A7QA 1S3RA 4NC1E 4GRMA 1NCCL 1C5DA 4NDMA 2JI3A 3RA7L 3POCA 3P11H 4XX1E 3RNQB 2ALWA 2LT9A 3VXSA 2VDOH 1OZTG 4EAEA 4NM4L 2H0EA 3VFRB 2IAND 4XTRD 2WINA 4JKWA 3WFCL 5I73B 4NT6A 4FA8A 1MWAH 2HRPH 3DHPA 3QIUA 1XGPB 3MV9B 5DVKA 1UURA 1THCA 2OZNA 4OD2B 2XTJB 2IH9A 4X5LA 1E4KA 4H25B 4XODA 4JGJA 4EN3B 2BSTB 1UHVA 5EF3A 5GGRA 2JK5A 1IFHL 4QRPA 2HJKA 1DUYA 3DTDA 4Z7UF 1WA2X 3UGXA 3AAZB 4KO9A 1RXLA 3D85A 1YJDL 4GY4A 4DGIH 3F6JA 4DHLA 4OIIH 4J3OC 4JN1L 2PYEA 2C3XA 1GZMA 2J72A 4G9FA 4IRSB 2MOQA 3PWLB 4R0LB 4X6CF 4JN2B 4J39A 3L7FB 4MJIB 1BQSA 5E5UB 4IBUA 2B5IC 5IVZB 5D8JH 2WQUA 4G1EA 1BXXA 2JE8A 4ZUTA 4OCNC 2DOCA 3G5ZB 1IAII 4PJAF 1OGAB 1F4HA 4JFYB 1JUFA 4RQQB 4P0DA 2IJ0C 2VRKA 5EZOL 3DX7A 3A6OA 1LXMA 4PJXB 1G1KA 3X12A 4QKXB 4FDWA 4JL1A 3O9WA 1HH6A 1N2RA 4JPWH 3P30L 1JK8A 3QDMB 5C3TA 2AK4B 3CN1A 5BO1L 4FQQA 3V6ZB 3CXHK 2M2DA 3QCTH 4MA3B 4G82A 1P7KA 3T0WA 3KMDA 5EWIL 3LQAH 2KL6A 1J1OH 2VZ3A 4P2RB 3C60C 4M5YH 3UYRL 3NJNA 1JRHI 1LWJA 5HYJD 1VEOA 3A24A 3LN5A 3NIFE 4UQ2A 4RWYL 5GS1B 1YEHL 1JDAA 1JWMA 4PV8A 3MV11 3CXDH 3VM7A 4AGQA 4J1UA 4P59L 1HC1A 3MRBB 3L3KB 5IREA 1GR7A 1I7RB 4JG0L 4TVPH 1R0AH 1AQMA 4DGUA 2EECA 2P3YA 5HVGB 3CVHB 5DI8B 4DO4A 1FORL 7TAAA 1JV6A 5E00A 4WU5B 1LD9B 3GLAA 4RWHA 3WFHA 4KMLB 4W9CC 5F6IB 2CNZA 1N8OE 3FUFA 3IPFA 4FI8A 3JWNE 1NBYA 3MOQA 4M7LH 5HSFA 4NC1C 4GPVA 5J06A 3SDDC 3PWHA 2OJEB 4HUVB 3VI3B 4ONHA 1NWPA 3VUAA 1XDTT 4WEEA 1RULH 4EE2A 1OAJA 3MUGB 3EBHA 1P2CB 4HUNB 4OH2A 2FR4A 2GK2A 1IJNA 2AEPH 1ZSHA 4WI2A 5CHNA 1OOWA 3GIVA 5I17A 2OXGB 1ECZA 5H2BA 2HVKA 2VDPH 4MCMA 1ETA1 1KN4L 5DFAA 1G9MH 3ZE1B 4CAGA 5JHDB 2NW3B 3QB7C 3D39B 4KTEL 5D7IB 2PXYD 3EYSH 4NM8L 5HHNA 2XPZA 4XMLL 3T2OA 3SDXF 1WO2A 4RRPG 3VG9B 3COCA 4PJCF 5JJEA 3DPBB 4WGVB 2O72A 3VJ6A 4EIGB 5JA9A 2DLFL 1ZCRA 4QAWA 2WJKA 4Y7OC 3Q44A 4PRBB 2YRZA 3PL6A 2WJ7A 2GIMA 1JGJA 2GIXA 4GAYA 5I71B 1O7VA 4WFED 4WKZB 1M57B 4L29B 4X8JB 4A2HA 2JCCA 4FULA 2BWQA 4C83A 3HRZA 4LU5H 1JNJA 1FHGA 4ZMQA 3EGXB 5M7QA 1JWUA 1EZVY 3FQRB 4XB7A 3IPBA 5GRVL 3DGGA 4LRNH 3DI3B 4QRPE 4L0YA 5BXFB 2VUOA 3TJEL 4J2QA 5KJ7E 3B3IA 2Z8RA 5AW2B 3WFDL 1YMMB 1PFOA 3QFGA 4JVUA 1WP6A 1UOVA 4H0LC 1FGNL 5KYXB 2VAJA 4X80L 3EF4A 3GO1L 4HIXH 1VFOA 4OZHA 3APFA 2EEBA 1PZDA 1SPDA 4G6MH 4X98B 3P9WB 4LLQB 3WNLA 2EYTB 3P9LA 1VA9A 2CK0H 4IRZA 4DKEL 4ABWA 4ZTPH 4JFEA 1ZPUA 4X9HA 1ZLSH 3QCUH 3RUGB 1NFIB 4BCYA 1BIHA 3I50H 2QR0A 1H8SA 5CO1A 2HAZA 1X9QA 3PGDA 5T1DL 4NN7C 2DYRB 1DBBH 1E8WA 1LP9A 1IM3A 3CZFA 2WWKT 4HJGA 4XTNA 3KNBA 4XHQA 1PKQB 1WA1X 4EDXB 2BSRA 2E7DA 1LM8V 4R7VA 4R26H 3K2UL 3KR3L 2Y7QB 1MIEL 1QHOA 4RGOL 4QCIB 1XL4A 1VCBC 2XA3A 2NX5E 2FEDD 3MCKA 2AJZB 5DVNA 3MJ8B 4B9JA 1KELH 4PB9H 1GCFA 2VN7A 2F7QA 3NFSL 5IHUL 4ELKA 5ACMA 1NZRA 3QR0A 2EVFA 1T3FB 3L3OB 2XQBH 2WGNB 4IDJH 4BFRA 4ODSL 2V7HA 5F3HA 5TGBB 2YEZA 5D7LD 3VX1A 1QA9B 3DWTA 3GSQB 3REWB 1SLVA 2VN5A 5FAAA 1RZGA 2BO0A 4UNUA 3ISYA 1U8MB 1OK8A 4QHKJ 2RALA 3T0EC 3LSOB 3VNZA 3O6LL 1B2WH 3N41B 4MD0A 3RL2A 4HZ1A 3LKQA 1L0PA 1OSEA 5DYSA 2FWOA 3BEVA 1RUQL 3HLKA 4L8BB 2GI0A 3SJVB 3X14B 3FH8A 4P2OC 2HJFA 3WE1A 1IEBB 3LRHA 4WW1A 1W72B 2C3GA 1AO7D 1IB5A 1EJ8A 4HPOL 2NNAB 2DQIH 2XQ0A 5ADPH 3LIZA 3HBGA 2OULB 3IJHB 3GSNA 4CDHA 2O6DA 4FMKA 1HHIB 1R5IA 4PJHA 4BA8A 1ZHBA 3D0VA 3I9PA 3FRUB 1DO5A 2R9HC 1BVKB 1EANA 1T1WB 1EXGA 4K2UH 5GGTA 3QIUC 4RA0C 5LVEA 4WGWB 4HCRA 4DNLA 1GRWA 3HB3B 2DQEL 1SEBA 1N8ZA 1E4KC 1JGLL 4H13C 1SM3H 2QSCH 4XC3L 2NY5C 1I8IB 4LNVA 1WFNA 1HJCA 3B1TA 4H1LH 1JN6B 4YHLH 4LHJB 1KC5H 3EFDH 4OLUH 5CJBA 2NLJA 2A9AA 2XWZA 4APXB 1CMOA 4Y2DB 2A0LC 1MVUA 3EJPA 3UTTD 3S3BB 3GB7B 5MEND 5I5MA 1UB6A 4QDGA 1EMTH 4KKBC 5FW8A 2D9CA 2E7MA 2ZP0T 2FH6A 4NQXA 1MW1A 1TZHB 2X4PB 5B6ZA 1TJIH 2FTAA 5CUSL 3N42B 4U2YA 4KTDL 3G6AA 4A7VA 3OAUH 3D3VE 3OKKB 1M1XA 1EQWA 5KVEE 5A2BA 3J7HA 3TBYB 3DYMA 4PR5A 3BP7A 1YEDB 5IVXE 5DJAA 5TDOB 3UJTL 3O9WC 1F3DJ 3O2DL 4RH4A 1FYHB 1BFVL 3GBML 3HKFA 5LXVA 3S0PA 3KCWA 3MRLA 2GTQA 4JKPH 3TFBA 3CSFA 2YSSA 2CDEA 5T3XD 5I1DA 1KY6A 1HHKA 3FL7A 4MJ6A 1Q9OB 2HG5A 2ZKWA 3HE6B 4TUJB 1IAIL 1X5MA 4I2XA 1LNUB 2VC2L 1TSHA 2JIXB 2QVMA 4AI7A 4CSSA 1SBSH 1GTNA 4A4MA 4CN1A 2A73B 1MNUL 1PCSA 7FABL 1JPSH 3QDJA 4XP9H 4ODTL 3WMQA 3H85A 5C0BA 2DM7A 3SOBL 2G4EA 5ACZB 1P9MA 1K3ZA 4JG9A 4UM9B 3TS8A 4N87A 1WWAX 5HJ3B 3UC0L 3H9YA 3ULVD 4LLYA 4Q9RL 4X4KA 4GQZA 1JYVA 5I15H 4JPIA 4YO0A 3EOAA 5T3ZD 4E0RB 4P3CH 2HT2C 3BZ4A 1YY9D 3KZ8A 4KRNA 2BHZA 1EHNA 4MMZA 1R3JB 3SKOB 3UBXG 2B1HH 4ZNEA 5JQHC 3CVHH 5L4JA 4RX4A 4F2MB 2D0GA 3KXFE 3LDBC 4XOCA 1SHWA 4B50A 3BAXA 3GSVA 3QPXL 4Q58C 4E5XG 4JQIH 4QOKA 4NO2A 3TBSA 2I7OA 3R19A 3Q2NA 2VLLB 2PYFB 3WY2A 4O2EB 4XH2B 1K6QL 3CHPA 5D1QD 3TV8A 3VWJB 1O75A 2Y03A 3BLBA 3MRHA 4YLBA 5CJXA 3T3PE 3CHXA 3H56A 4B5ZA 1G4RA 2E27H 3BAWA 2NXZD 2DZEA 4XPGH 3L1GA 2CLRA 4JM2A 2NY1D 3OKMB 5CFAA 1KG8A 1FZMA 3O41A 3PL6C 1QQDB 4AVJA 3KDMA 1JS4A 5FM5O 3QJFA 5E5MA 1H5BA 4DKTA 2ADFH 3VW7A 2QTVA 2VLRD 4QRRB 1A6UL 1Z9SA 2P5WD 3HRZC 5F0PB 4LDLB 3KBEA 2FVNA 3ZL4H 2DQUL 4L8DB 4OB5L 1GGCL 3E3QE 3HUJF 1XCQA 2YD0A 3IDXL 3H42H 5CWSA 1BFSA 1L0XA 2H32A 4XAWH 1SXSA 4NRYA 4TUUA 3RL1A 1MREH 3WJJA 4NKIH 2ADIA 1WJ3A 2D2OA 3FRPA 1CFQB 3CLEL 4WKXA 1TCRB 2EYRB 1KDJA 1P53A 3U9PL 4Q9QH 3MODL 4PBWD 4KTYA 1I7ZB 4XN4A 3WJMB 5A16B 2E7CA 2AQNA 1AZVA 3SOTA 3DI2B 3UH8A 2AW2A 1LYQA 2NXYC 4PRDB 4IMLB 3VRIA 5D7JD 5HJGA 1TUPA 2OMVA 2PN5A 3FUDA 4YDJB 2O1AA 2C26A 3GBDA 2WYZA 1ZVSA 3IKKA 3O8XB 5AOZA 1YDPB 3F7VA 3WTUA 2IAMA 1TG8A 3BDBA 4APQA 5IR1B 4J3OF 1C3WA 2E7HA 3MMEA 4W9LC 2AVGA 3IU3A 4XMKL 1ZTXH 4XBEH 1UWYA 1UH2A 4E42B 5BUAA 3UTYA 1OB1B 4K7FA 1KNOA 1HJBC 1WBYB 5FKAA 3TYGH 3BPCA 1QKZL 3FQ2A 5CR1A 2AITA 5I1LB 5L2JB 4A2FA 4YDIH 1NMBH 3SGKC 5GZOD 3QNYB 5K39B 4GAGL 3SHSA 4KRPD 1F4XL 1N10A 5IJVA 4J2XA 3OKEA 4ZZFA 4IHOA 4DEPB 5F0JB 3MJGX 1A65A 2GJPA 1YYCA 2XN9B 4Q4EA 4ZFGH 3RWFB 3T2NL 3W3BA