4N4WA

Structure of the human smoothened receptor in complex with sant-1.
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
473
structure length
457
Chain Sequence
GGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSESKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQADCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Smoothened receptor modulation and chemoresistance to anticancer drugs.
pubmed doi rcsb
source organism Shigella flexneri 5 str. 8401
molecule tags Membrane protein, transport protein
molecule keywords Cytochrome b(562),Smoothened homolog
total genus 186
structure length 457
sequence length 473
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n4wA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n4wA02
4KNFA 5B6YA 3QBLA 5DHGA 3REYA 1GUEA 2G87A 5LWEA 2YCXA 4DKLA 4U9DA 1L0MA 3OAXA 5B0WA 3ZPRA 4UHRA 2YCYA 4Y9HA 4BWBA 3S8GB 1M0MA 5BR5A 5TGZA 2XM0A 1Q5JA 1S8LA 2WJKA 3COCA 2YDOA 4K5YA 3AM6A 2BRDA 3UZCA 3HAPA 3ZTMA 4X32A 3QAKA 5KKHA 4FA7B 1RCPA 4X1HA 3OE0A 4MD1A 3QJVB 2J4YA 3UTYA 4CDVA 2JAFA 2XLWA 5H2PA 1APCA 5H2JA 2WJLA 2HPYA 1BRRA 1GU8A 2PEDA 5B6ZA 4CJGA 5B6WA 1X0K1 5G28A 4WW3A 2QLAA 4JQ6A 2XL8A 3PXOA 1IW6A 3M4BA 3ZWIA 2YKZA 1E86A 1S52A 4G7SB 4X31A 1EHKB 3QAPA 4OV0A 1FBKA 3M4CA 3VVKA 4MQSA 3L1MA 3FOPA 4A4MA 4CJOA 2XLEA 3NSBA 1YYXA 4LDEA 5JRAA 5JVEA 1E12A 5JLIA 1E85A 5H2NA 1QM8A 3X3CA 2I21A 5JJEA 1CGOA 4JR8A 1QKPA 4JEBA 5JS5A 3UTWA 3VI0A 4BV0A 4J4QA 3QJUB 2R4RA 3AYNA 2XM4A 1QKOA 2Z73A 1S54A 2EI4A 4G72B 1M6TA 2YL3A 5ETZA 4XTLA 2NTWA 3P0GA 2NTUA 1C8RA 2AT9A 4GP8B 2KSBA 1UCQA 3V2WA 1S53A 4N4WA 3DE9A 1JGJA 2Y04A 5G2AA 5A44A 4CX9A 1R84A 1XMEB 3CAPA 4PXKA 5H2OA 3VGAA 3HNJA 3MBVA 5JJNA 4CDAA 5AWZA 4CIPA 5A8EA 3S8FB 2JAGA 5C1MA 3NS0A 1KGBA 2QPEB 3NMIA 2XLOA 1JV6A 1M0LA 2J9BA 4DAJA 1AT9A 1L9HA 5JP7A 1KMEA 3HNKA 1CGNA 4AMJA 4QRYA 5F8UA 1BM1A 1A7VA 3QVZA 1CWQA 4BEYA 1R2NA 5B35A 3RFMA 1O0AA 3C9MA 5G53A 3UTVA 4L6RA 4XT3A 3S3BB 5JJJA 4PXFA 3M15A 5AHZA 4CDYA 3M79A 4EIYA 2XL6A 4N6HA 4UG2A 1P8HA 2QPDB 4D4NA 2KSYA 3HNLA 4BEZA 5JSLA 1IXFA 3TOMA 1E0PA 3QBIA 4HYXA 3PQRA 4XXJA 5A45A 1E83A 1CPRA 4XTNA 5ITEA 3RZEA 2Y01A 5FJGA 1KG8A 3UG9A 3OE9A 4TL3A 3IQ6A 4G71B 1MQVA 2YL1A 2Y03A 4FAAB 1C8SA 4EJ4A 1LN6A 1CPQA 4GPOA 1BBHA 3UONA 4LDLA 5J7AA 3T45A 3C63A 4MQTA 4G7QB 2ZFEA 3PWHA 1X0SA 5EN0A 2XLVA 3ABWA 4L35A 3QJQB 4LDOA 2YCWA 4AMIA 3QVYA 1QHJA 2XLDA 1AP9A 3ZQVA 3HNIA 1IW9A 2KS9A 2YCZA 1JAFA 1GQAA 1H68A 1XJIA 1YYJA 3TOLA 4D4XA 5H2IA 3EH3B 1LM3B 3UTXA 4GBRA 4NC3A 1JFPA 2F93A 4FPDA 1YZAA 1C3WA 1U19A 1PXRA 1F88A 3EH5B 3QBKA 1NBBA 3HAOA 2L6XA 4WGYA 4ULVA 2Z55A 2VT4A 3FOOA 5AHYA 3NMJA 1TN5A 3QJTB 3A7KA 1P8UA 3BVDB 4JE9A 3EH4B 3QBGA 3NY9A 3S3CB 5G2CA 5AGFA 2YL7A 1P8IA 3NMKA 4IB4A 1M0KA 2I1XA 3QJRB 4FBZA 5B6XA 3PDSA 4JEAA 3VG9A 1QPUA 3C62A 1S51A 2YDVA 3HASA 3NYAA 2XLHA 3ZPQA 1GZMA 5B6VA 4HWLA 2X72A 4HYJA 2YL0A 1PY6A 3SN6R 3X3BA 4U9EA 1F50A 5DHHA 4EA3A 2Y00A 4JKVA 1VGOA 5G2DA 4GYCA 4N4YB 4GP5B 4G7RB 3EMLA 5B3IA 2RH1A 4QIDA 2YLDA 1TN0A 2J8WA 3UZAA 4BUOA 3DQBA 3V2YA 1BRXA 5G54A 3QW0A 2XLMA 1HZXA 1JV7A 5G36A 2LNLA 4BVNA 4G70B 3WQJA 2KSAA 3AYMA 3KJ6A 1H2SA 2YLGA 1BRDA 1S05A 3OE6A 5JUAA 3OE8A 3D4SA 1X0I1 2R4SA 1UAZA 2M3GA 5ITCA 1VJMA 3QW1A 2Y02A 3DDLA 3ODUA 5H2KA 3S3DB 3ZTZA 1Q5IA 1XIOA 5JT4A 4WAVA 1YZCA 3NY8A 3PBLA 4IARA 4ER9A 4DJHA 3ZQYA 5DYSA 1DZEA 1QQ3A 1F4ZA 3VHZA 2I20A 1FBBA 3DE8A 3ZEVA 1E84A 5H2HA 1S8JA 2ZIYA 3HAQA 2CCYA 1PXSA 5H2MA 5AX0A 3CODA 4MD2A 1MGYA 3U8PA 2ZZLA 4GP4B 4GRVA 1KG9A 4IAQA 4MBSA 3HANA 5H2LA 3IQ5A 4WGZA 2YLIA 3VRCA 1EKYA 3HARA 4QI1A 3C9LA 5AZDA 5B2NA 2I35A 4XTOA 3QDCA 2F95A 3VW7A 2BC5A 4XT1A 5BR2A 5B34A 3QJSB 4KLYA 256BA 5AX1A
chains in the Genus database with same CATH superfamily
3S90A 1BR2A 4UDVA 1GUEA 4EWCA 1YAUO 3EJNA 3FMSA 2G87A 2Q9CA 4DKLA 1O3UA 5B1BC 3RF3A 2LIGA 3JYHA 1ST6A 2M64A 3ZPRA 2YVKA 1ZW2A 2QE9A 2PP4A 4BG0A 2X51A 1Q5JA 1S8LA 3AM6A 1D1BA 4Q4ZF 3B29A 4U5FE 3AQBA 3TULA 3QAKA 1Q0MA 4FA7B 2ETSA 4X1HA 3X1OA 4MD1A 4PJLA 2J4YA 3L8IA 1RKCA 3EGDA 2DYSC 3EFOB 2ZXPA 1APCA 4BEJA 3FVYA 5L0CA 3EQLF 2YQYA 2MYSA 5B6WA 1ZYRF 3K33A 5KYNA 4JQ6A 3G4XA 1HE1A 1Q0KA 4QI2A 2P1AA 4OIQF 1ZHTA 3Q7LA 2I15A 4OV0A 4YT8A 3ZDLA 3GM3A 4MQ9F 3VVKA 4ZLDA 3NSBA 1YYXA 5JRAA 4E0IA 4GYTA 3UMIA 3AG3C 1E85A 1FTSA 2VASA 1ZZPA 5JJEA 2A0BA 5JS5A 4BV0A 4K1OA 1LVKA 2J0XA 2KW3C 2EI4A 3UNGC 1D0YA 3AG4C 4RD9A 2YL3A 5ETZA 4XTLA 3A11A 2A6HF 2KJGA 3EG9B 1S53A 1DOVA 4N4WA 3DE9A 2C04A 2Y04A 2B0JA 1AUEA 1TKNA 2YWAA 2DB4A 2NUPB 2Y69C 1R84A 1OCZC 3JT1A 2CNWA 3ZG1A 3Q6MA 4CDAA 5AWZA 3H65A 5A8EA 4AL0A 1WASA 2NSGA 4DXWA 5F5FA 3CSKA 3DJNB 3PHF2 1QZXA 3KYJA 3R2PA 4EBBA 3O6XA 3DM9B 3RVYA 3G4ZA 3HNKA 1CGNA 4AMJA 1A7VA 3QVZA 2IM8A 5KYUB 1E2XA 1MNDA 2R02A 2BL2A 1VYIA 5B35A 3NYLA 2HV7A 5G53A 3GM2A 1F1MA 5E2QA 1FR0A 4EIYA 4UG2A 4CBEA 4OINF 1J8YF 3HNLA 4BEZA 1A7DA 1V74B 4YT5A 2Q4FA 2R7TA 4HYXA 2XL4A 1WGWA 1MMGA 5A45A 4U5CE 1YA9A 3JSZA 3RZEA 3K6BA 4MVSA 1ZVZA 4G71B 3POVA 2KQ9A 4E18A 4YT4A 2MWQA 4FX5A 4GPOA 4OIOF 2WVOA 1U89A 3SNHA 2J7PD 3JRTA 1JOGA 5J7AA 1Z6AA 3C63A 4O7GA 1X0SA 2XLVA 3T9OA 4L35A 1Z7Qc 3QVYA 1GS9A 4RBNA 3ZQVA 4OIPF 1IW9A 4YT2A 2YCZA 3GEHA 2L9JA 4HFFB 1RJ9A 3AOUA 1G8XA 1UFBA 1YYJA 4XQ1A 1LM3B 3MBGA 3N2ZB 4PACA 4C7OB 4ANJA 1XWJA 1EQ1A 5CIVA 3HAOA 2L6XA 4WGYA 3BRJA 2LD6A 1KU2A 3LLIA 3VYWA 1ZHWA 4CS9C 3T4RA 2TMVP 1L3PA 3A7KA 3OEOA 4J7YA 3C8GD 2GWWA 4JE9A 4MVMA 3S3CB 5G2CA 4IB4A 3QJRB 5B6XA 3IPMO 4JTCB 1OCRC 1NSGB 1TR2A 1TWAA 3NRHA 4NCQA 1H9TA 2YL0A 3PMRA 2H8AA 1OXBA 4MNDA 2NUTA 4O79A 4JC7A 4A4AA 4GP5B 4G7RB 4YL1A 4C3EA 2RH1A 1BZ4A 3L8JA 1NLXA 2P61A 2OJQA 2R25A 4GQHA 3DJUB 3WHNA 3B9QA 4O6NA 4G70B 4LACB 3KJ6A 3S9OA 3RQFA 1S05A 1C02A 1TFKB 4XPWA 2H7OA 1MNEA 3OE8A 4OD5A 3JCUQ 3ABKC 1UAZA 2M3GA 1WTYA 4N06A 3RFYA 4PFPA 1VJMA 2Y02A 3AGUA 3OWTA 2Q00A 3PBLA 4ER9A 4X0RA 3ZQYA 5IY5C 2W4MA 1DZEA 3EG9A 1AEPA 2IXNA 4G0HA 3DE8A 3ZEVA 1E84A 4N6CA 1TWHA 2ZIYA 3T6JA 4I1OB 3UR3C 2EPOA 1M2VA 4JURI 5AX0A 5DVWA 2LSEA 1MGYA 5COMA 1YA7O 2Y39A 3B71A 3K1IC 3S84A 2LFFA 4KNVA 3C9LA 2I35A 1Z5ZA 3K66A 2F95A 1K05A 4YK5A 2HFIA 1YDIA 3GEEA 4JIOA 2R7UA 5B34A 1M2OA 1RXQA 3EGXA 4KNFA 5B6YA 3QBLA 2A1DD 5KYYB 1XZPA 1M56C 2A6EF 1L0MA 2KK1A 3U9MA 1V55C 3FAJA 3DXJF 2YCYA 4BWBA 3TJ5A 2L6GA 2WJKA 4XEFA 3V5XA 3COCA 2YDOA 3UZCA 3W2WA 1G4US 4BJ1A 5F5HA 3EGDB 2EPMX 5KKHA 2WL8A 1RCPA 3H2UA 3JYYA 3OE0A 3LS1A 2JAFA 3V5YA 1U0BB 3ITFA 2VH3A 5H2JA 1OR2A 1OQCA 2IYLD 4CJGA 4JTDB 1X0K1 5G28A 4WABA 4WW3A 3C8ZA 2F22A 3AGTA 3UMKA 1JPJA 5T3TA 2IBFA 3FAPB 1S52A 5KYXB 4C7OA 3FHDA 3RW0A 1TFOB 3HLZA 2R7SA 2L81A 3QAPA 3R7CA 4DVZA 1QVXA 1L7CA 4IRUA 1KTMA 3M4CA 2OU6A 1RJ9B 3FOPA 2R7WA 3L0IA 4AX2A 2HSQA 2XRHA 4JCZA 4LDEA 1E12A 1BDJB 4K0DA 1MMNA 4LLCA 2EPKX 4EUKB 5H2NA 3X3CA 3C18A 1CGOA 3LNRA 4JEBA 3UTWA 4XLNF 3W2VA 1M6TA 1SMYF 2E87A 3LJBA 2AT9A 3GODA 1UCQA 3V2WA 1FMWA 4MTFA 3SXZA 2Q9AA 4LDRA 1N1CA 2P0NA 5G2AA 5EHHA 4BJTA 4PXKA 5H2OA 1Z63A 2W9YA 3VF0A 2CNWD 3FXHA 4MW3A 4O6MA 2JAGA 1T9KA 1OXKA 2XS1A 5C1MA 3NS0A 4Q5SF 1FMVA 4KNWA 3N24A 2J9BA 4DAJA 3RQGA 1AT9A 2AP3A 5JP7A 4JJGA 5HV9A 5KYUA 3LAYA 3GM1A 4K7BA 3RKOF 2C03A 2R7XA 4QRYA 5F8UA 3JRMO 2W4BA 1BM1A 4YL3A 4BEYA 3UGPA 1R2NA 4U5EE 4EBJA 1K40A 3SEOA 1B68A 4XT3A 4CS8C 4YWQA 3M79A 2XL6A 4N6HA 4JCHA 1P8HA 2FAPB 2QPDB 3VM6A 1D1CA 1RKEB 2DYRC 1IXFA 2PF4E 3K1IA 4XXJA 1CPRA 2R7RA 4MVOA 5ITEA 5FJGA 3A9CA 1KG8A 3QMKA 2YZSA 4DBQA 2LP4A 2Y03A 2OJED 4CS8A 3KPHA 5KYXA 4E7ZA 1BBHA 3UONA 2G62A 4LDKA 5B3SC 3F47A 2CYDA 4MQTA 4LDQA 3PDMP 5DS6A 2EIKC 1FFTC 2ZFEA 2ZD9A 3ABWA 4R32A 2AU5A 3WODF 4KC9A 1UG7A 5CI9A 2KS9A 1JAFA 4G78A 1K04A 4HFKB 1A0BA 1XJIA 4WJ0A 3IEEA 3V7OA 4AK9A 2LCHA 2LFDA 5D92A 1JFPA 1YZAA 1C3WA 3EH5B 1NBBA 4P6IC 4MTOA 4ULVA 2UUHA 3UGOA 2HJMA 2ZXOA 3Q7GA 5BQHA 4PFOA 3F46A 3X2QC 5A6BD 5KYYA 3FDQA 3QJTB 4PJNA 3NYJA 1P8UA 5COGA 5DLJA 5AC4A 1R4TA 1MMAA 3U3FA 3U2LA 4DJ9A 1M0KA 4JEAA 4NTFA 2B0HA 3C62A 2YDVA 3O10A 3NYAA 1GZMA 5L0GA 2X72A 1ZU4A 1JRAA 4XLPF 5DHHA 1M2VB 4JKVA 4BJ5A 2KC3A 2BE5F 4GYCA 5L0JA 3EMLA 2PNOA 3AQCA 3E9VA 5B3IA 2V3CC 4QIDA 1TN0A 2J8WA 2A68F 4IGGA 2J46A 3U5SA 3E70C 3GANA 3WQJA 2KSAA 3AYMA 2YLGA 1BRDA 3OE6A 4HE8D 2Y3BA 2R4SA 3CQZA 2YRFA 3QW1A 3ZTZA 2OKUA 4BPMA 1I5NA 3NDBB 4DJHA 2XXAA 3DWWA 3I5PA 2Z15A 1F4ZA 2I20A 1FBBA 5H2HA 1S8JA 4XPYA 4BEMJ 3HAQA 3MLGA 4XTKA 1T5OA 3JSEO 1FFHA 1RMVA 3AG1C 3U8PA 1C17M 3US6A 1EI7A 3SP1A 5D91A 4MBSA 4CS7A 5H2LA 4XEKA 2EINC 1EKYA 3MYIA 5B2NA 2BC5A 1Y4CA 4A2NB 4KLYA 1OW8A 1VK5A 4PJMA 4J30B 5AX1A 4YN0B 5DHGA 3REYA 5L3VA 4DBRA 5L0FA 5T1DB 2YCXA 4BJ6C 3W4YA 4Y9HA 3S8GB 5BR5A 5A69A 2HSBA 5TGZA 2CW0F 2BRDA 1V4AA 2QUPA 3HAPA 3ZTMA 3T6GB 2DGJA 5EK0A 4JZAA 3QJVB 3UTYA 2GAQA 3TK0A 4IJJA 2XLWA 5A6KA 4RDAA 4CIHA 5H2PA 5EGYA 4NQFA 3EZHA 1NZEA 2JD3A 2R05A 3KYIA 5B6ZA 1OCOC 3LEOA 3Q6NA 4M63A 2L7AA 3ECSA 2QLAA 1WN0A 3NKEA 1J8MF 1IW6A 2ZXWC 4EBKA 3M4BA 3ZWIA 2GFHA 2OCCC 3DZAA 4X31A 1LKXA 1PD0A 3EZIA 2J9UA 1V54C 1FBKA 2KYHA 3IQCA 4AE4A 4A4MA 2Q7RA 4CJOA 3DMDA 2XLEA 4NTAA 5JLIA 2VCAA 3N0TA 4NTBA 4JR8A 4FWVA 1QKPA 4B6IA 4J4QA 2R4RA 3S0XA 2XM4A 3MX3A 1HY5A 4C3DA 4IWBA 3KL4A 4W8PA 1S54A 3LESA 4MVUA 1I4YA 1JR8A 3KH2A 3C8GA 3EGXB 5A6BA 2PBEA 2KSBA 1T6UA 5COFA 2ICWG 2HS5A 3ZIBA 3GORA 4IAOA 1XMEB 2R03A 3HNJA 3MBVA 1JPNA 5JJNA 4DOZA 5DS5A 3S8FB 1R5ID 5K0IA 2HZ8A 3B0VC 2YHSA 1S7ZA 3B0UX 3ABMC 3NMIA 4JRZA 2XSEA 2NUPA 2HJ3A 1D0XA 3KKBA 4FESA 1JV6A 3MFNA 2DI3A 3GWLA 4OD4A 3ZC4A 1CWQA 4J32B 2H7VC 3ASOC 4CSAC 1LS1A 3RFMA 1O0AA 3TD7A 4L6RA 5FZTA 1DOWA 5L0HA 5L3QA 3S3BB 4PXFA 2ZXRA 3M15A 4J7TA 4P9FA 1OCCC 4Z9IA 5JSLA 4U5DE 3TOMA 3QBIA 1T6IA 2OEVA 4EHPA 1EA8A 2CGEA 4TL3A 1T6QA 1JMWA 3EPVA 1VTMP 2VCBA 2YL1A 3RH3A 4FAAB 1C8SA 4PR9A 1LN6A 5BQIA 2QTVA 2VC9A 4I3MA 2IOQA 4DRJB 1NU9C 2CDQA 1Z3IX 4G7QB 5EN0A 3ASNC 5A6JA 3QJQB 4LDOA 4AMIA 2M4EA 3EFOA 1VLTA 1ORSC 1TWGA 4DRIB 2EIJC 5FCLA 3ZSUA 5BUOA 2GA0A 2UUIA 5CI8A 1Q0FA 2Q9BA 3TOLA 4D4XA 1PD1A 4NC3A 3W8IA 5DQZA 2KNHA 1U19A 1PXRA 1LIHA 1HW1A 3V5ZA 3SXKA 2Z55A 3QTHA 2R9RB 2VT4A 2O9XA 3NMJA 1TN5A 1ORJA 2QY9A 2I8BA 3BVDB 3QBGA 3NY9A 1SYQA 2YL7A 3NMKA 2I1XA 4FBZA 1ZHXA 3PDSA 3VG9A 4H54A 4HEAJ 1S51A 2AWCA 4XPXA 3AG2C 2D4UA 2XLHA 2Y3GA 3ZPQA 3RQEA 1VB5A 2XS8A 4HWLA 1MMDA 5B6VA 1NU7D 4G7OF 3SN6R 1RKEA 3DM5A 1BR1A 2Y00A 3LEVA 1VGOA 5L0IA 4MVRA 5G2DA 2J9WA 3ABLC 3CEXA 4U5BE 3UZAA 1ORYA 3S27A 3V2YA 1OKKA 1BRXA 3T6BA 3QW0A 2XLMA 3LLKA 1HZXA 3SXYA 4BVNA 2NUTB 3GEIA 1BR4A 2NSFA 1O5HA 1H2SA 1YJGA 3O39A 1SF8A 3DI5A 5AC5A 3D4SA 1OKKD 1X0I1 4F4BA 4XWJA 5ITCA 4QDLA 4U5GA 3DDLA 3ODUA 5H2KA 3S3DB 1VMAA 1Q5IA 4E17A 1XIOA 3U9JA 3PCVA 5DS4A 4BJ5C 3NY8A 1YZCA 4IARA 1GGQA 1QQ3A 2LQGA 3VHZA 3AJMA 3ATPA 3C8GB 1HMOA 1Q0DA 3UMHA 2WVNA 3I5QA 2PX3A 1PV3A 3W8HA 2CCYA 1PXSA 3G50A 5DQTA 1YARO 4P9TA 5H2MA 3CODA 4MD2A 3LS0A 1Z23A 4E7SA 4MTGA 4GP4B 4GRVA 3JTLO 1OW7A 1KG9A 4IAQA 1HW2A 3HANA 4KBLA 2YLIA 3VRCA 4LERA 3HARA 4QI1A 3QDCA 3VW7A 4AE4B 3O55A 3EH1A 5BQGA 5BR2A 2J45A 1LI7A 4EKWA 2Y3HA 3BEHA 4E0HA 1G5ZA 1H7IA 2EPNA 2NPUA 5LWEA 1WATA 4U9DA 3OAXA 5B0WA 2ASRA 4UHRA 2Q3TA 4PJJA 1M0MA 2XM0A 3LNMB 4I44A 4K5YA 2G3KA 1LI5A 4JJFA 2J0WA 4YJWA 4X32A 2WZGA 4AL1A 1CGME 4MVZA 4G7HF 4CDVA 3U0CA 4BJ6A 2WJLA 2HPYA 1BRRA 1GU8A 2PEDA 3NYMA 4C3BA 1LS4A 1TQGA 4U5HA 1SR2A 2GDCA 3B0PA 4CSAA 2XL8A 3LUTB 5A6AA 2EILC 3PXOA 4DS7E 4CS9A 2IXOA 1E86A 2YKZA 4G7SB 1EHKB 1VYKA 3C7JA 3TQOA 1OW6A 1D1AA 1I4ZA 1O87A 2WVQA 4MQSA 2JX0A 3L1MA 1D0ZA 3DAFA 2HV6A 3DAGA 1AVOB 2VB6A 1NG1A 5JVEA 2X0CA 1QM8A 3DKAA 2I21A 3VI0A 3GWNA 3QJUB 3AYNA 1QKOA 2Z73A 1IZMA 2RSEB 4G72B 5T3WA 2NTWA 3P0GA 2FGYA 2NTUA 1C8RA 2OQMA 4GP8B 3U2MA 2V26A 2HUJA 2XXAB 2KSFA 2A0UA 1JGJA 1PCXA 5A44A 2HMQA 4CX9A 5KYWB 3K7DA 4JTAB 3VGAA 3CAPA 1U6HA 1M57C 3KMIA 4JW1A 4FAPB 1NFOA 3U3BA 2IXPA 4CIPA 4KI2A 5L0DA 4I1MA 4DRHB 4O6YA 1KGBA 2QPEB 1LPEA 2XLOA 2KGOA 4Z9JA 1M0LA 1ZHYA 3NKDA 2MHRA 1L9HA 5KYWA 5TJ5E 1KMEA 3NG1A 3WAQA 3H2VA 2J7PA 3C9MA 4LLEA 3UTVA 1QKRA 2LK4A 4JVSA 5JJJA 5AHZA 3K1HA 4CDYA 2OG2A 2HKVA 4PK4A 3ZVRA 2R7VA 4DVYP 5GPGB 4D4NA 2KSYA 3S29A 2L6HA 3SXMA 1E0PA 5E33A 3PQRA 2ZPAA 3L34A 1E83A 4XTNA 3RYLA 3HKKA 2Y01A 2D5RB 3MYFA 3UG9A 1H6GA 3OE9A 2HMZA 3IQ6A 3VAYA 3HJCA 1MQVA 1NFNA 1IW7F 1TWCA 5HSWA 1ZW3A 4EJ4A 1CPQA 3JZ0A 4YL0A 4LDLA 4QI0A 3IHUA 3T45A 1KNYA 3OA1A 1HMDA 5E3AA 4W8KA 3WG7C 2G3VA 1C03A 3PWHA 1WOLA 2OOCA 3EHNA 2YCWA 1QHJA 2XLDA 2FFHA 1AP9A 3HNIA 2EPLX 4G7ZF 1W2WA 1GQAA 1YLMA 2R7QA 2WZLA 1H68A 5H2IA 3EH3B 2Y3DA 3UTXA 4GBRA 3EHMA 4Z9HA 2IXMA 2F93A 1QLEC 4FPDA 1F88A 3QBKA 4NY3A 1VLSA 4ULWA 2QNLA 3QZCA 3J06A 4H4KC 2NG1A 3FOOA 1VOMA 1HE9A 3RVZA 3TJ6A 5AHYA 2H7BA 3EH4B 4MW8A 5AGFA 1P8IA 1XZQA 2EIMC 1QPUA 2PFDA 4OIRF 3HASA 4GEHA 1SZIA 1A41A 4HYJA 2WB7A 2P7VA 1PY6A 3X3BA 2P6VA 4U9EA 1F50A 2AVKA 4EA3A 1QSPA 2VCCA 1H9GA 4N4YB 2PX0A 2J9VA 4MVQA 1ZHZA 2YLDA 3S28A 4BUOA 1WWPA 3DQBA 2R7OA 5G54A 1YVIA 4Q7CA 1ZU5A 5G36A 1JV7A 2LNLA 2JPUA 1Y6DA 4XEVA 1FNTc 5JUAA 2YEVA 1GM5A 3HTKC 2RD9A 5JT4A 1LE2A 3RIPA 4WAVA 1Q0GA 2AWYA 5E3CA 5DYSA 3EH2A 3IQTA 3CAXA 1A7EA 3M1CB 2L6FA 2A69F 1LE4A 1T01A 5B1AC 2ZZLA 3U8VA 4ONSA 1FAPB 3IQ5A 3CZ6A 4WGZA 4MS2A 3I4UA 2W45A 5AZDA 2WZFA 4XTOA 3DD7A 2OEXA 1OR3A 1G4WR 4XT1A 5F28E 3QJSB 256BA 4ZLCA 3SYNA 3SZRA
chains in the Genus database with same CATH topology
4KNFA 5B6YA 3QBLA 5DHGA 3REYA 1GUEA 2G87A 5LWEA 2YCXA 4DKLA 4U9DA 1L0MA 3OAXA 5B0WA 3ZPRA 4UHRA 2YCYA 4Y9HA 4BWBA 3S8GB 1M0MA 5BR5A 5TGZA 2XM0A 1Q5JA 1S8LA 2WJKA 3COCA 2YDOA 4K5YA 3AM6A 2BRDA 3UZCA 3HAPA 3ZTMA 4X32A 3QAKA 5KKHA 4FA7B 1RCPA 4X1HA 3OE0A 4MD1A 3QJVB 2J4YA 3UTYA 4CDVA 2JAFA 2XLWA 5H2PA 1APCA 5H2JA 2WJLA 2HPYA 1BRRA 1GU8A 2PEDA 5B6ZA 4CJGA 5B6WA 1X0K1 5G28A 4WW3A 2QLAA 4JQ6A 2XL8A 3PXOA 4DS7E 1IW6A 3M4BA 3ZWIA 2YKZA 1E86A 1S52A 4G7SB 4X31A 1EHKB 3QAPA 4OV0A 1FBKA 3M4CA 3VVKA 4MQSA 3L1MA 3FOPA 4A4MA 4CJOA 2XLEA 3NSBA 1YYXA 4LDEA 5JRAA 5JVEA 1E12A 5JLIA 1E85A 5H2NA 1QM8A 3X3CA 2I21A 5JJEA 1CGOA 4JR8A 1QKPA 4JEBA 5JS5A 3UTWA 3VI0A 4BV0A 4J4QA 3QJUB 2R4RA 3AYNA 2XM4A 1QKOA 2Z73A 1S54A 2EI4A 4G72B 1M6TA 2YL3A 5ETZA 4XTLA 2NTWA 3P0GA 2NTUA 1C8RA 2AT9A 4GP8B 2KSBA 1UCQA 3V2WA 1S53A 4N4WA 3DE9A 1JGJA 2Y04A 5G2AA 5A44A 4CX9A 1R84A 1XMEB 3CAPA 4PXKA 5H2OA 3VGAA 3HNJA 3MBVA 5JJNA 4CDAA 5AWZA 4CIPA 5A8EA 3S8FB 2JAGA 5C1MA 3NS0A 1KGBA 2QPEB 3NMIA 2XLOA 1JV6A 1M0LA 2J9BA 4DAJA 1AT9A 1L9HA 5JP7A 1KMEA 3HNKA 1CGNA 4AMJA 4QRYA 5F8UA 1BM1A 1A7VA 3QVZA 1CWQA 4BEYA 1R2NA 5B35A 3RFMA 1O0AA 3C9MA 5G53A 3UTVA 4L6RA 4XT3A 3S3BB 5JJJA 4PXFA 3M15A 5AHZA 4CDYA 3M79A 4EIYA 2XL6A 4N6HA 4UG2A 1P8HA 2QPDB 4D4NA 2KSYA 3HNLA 4BEZA 5JSLA 1IXFA 3TOMA 1E0PA 3QBIA 4HYXA 3PQRA 4XXJA 5A45A 1E83A 1CPRA 4XTNA 5ITEA 3RZEA 2Y01A 5FJGA 1KG8A 3UG9A 3OE9A 4TL3A 3IQ6A 4G71B 1MQVA 2YL1A 2Y03A 4FAAB 1C8SA 4EJ4A 1LN6A 1CPQA 4GPOA 1BBHA 3UONA 4LDLA 5J7AA 3T45A 3C63A 4MQTA 4G7QB 2ZFEA 3PWHA 1X0SA 5EN0A 2XLVA 3ABWA 4L35A 3QJQB 4LDOA 2YCWA 4AMIA 3QVYA 1QHJA 2XLDA 1AP9A 3ZQVA 3HNIA 1IW9A 2KS9A 2YCZA 1JAFA 1GQAA 1H68A 1XJIA 1YYJA 3TOLA 4D4XA 5H2IA 3EH3B 1LM3B 3UTXA 4GBRA 4NC3A 1JFPA 2F93A 4FPDA 1YZAA 1C3WA 1U19A 1PXRA 1F88A 3EH5B 3QBKA 1NBBA 3HAOA 2L6XA 4WGYA 4ULVA 2Z55A 2VT4A 3FOOA 5AHYA 3NMJA 1TN5A 3QJTB 3A7KA 1P8UA 3BVDB 4JE9A 3EH4B 3QBGA 3NY9A 3S3CB 5G2CA 5AGFA 2YL7A 1P8IA 3NMKA 4IB4A 1M0KA 2I1XA 3QJRB 4FBZA 5B6XA 3PDSA 4JEAA 3VG9A 1QPUA 3C62A 1S51A 2YDVA 3HASA 3NYAA 2XLHA 3ZPQA 1GZMA 5B6VA 4HWLA 2X72A 4HYJA 2YL0A 1PY6A 3SN6R 3X3BA 4U9EA 1F50A 5DHHA 4EA3A 2Y00A 4JKVA 1VGOA 5G2DA 4GYCA 4N4YB 4GP5B 4G7RB 3EMLA 5B3IA 2RH1A 4QIDA 2YLDA 1TN0A 2J8WA 3UZAA 4BUOA 3DQBA 3V2YA 1BRXA 5G54A 3QW0A 2XLMA 1HZXA 1JV7A 5G36A 2LNLA 4BVNA 4G70B 3WQJA 2KSAA 3AYMA 3KJ6A 1H2SA 2YLGA 1BRDA 1S05A 3OE6A 5JUAA 3OE8A 3D4SA 1X0I1 2R4SA 1UAZA 2M3GA 5ITCA 1VJMA 3QW1A 2Y02A 3DDLA 3ODUA 5H2KA 3S3DB 3ZTZA 1Q5IA 1XIOA 5JT4A 4WAVA 1YZCA 3NY8A 3PBLA 4IARA 4ER9A 4DJHA 3ZQYA 5DYSA 1DZEA 1QQ3A 1F4ZA 3VHZA 2I20A 1FBBA 3DE8A 3ZEVA 1E84A 5H2HA 1S8JA 2ZIYA 3HAQA 2CCYA 1PXSA 5H2MA 5AX0A 3CODA 4MD2A 1MGYA 3U8PA 2ZZLA 4GP4B 4GRVA 1KG9A 4IAQA 4MBSA 3HANA 5H2LA 3IQ5A 4WGZA 2YLIA 3VRCA 1EKYA 3HARA 4QI1A 3C9LA 5AZDA 5B2NA 2I35A 4XTOA 3QDCA 2F95A 3VW7A 2BC5A 4XT1A 5BR2A 5B34A 3QJSB 4KLYA 256BA 5AX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KNF A;  5B6Y A;  3QBL A;  5DHG A;  3REY A;  1GUE A;  2G87 A;  5LWE A;  2YCX A;  4DKL A;  4U9D A;  1L0M A;  3OAX A;  5B0W A;  3ZPR A;  4UHR A;  2YCY A;  4Y9H A;  4BWB A;  3S8G B;  1M0M A;  5BR5 A;  5TGZ A;  2XM0 A;  1Q5J A;  1S8L A;  2WJK A;  3COC A;  2YDO A;  4K5Y A;  3AM6 A;  2BRD A;  3UZC A;  3HAP A;  3ZTM A;  4X32 A;  3QAK A;  5KKH A;  4FA7 B;  1RCP A;  4X1H A;  3OE0 A;  4MD1 A;  3QJV B;  2J4Y A;  3UTY A;  4CDV A;  2JAF A;  2XLW A;  5H2P A;  1APC A;  5H2J A;  2WJL A;  2HPY A;  1BRR A;  1GU8 A;  2PED A;  5B6Z A;  4CJG A;  5B6W A;  1X0K 1;  5G28 A;  4WW3 A;  2QLA A;  4JQ6 A;  2XL8 A;  3PXO A;  1IW6 A;  3M4B A;  3ZWI A;  2YKZ A;  1E86 A;  1S52 A;  4G7S B;  4X31 A;  1EHK B;  3QAP A;  4OV0 A;  1FBK A;  3M4C A;  3VVK A;  4MQS A;  3L1M A;  3FOP A;  4A4M A;  4CJO A;  2XLE A;  3NSB A;  1YYX A;  4LDE A;  5JRA A;  5JVE A;  1E12 A;  5JLI A;  1E85 A;  5H2N A;  1QM8 A;  3X3C A;  2I21 A;  5JJE A;  1CGO A;  4JR8 A;  1QKP A;  4JEB A;  5JS5 A;  3UTW A;  3VI0 A;  4BV0 A;  4J4Q A;  3QJU B;  2R4R A;  3AYN A;  2XM4 A;  1QKO A;  2Z73 A;  1S54 A;  2EI4 A;  4G72 B;  1M6T A;  2YL3 A;  5ETZ A;  4XTL A;  2NTW A;  3P0G A;  2NTU A;  1C8R A;  2AT9 A;  4GP8 B;  2KSB A;  1UCQ A;  3V2W A;  1S53 A;  4N4W A;  3DE9 A;  1JGJ A;  2Y04 A;  5G2A A;  5A44 A;  4CX9 A;  1R84 A;  1XME B;  3CAP A;  4PXK A;  5H2O A;  3VGA A;  3HNJ A;  3MBV A;  5JJN A;  4CDA A;  5AWZ A;  4CIP A;  5A8E A;  3S8F B;  2JAG A;  5C1M A;  3NS0 A;  1KGB A;  2QPE B;  3NMI A;  2XLO A;  1JV6 A;  1M0L A;  2J9B A;  4DAJ A;  1AT9 A;  1L9H A;  5JP7 A;  1KME A;  3HNK A;  1CGN A;  4AMJ A;  4QRY A;  5F8U A;  1BM1 A;  1A7V A;  3QVZ A;  1CWQ A;  4BEY A;  1R2N A;  5B35 A;  3RFM A;  1O0A A;  3C9M A;  5G53 A;  3UTV A;  4L6R A;  4XT3 A;  3S3B B;  5JJJ A;  4PXF A;  3M15 A;  5AHZ A;  4CDY A;  3M79 A;  4EIY A;  2XL6 A;  4N6H A;  4UG2 A;  1P8H A;  2QPD B;  4D4N A;  2KSY A;  3HNL A;  4BEZ A;  5JSL A;  1IXF A;  3TOM A;  1E0P A;  3QBI A;  4HYX A;  3PQR A;  4XXJ A;  5A45 A;  1E83 A;  1CPR A;  4XTN A;  5ITE A;  3RZE A;  2Y01 A;  5FJG A;  1KG8 A;  3UG9 A;  3OE9 A;  4TL3 A;  3IQ6 A;  4G71 B;  1MQV A;  2YL1 A;  2Y03 A;  4FAA B;  1C8S A;  4EJ4 A;  1LN6 A;  1CPQ A;  4GPO A;  1BBH A;  3UON A;  4LDL A;  5J7A A;  3T45 A;  3C63 A;  4MQT A;  4G7Q B;  2ZFE A;  3PWH A;  1X0S A;  5EN0 A;  2XLV A;  3ABW A;  4L35 A;  3QJQ B;  4LDO A;  2YCW A;  4AMI A;  3QVY A;  1QHJ A;  2XLD A;  1AP9 A;  3ZQV A;  3HNI A;  1IW9 A;  2KS9 A;  2YCZ A;  1JAF A;  1GQA A;  1H68 A;  1XJI A;  1YYJ A;  3TOL A;  4D4X A;  5H2I A;  3EH3 B;  1LM3 B;  3UTX A;  4GBR A;  4NC3 A;  1JFP A;  2F93 A;  4FPD A;  1YZA A;  1C3W A;  1U19 A;  1PXR A;  1F88 A;  3EH5 B;  3QBK A;  1NBB A;  3HAO A;  2L6X A;  4WGY A;  4ULV A;  2Z55 A;  2VT4 A;  3FOO A;  5AHY A;  3NMJ A;  1TN5 A;  3QJT B;  3A7K A;  1P8U A;  3BVD B;  4JE9 A;  3EH4 B;  3QBG A;  3NY9 A;  3S3C B;  5G2C A;  5AGF A;  2YL7 A;  1P8I A;  3NMK A;  4IB4 A;  1M0K A;  2I1X A;  3QJR B;  4FBZ A;  5B6X A;  3PDS A;  4JEA A;  3VG9 A;  1QPU A;  3C62 A;  1S51 A;  2YDV A;  3HAS A;  3NYA A;  2XLH A;  3ZPQ A;  1GZM A;  5B6V A;  4HWL A;  2X72 A;  4HYJ A;  2YL0 A;  1PY6 A;  3SN6 R;  3X3B A;  4U9E A;  1F50 A;  5DHH A;  4EA3 A;  2Y00 A;  4JKV A;  1VGO A;  5G2D A;  4GYC A;  4N4Y B;  4GP5 B;  4G7R B;  3EML A;  5B3I A;  2RH1 A;  4QID A;  2YLD A;  1TN0 A;  2J8W A;  3UZA A;  4BUO A;  3DQB A;  3V2Y A;  1BRX A;  5G54 A;  3QW0 A;  2XLM A;  1HZX A;  1JV7 A;  5G36 A;  2LNL A;  4BVN A;  4G70 B;  3WQJ A;  2KSA A;  3AYM A;  3KJ6 A;  1H2S A;  2YLG A;  1BRD A;  1S05 A;  3OE6 A;  5JUA A;  3OE8 A;  3D4S A;  1X0I 1;  2R4S A;  1UAZ A;  2M3G A;  5ITC A;  1VJM A;  3QW1 A;  2Y02 A;  3DDL A;  3ODU A;  5H2K A;  3S3D B;  3ZTZ A;  1Q5I A;  1XIO A;  5JT4 A;  4WAV A;  1YZC A;  3NY8 A;  3PBL A;  4IAR A;  4ER9 A;  4DJH A;  3ZQY A;  5DYS A;  1DZE A;  1QQ3 A;  1F4Z A;  3VHZ A;  2I20 A;  1FBB A;  3DE8 A;  3ZEV A;  1E84 A;  5H2H A;  1S8J A;  2ZIY A;  3HAQ A;  2CCY A;  1PXS A;  5H2M A;  5AX0 A;  3COD A;  4MD2 A;  1MGY A;  3U8P A;  2ZZL A;  4GP4 B;  4GRV A;  1KG9 A;  4IAQ A;  4MBS A;  3HAN A;  5H2L A;  3IQ5 A;  4WGZ A;  2YLI A;  3VRC A;  1EKY A;  3HAR A;  4QI1 A;  3C9L A;  5AZD A;  5B2N A;  2I35 A;  4XTO A;  3QDC A;  2F95 A;  3VW7 A;  2BC5 A;  4XT1 A;  5BR2 A;  5B34 A;  3QJS B;  4KLY A;  256B A;  5AX1 A; 
#chains in the Genus database with same CATH topology
 3S90 A;  1BR2 A;  4UDV A;  1GUE A;  4EWC A;  1YAU O;  3EJN A;  3FMS A;  2G87 A;  2Q9C A;  4DKL A;  1O3U A;  5B1B C;  3RF3 A;  2LIG A;  3JYH A;  1ST6 A;  2M64 A;  3ZPR A;  2YVK A;  1ZW2 A;  2QE9 A;  2PP4 A;  4BG0 A;  2X51 A;  1Q5J A;  1S8L A;  3AM6 A;  1D1B A;  4Q4Z F;  3B29 A;  4U5F E;  3AQB A;  3TUL A;  3QAK A;  1Q0M A;  4FA7 B;  2ETS A;  4X1H A;  3X1O A;  4MD1 A;  4PJL A;  2J4Y A;  3L8I A;  1RKC A;  3EGD A;  2DYS C;  3EFO B;  2ZXP A;  1APC A;  4BEJ A;  3FVY A;  5L0C A;  3EQL F;  2YQY A;  2MYS A;  5B6W A;  1ZYR F;  3K33 A;  5KYN A;  4JQ6 A;  3G4X A;  1HE1 A;  1Q0K A;  4QI2 A;  2P1A A;  4OIQ F;  1ZHT A;  3Q7L A;  2I15 A;  4OV0 A;  4YT8 A;  3ZDL A;  3GM3 A;  4MQ9 F;  3VVK A;  4ZLD A;  3NSB A;  1YYX A;  5JRA A;  4E0I A;  4GYT A;  3UMI A;  3AG3 C;  1E85 A;  1FTS A;  2VAS A;  1ZZP A;  5JJE A;  2A0B A;  5JS5 A;  4BV0 A;  4K1O A;  1LVK A;  2J0X A;  2KW3 C;  2EI4 A;  3UNG C;  1D0Y A;  3AG4 C;  4RD9 A;  2YL3 A;  5ETZ A;  4XTL A;  3A11 A;  2A6H F;  2KJG A;  3EG9 B;  1S53 A;  1DOV A;  4N4W A;  3DE9 A;  2C04 A;  2Y04 A;  2B0J A;  1AUE A;  1TKN A;  2YWA A;  2DB4 A;  2NUP B;  2Y69 C;  1R84 A;  1OCZ C;  3JT1 A;  2CNW A;  3ZG1 A;  3Q6M A;  4CDA A;  5AWZ A;  3H65 A;  5A8E A;  4AL0 A;  1WAS A;  2NSG A;  4DXW A;  5F5F A;  3CSK A;  3DJN B;  3PHF 2;  1QZX A;  3KYJ A;  3R2P A;  4EBB A;  3O6X A;  3DM9 B;  3RVY A;  3G4Z A;  3HNK A;  1CGN A;  4AMJ A;  1A7V A;  3QVZ A;  2IM8 A;  5KYU B;  1E2X A;  1MND A;  2R02 A;  2BL2 A;  1VYI A;  5B35 A;  3NYL A;  2HV7 A;  5G53 A;  3GM2 A;  1F1M A;  5E2Q A;  1FR0 A;  4EIY A;  4UG2 A;  4CBE A;  4OIN F;  1J8Y F;  3HNL A;  4BEZ A;  1A7D A;  1V74 B;  4YT5 A;  2Q4F A;  2R7T A;  4HYX A;  2XL4 A;  1WGW A;  1MMG A;  5A45 A;  4U5C E;  1YA9 A;  3JSZ A;  3RZE A;  3K6B A;  4MVS A;  1ZVZ A;  4G71 B;  3POV A;  2KQ9 A;  4E18 A;  4YT4 A;  2MWQ A;  4FX5 A;  4GPO A;  4OIO F;  2WVO A;  1U89 A;  3SNH A;  2J7P D;  3JRT A;  1JOG A;  5J7A A;  1Z6A A;  3C63 A;  4O7G A;  1X0S A;  2XLV A;  3T9O A;  4L35 A;  1Z7Q c;  3QVY A;  1GS9 A;  4RBN A;  3ZQV A;  4OIP F;  1IW9 A;  4YT2 A;  2YCZ A;  3GEH A;  2L9J A;  4HFF B;  1RJ9 A;  3AOU A;  1G8X A;  1UFB A;  1YYJ A;  4XQ1 A;  1LM3 B;  3MBG A;  3N2Z B;  4PAC A;  4C7O B;  4ANJ A;  1XWJ A;  1EQ1 A;  5CIV A;  3HAO A;  2L6X A;  4WGY A;  3BRJ A;  2LD6 A;  1KU2 A;  3LLI A;  3VYW A;  1ZHW A;  4CS9 C;  3T4R A;  2TMV P;  1L3P A;  3A7K A;  3OEO A;  4J7Y A;  3C8G D;  2GWW A;  4JE9 A;  4MVM A;  3S3C B;  5G2C A;  4IB4 A;  3QJR B;  5B6X A;  3IPM O;  4JTC B;  1OCR C;  1NSG B;  1TR2 A;  1TWA A;  3NRH A;  4NCQ A;  1H9T A;  2YL0 A;  3PMR A;  2H8A A;  1OXB A;  4MND A;  2NUT A;  4O79 A;  4JC7 A;  4A4A A;  4GP5 B;  4G7R B;  4YL1 A;  4C3E A;  2RH1 A;  1BZ4 A;  3L8J A;  1NLX A;  2P61 A;  2OJQ A;  2R25 A;  4GQH A;  3DJU B;  3WHN A;  3B9Q A;  4O6N A;  4G70 B;  4LAC B;  3KJ6 A;  3S9O A;  3RQF A;  1S05 A;  1C02 A;  1TFK B;  4XPW A;  2H7O A;  1MNE A;  3OE8 A;  4OD5 A;  3JCU Q;  3ABK C;  1UAZ A;  2M3G A;  1WTY A;  4N06 A;  3RFY A;  4PFP A;  1VJM A;  2Y02 A;  3AGU A;  3OWT A;  2Q00 A;  3PBL A;  4ER9 A;  4X0R A;  3ZQY A;  5IY5 C;  2W4M A;  1DZE A;  3EG9 A;  1AEP A;  2IXN A;  4G0H A;  3DE8 A;  3ZEV A;  1E84 A;  4N6C A;  1TWH A;  2ZIY A;  3T6J A;  4I1O B;  3UR3 C;  2EPO A;  1M2V A;  4JUR I;  5AX0 A;  5DVW A;  2LSE A;  1MGY A;  5COM A;  1YA7 O;  2Y39 A;  3B71 A;  3K1I C;  3S84 A;  2LFF A;  4KNV A;  3C9L A;  2I35 A;  1Z5Z A;  3K66 A;  2F95 A;  1K05 A;  4YK5 A;  2HFI A;  1YDI A;  3GEE A;  4JIO A;  2R7U A;  5B34 A;  1M2O A;  1RXQ A;  3EGX A;  4KNF A;  5B6Y A;  3QBL A;  2A1D D;  5KYY B;  1XZP A;  1M56 C;  2A6E F;  1L0M A;  2KK1 A;  3U9M A;  1V55 C;  3FAJ A;  3DXJ F;  2YCY A;  4BWB A;  3TJ5 A;  2L6G A;  2WJK A;  4XEF A;  3V5X A;  3COC A;  2YDO A;  3UZC A;  3W2W A;  1G4U S;  4BJ1 A;  5F5H A;  3EGD B;  2EPM X;  5KKH A;  2WL8 A;  1RCP A;  3H2U A;  3JYY A;  3OE0 A;  3LS1 A;  2JAF A;  3V5Y A;  1U0B B;  3ITF A;  2VH3 A;  5H2J A;  1OR2 A;  1OQC A;  2IYL D;  4CJG A;  4JTD B;  1X0K 1;  5G28 A;  4WAB A;  4WW3 A;  3C8Z A;  2F22 A;  3AGT A;  3UMK A;  1JPJ A;  5T3T A;  2IBF A;  3FAP B;  1S52 A;  5KYX B;  4C7O A;  3FHD A;  3RW0 A;  1TFO B;  3HLZ A;  2R7S A;  2L81 A;  3QAP A;  3R7C A;  4DVZ A;  1QVX A;  1L7C A;  4IRU A;  1KTM A;  3M4C A;  2OU6 A;  1RJ9 B;  3FOP A;  2R7W A;  3L0I A;  4AX2 A;  2HSQ A;  2XRH A;  4JCZ A;  4LDE A;  1E12 A;  1BDJ B;  4K0D A;  1MMN A;  4LLC A;  2EPK X;  4EUK B;  5H2N A;  3X3C A;  3C18 A;  1CGO A;  3LNR A;  4JEB A;  3UTW A;  4XLN F;  3W2V A;  1M6T A;  1SMY F;  2E87 A;  3LJB A;  2AT9 A;  3GOD A;  1UCQ A;  3V2W A;  1FMW A;  4MTF A;  3SXZ A;  2Q9A A;  4LDR A;  1N1C A;  2P0N A;  5G2A A;  5EHH A;  4BJT A;  4PXK A;  5H2O A;  1Z63 A;  2W9Y A;  3VF0 A;  2CNW D;  3FXH A;  4MW3 A;  4O6M A;  2JAG A;  1T9K A;  1OXK A;  2XS1 A;  5C1M A;  3NS0 A;  4Q5S F;  1FMV A;  4KNW A;  3N24 A;  2J9B A;  4DAJ A;  3RQG A;  1AT9 A;  2AP3 A;  5JP7 A;  4JJG A;  5HV9 A;  5KYU A;  3LAY A;  3GM1 A;  4K7B A;  3RKO F;  2C03 A;  2R7X A;  4QRY A;  5F8U A;  3JRM O;  2W4B A;  1BM1 A;  4YL3 A;  4BEY A;  3UGP A;  1R2N A;  4U5E E;  4EBJ A;  1K40 A;  3SEO A;  1B68 A;  4XT3 A;  4CS8 C;  4YWQ A;  3M79 A;  2XL6 A;  4N6H A;  4JCH A;  1P8H A;  2FAP B;  2QPD B;  3VM6 A;  1D1C A;  1RKE B;  2DYR C;  1IXF A;  2PF4 E;  3K1I A;  4XXJ A;  1CPR A;  2R7R A;  4MVO A;  5ITE A;  5FJG A;  3A9C A;  1KG8 A;  3QMK A;  2YZS A;  4DBQ A;  2LP4 A;  2Y03 A;  2OJE D;  4CS8 A;  3KPH A;  5KYX A;  4E7Z A;  1BBH A;  3UON A;  2G62 A;  4LDK A;  5B3S C;  3F47 A;  2CYD A;  4MQT A;  4LDQ A;  3PDM P;  5DS6 A;  2EIK C;  1FFT C;  2ZFE A;  2ZD9 A;  3ABW A;  4R32 A;  2AU5 A;  3WOD F;  4KC9 A;  1UG7 A;  5CI9 A;  2KS9 A;  1JAF A;  4G78 A;  1K04 A;  4HFK B;  1A0B A;  1XJI A;  4WJ0 A;  3IEE A;  3V7O A;  4AK9 A;  2LCH A;  2LFD A;  5D92 A;  1JFP A;  1YZA A;  1C3W A;  3EH5 B;  1NBB A;  4P6I C;  4MTO A;  4ULV A;  2UUH A;  3UGO A;  2HJM A;  2ZXO A;  3Q7G A;  5BQH A;  4PFO A;  3F46 A;  3X2Q C;  5A6B D;  5KYY A;  3FDQ A;  3QJT B;  4PJN A;  3NYJ A;  1P8U A;  5COG A;  5DLJ A;  5AC4 A;  1R4T A;  1MMA A;  3U3F A;  3U2L A;  4DJ9 A;  1M0K A;  4JEA A;  4NTF A;  2B0H A;  3C62 A;  2YDV A;  3O10 A;  3NYA A;  1GZM A;  5L0G A;  2X72 A;  1ZU4 A;  1JRA A;  4XLP F;  5DHH A;  1M2V B;  4JKV A;  4BJ5 A;  2KC3 A;  2BE5 F;  4GYC A;  5L0J A;  3EML A;  2PNO A;  3AQC A;  3E9V A;  5B3I A;  2V3C C;  4QID A;  1TN0 A;  2J8W A;  2A68 F;  4IGG A;  2J46 A;  3U5S A;  3E70 C;  3GAN A;  3WQJ A;  2KSA A;  3AYM A;  2YLG A;  1BRD A;  3OE6 A;  4HE8 D;  2Y3B A;  2R4S A;  3CQZ A;  2YRF A;  3QW1 A;  3ZTZ A;  2OKU A;  4BPM A;  1I5N A;  3NDB B;  4DJH A;  2XXA A;  3DWW A;  3I5P A;  2Z15 A;  1F4Z A;  2I20 A;  1FBB A;  5H2H A;  1S8J A;  4XPY A;  4BEM J;  3HAQ A;  3MLG A;  4XTK A;  1T5O A;  3JSE O;  1FFH A;  1RMV A;  3AG1 C;  3U8P A;  1C17 M;  3US6 A;  1EI7 A;  3SP1 A;  5D91 A;  4MBS A;  4CS7 A;  5H2L A;  4XEK A;  2EIN C;  1EKY A;  3MYI A;  5B2N A;  2BC5 A;  1Y4C A;  4A2N B;  4KLY A;  1OW8 A;  1VK5 A;  4PJM A;  4J30 B;  5AX1 A;  4YN0 B;  5DHG A;  3REY A;  5L3V A;  4DBR A;  5L0F A;  5T1D B;  2YCX A;  4BJ6 C;  3W4Y A;  4Y9H A;  3S8G B;  5BR5 A;  5A69 A;  2HSB A;  5TGZ A;  2CW0 F;  2BRD A;  1V4A A;  2QUP A;  3HAP A;  3ZTM A;  3T6G B;  2DGJ A;  5EK0 A;  4JZA A;  3QJV B;  3UTY A;  2GAQ A;  3TK0 A;  4IJJ A;  2XLW A;  5A6K A;  4RDA A;  4CIH A;  5H2P A;  5EGY A;  4NQF A;  3EZH A;  1NZE A;  2JD3 A;  2R05 A;  3KYI A;  5B6Z A;  1OCO C;  3LEO A;  3Q6N A;  4M63 A;  2L7A A;  3ECS A;  2QLA A;  1WN0 A;  3NKE A;  1J8M F;  1IW6 A;  2ZXW C;  4EBK A;  3M4B A;  3ZWI A;  2GFH A;  2OCC C;  3DZA A;  4X31 A;  1LKX A;  1PD0 A;  3EZI A;  2J9U A;  1V54 C;  1FBK A;  2KYH A;  3IQC A;  4AE4 A;  4A4M A;  2Q7R A;  4CJO A;  3DMD A;  2XLE A;  4NTA A;  5JLI A;  2VCA A;  3N0T A;  4NTB A;  4JR8 A;  4FWV A;  1QKP A;  4B6I A;  4J4Q A;  2R4R A;  3S0X A;  2XM4 A;  3MX3 A;  1HY5 A;  4C3D A;  4IWB A;  3KL4 A;  4W8P A;  1S54 A;  3LES A;  4MVU A;  1I4Y A;  1JR8 A;  3KH2 A;  3C8G A;  3EGX B;  5A6B A;  2PBE A;  2KSB A;  1T6U A;  5COF A;  2ICW G;  2HS5 A;  3ZIB A;  3GOR A;  4IAO A;  1XME B;  2R03 A;  3HNJ A;  3MBV A;  1JPN A;  5JJN A;  4DOZ A;  5DS5 A;  3S8F B;  1R5I D;  5K0I A;  2HZ8 A;  3B0V C;  2YHS A;  1S7Z A;  3B0U X;  3ABM C;  3NMI A;  4JRZ A;  2XSE A;  2NUP A;  2HJ3 A;  1D0X A;  3KKB A;  4FES A;  1JV6 A;  3MFN A;  2DI3 A;  3GWL A;  4OD4 A;  3ZC4 A;  1CWQ A;  4J32 B;  2H7V C;  3ASO C;  4CSA C;  1LS1 A;  3RFM A;  1O0A A;  3TD7 A;  4L6R A;  5FZT A;  1DOW A;  5L0H A;  5L3Q A;  3S3B B;  4PXF A;  2ZXR A;  3M15 A;  4J7T A;  4P9F A;  1OCC C;  4Z9I A;  5JSL A;  4U5D E;  3TOM A;  3QBI A;  1T6I A;  2OEV A;  4EHP A;  1EA8 A;  2CGE A;  4TL3 A;  1T6Q A;  1JMW A;  3EPV A;  1VTM P;  2VCB A;  2YL1 A;  3RH3 A;  4FAA B;  1C8S A;  4PR9 A;  1LN6 A;  5BQI A;  2QTV A;  2VC9 A;  4I3M A;  2IOQ A;  4DRJ B;  1NU9 C;  2CDQ A;  1Z3I X;  4G7Q B;  5EN0 A;  3ASN C;  5A6J A;  3QJQ B;  4LDO A;  4AMI A;  2M4E A;  3EFO A;  1VLT A;  1ORS C;  1TWG A;  4DRI B;  2EIJ C;  5FCL A;  3ZSU A;  5BUO A;  2GA0 A;  2UUI A;  5CI8 A;  1Q0F A;  2Q9B A;  3TOL A;  4D4X A;  1PD1 A;  4NC3 A;  3W8I A;  5DQZ A;  2KNH A;  1U19 A;  1PXR A;  1LIH A;  1HW1 A;  3V5Z A;  3SXK A;  2Z55 A;  3QTH A;  2R9R B;  2VT4 A;  2O9X A;  3NMJ A;  1TN5 A;  1ORJ A;  2QY9 A;  2I8B A;  3BVD B;  3QBG A;  3NY9 A;  1SYQ A;  2YL7 A;  3NMK A;  2I1X A;  4FBZ A;  1ZHX A;  3PDS A;  3VG9 A;  4H54 A;  4HEA J;  1S51 A;  2AWC A;  4XPX A;  3AG2 C;  2D4U A;  2XLH A;  2Y3G A;  3ZPQ A;  3RQE A;  1VB5 A;  2XS8 A;  4HWL A;  1MMD A;  5B6V A;  1NU7 D;  4G7O F;  3SN6 R;  1RKE A;  3DM5 A;  1BR1 A;  2Y00 A;  3LEV A;  1VGO A;  5L0I A;  4MVR A;  5G2D A;  2J9W A;  3ABL C;  3CEX A;  4U5B E;  3UZA A;  1ORY A;  3S27 A;  3V2Y A;  1OKK A;  1BRX A;  3T6B A;  3QW0 A;  2XLM A;  3LLK A;  1HZX A;  3SXY A;  4BVN A;  2NUT B;  3GEI A;  1BR4 A;  2NSF A;  1O5H A;  1H2S A;  1YJG A;  3O39 A;  1SF8 A;  3DI5 A;  5AC5 A;  3D4S A;  1OKK D;  1X0I 1;  4F4B A;  4XWJ A;  5ITC A;  4QDL A;  4U5G A;  3DDL A;  3ODU A;  5H2K A;  3S3D B;  1VMA A;  1Q5I A;  4E17 A;  1XIO A;  3U9J A;  3PCV A;  5DS4 A;  4BJ5 C;  3NY8 A;  1YZC A;  4IAR A;  1GGQ A;  1QQ3 A;  2LQG A;  3VHZ A;  3AJM A;  3ATP A;  3C8G B;  1HMO A;  1Q0D A;  3UMH A;  2WVN A;  3I5Q A;  2PX3 A;  1PV3 A;  3W8H A;  2CCY A;  1PXS A;  3G50 A;  5DQT A;  1YAR O;  4P9T A;  5H2M A;  3COD A;  4MD2 A;  3LS0 A;  1Z23 A;  4E7S A;  4MTG A;  4GP4 B;  4GRV A;  3JTL O;  1OW7 A;  1KG9 A;  4IAQ A;  1HW2 A;  3HAN A;  4KBL A;  2YLI A;  3VRC A;  4LER A;  3HAR A;  4QI1 A;  3QDC A;  3VW7 A;  4AE4 B;  3O55 A;  3EH1 A;  5BQG A;  5BR2 A;  2J45 A;  1LI7 A;  4EKW A;  2Y3H A;  3BEH A;  4E0H A;  1G5Z A;  1H7I A;  2EPN A;  2NPU A;  5LWE A;  1WAT A;  4U9D A;  3OAX A;  5B0W A;  2ASR A;  4UHR A;  2Q3T A;  4PJJ A;  1M0M A;  2XM0 A;  3LNM B;  4I44 A;  4K5Y A;  2G3K A;  1LI5 A;  4JJF A;  2J0W A;  4YJW A;  4X32 A;  2WZG A;  4AL1 A;  1CGM E;  4MVZ A;  4G7H F;  4CDV A;  3U0C A;  4BJ6 A;  2WJL A;  2HPY A;  1BRR A;  1GU8 A;  2PED A;  3NYM A;  4C3B A;  1LS4 A;  1TQG A;  4U5H A;  1SR2 A;  2GDC A;  3B0P A;  4CSA A;  2XL8 A;  3LUT B;  5A6A A;  2EIL C;  3PXO A;  4DS7 E;  4CS9 A;  2IXO A;  1E86 A;  2YKZ A;  4G7S B;  1EHK B;  1VYK A;  3C7J A;  3TQO A;  1OW6 A;  1D1A A;  1I4Z A;  1O87 A;  2WVQ A;  4MQS A;  2JX0 A;  3L1M A;  1D0Z A;  3DAF A;  2HV6 A;  3DAG A;  1AVO B;  2VB6 A;  1NG1 A;  5JVE A;  2X0C A;  1QM8 A;  3DKA A;  2I21 A;  3VI0 A;  3GWN A;  3QJU B;  3AYN A;  1QKO A;  2Z73 A;  1IZM A;  2RSE B;  4G72 B;  5T3W A;  2NTW A;  3P0G A;  2FGY A;  2NTU A;  1C8R A;  2OQM A;  4GP8 B;  3U2M A;  2V26 A;  2HUJ A;  2XXA B;  2KSF A;  2A0U A;  1JGJ A;  1PCX A;  5A44 A;  2HMQ A;  4CX9 A;  5KYW B;  3K7D A;  4JTA B;  3VGA A;  3CAP A;  1U6H A;  1M57 C;  3KMI A;  4JW1 A;  4FAP B;  1NFO A;  3U3B A;  2IXP A;  4CIP A;  4KI2 A;  5L0D A;  4I1M A;  4DRH B;  4O6Y A;  1KGB A;  2QPE B;  1LPE A;  2XLO A;  2KGO A;  4Z9J A;  1M0L A;  1ZHY A;  3NKD A;  2MHR A;  1L9H A;  5KYW A;  5TJ5 E;  1KME A;  3NG1 A;  3WAQ A;  3H2V A;  2J7P A;  3C9M A;  4LLE A;  3UTV A;  1QKR A;  2LK4 A;  4JVS A;  5JJJ A;  5AHZ A;  3K1H A;  4CDY A;  2OG2 A;  2HKV A;  4PK4 A;  3ZVR A;  2R7V A;  4DVY P;  5GPG B;  4D4N A;  2KSY A;  3S29 A;  2L6H A;  3SXM A;  1E0P A;  5E33 A;  3PQR A;  2ZPA A;  3L34 A;  1E83 A;  4XTN A;  3RYL A;  3HKK A;  2Y01 A;  2D5R B;  3MYF A;  3UG9 A;  1H6G A;  3OE9 A;  2HMZ A;  3IQ6 A;  3VAY A;  3HJC A;  1MQV A;  1NFN A;  1IW7 F;  1TWC A;  5HSW A;  1ZW3 A;  4EJ4 A;  1CPQ A;  3JZ0 A;  4YL0 A;  4LDL A;  4QI0 A;  3IHU A;  3T45 A;  1KNY A;  3OA1 A;  1HMD A;  5E3A A;  4W8K A;  3WG7 C;  2G3V A;  1C03 A;  3PWH A;  1WOL A;  2OOC A;  3EHN A;  2YCW A;  1QHJ A;  2XLD A;  2FFH A;  1AP9 A;  3HNI A;  2EPL X;  4G7Z F;  1W2W A;  1GQA A;  1YLM A;  2R7Q A;  2WZL A;  1H68 A;  5H2I A;  3EH3 B;  2Y3D A;  3UTX A;  4GBR A;  3EHM A;  4Z9H A;  2IXM A;  2F93 A;  1QLE C;  4FPD A;  1F88 A;  3QBK A;  4NY3 A;  1VLS A;  4ULW A;  2QNL A;  3QZC A;  3J06 A;  4H4K C;  2NG1 A;  3FOO A;  1VOM A;  1HE9 A;  3RVZ A;  3TJ6 A;  5AHY A;  2H7B A;  3EH4 B;  4MW8 A;  5AGF A;  1P8I A;  1XZQ A;  2EIM C;  1QPU A;  2PFD A;  4OIR F;  3HAS A;  4GEH A;  1SZI A;  1A41 A;  4HYJ A;  2WB7 A;  2P7V A;  1PY6 A;  3X3B A;  2P6V A;  4U9E A;  1F50 A;  2AVK A;  4EA3 A;  1QSP A;  2VCC A;  1H9G A;  4N4Y B;  2PX0 A;  2J9V A;  4MVQ A;  1ZHZ A;  2YLD A;  3S28 A;  4BUO A;  1WWP A;  3DQB A;  2R7O A;  5G54 A;  1YVI A;  4Q7C A;  1ZU5 A;  5G36 A;  1JV7 A;  2LNL A;  2JPU A;  1Y6D A;  4XEV A;  1FNT c;  5JUA A;  2YEV A;  1GM5 A;  3HTK C;  2RD9 A;  5JT4 A;  1LE2 A;  3RIP A;  4WAV A;  1Q0G A;  2AWY A;  5E3C A;  5DYS A;  3EH2 A;  3IQT A;  3CAX A;  1A7E A;  3M1C B;  2L6F A;  2A69 F;  1LE4 A;  1T01 A;  5B1A C;  2ZZL A;  3U8V A;  4ONS A;  1FAP B;  3IQ5 A;  3CZ6 A;  4WGZ A;  4MS2 A;  3I4U A;  2W45 A;  5AZD A;  2WZF A;  4XTO A;  3DD7 A;  2OEX A;  1OR3 A;  1G4W R;  4XT1 A;  5F28 E;  3QJS B;  256B A;  4ZLC A;  3SYN A;  3SZR A; 
#chains in the Genus database with same CATH homology
 4KNF A;  5B6Y A;  3QBL A;  5DHG A;  3REY A;  1GUE A;  2G87 A;  5LWE A;  2YCX A;  4DKL A;  4U9D A;  1L0M A;  3OAX A;  5B0W A;  3ZPR A;  4UHR A;  2YCY A;  4Y9H A;  4BWB A;  3S8G B;  1M0M A;  5BR5 A;  5TGZ A;  2XM0 A;  1Q5J A;  1S8L A;  2WJK A;  3COC A;  2YDO A;  4K5Y A;  3AM6 A;  2BRD A;  3UZC A;  3HAP A;  3ZTM A;  4X32 A;  3QAK A;  5KKH A;  4FA7 B;  1RCP A;  4X1H A;  3OE0 A;  4MD1 A;  3QJV B;  2J4Y A;  3UTY A;  4CDV A;  2JAF A;  2XLW A;  5H2P A;  1APC A;  5H2J A;  2WJL A;  2HPY A;  1BRR A;  1GU8 A;  2PED A;  5B6Z A;  4CJG A;  5B6W A;  1X0K 1;  5G28 A;  4WW3 A;  2QLA A;  4JQ6 A;  2XL8 A;  3PXO A;  4DS7 E;  1IW6 A;  3M4B A;  3ZWI A;  2YKZ A;  1E86 A;  1S52 A;  4G7S B;  4X31 A;  1EHK B;  3QAP A;  4OV0 A;  1FBK A;  3M4C A;  3VVK A;  4MQS A;  3L1M A;  3FOP A;  4A4M A;  4CJO A;  2XLE A;  3NSB A;  1YYX A;  4LDE A;  5JRA A;  5JVE A;  1E12 A;  5JLI A;  1E85 A;  5H2N A;  1QM8 A;  3X3C A;  2I21 A;  5JJE A;  1CGO A;  4JR8 A;  1QKP A;  4JEB A;  5JS5 A;  3UTW A;  3VI0 A;  4BV0 A;  4J4Q A;  3QJU B;  2R4R A;  3AYN A;  2XM4 A;  1QKO A;  2Z73 A;  1S54 A;  2EI4 A;  4G72 B;  1M6T A;  2YL3 A;  5ETZ A;  4XTL A;  2NTW A;  3P0G A;  2NTU A;  1C8R A;  2AT9 A;  4GP8 B;  2KSB A;  1UCQ A;  3V2W A;  1S53 A;  4N4W A;  3DE9 A;  1JGJ A;  2Y04 A;  5G2A A;  5A44 A;  4CX9 A;  1R84 A;  1XME B;  3CAP A;  4PXK A;  5H2O A;  3VGA A;  3HNJ A;  3MBV A;  5JJN A;  4CDA A;  5AWZ A;  4CIP A;  5A8E A;  3S8F B;  2JAG A;  5C1M A;  3NS0 A;  1KGB A;  2QPE B;  3NMI A;  2XLO A;  1JV6 A;  1M0L A;  2J9B A;  4DAJ A;  1AT9 A;  1L9H A;  5JP7 A;  1KME A;  3HNK A;  1CGN A;  4AMJ A;  4QRY A;  5F8U A;  1BM1 A;  1A7V A;  3QVZ A;  1CWQ A;  4BEY A;  1R2N A;  5B35 A;  3RFM A;  1O0A A;  3C9M A;  5G53 A;  3UTV A;  4L6R A;  4XT3 A;  3S3B B;  5JJJ A;  4PXF A;  3M15 A;  5AHZ A;  4CDY A;  3M79 A;  4EIY A;  2XL6 A;  4N6H A;  4UG2 A;  1P8H A;  2QPD B;  4D4N A;  2KSY A;  3HNL A;  4BEZ A;  5JSL A;  1IXF A;  3TOM A;  1E0P A;  3QBI A;  4HYX A;  3PQR A;  4XXJ A;  5A45 A;  1E83 A;  1CPR A;  4XTN A;  5ITE A;  3RZE A;  2Y01 A;  5FJG A;  1KG8 A;  3UG9 A;  3OE9 A;  4TL3 A;  3IQ6 A;  4G71 B;  1MQV A;  2YL1 A;  2Y03 A;  4FAA B;  1C8S A;  4EJ4 A;  1LN6 A;  1CPQ A;  4GPO A;  1BBH A;  3UON A;  4LDL A;  5J7A A;  3T45 A;  3C63 A;  4MQT A;  4G7Q B;  2ZFE A;  3PWH A;  1X0S A;  5EN0 A;  2XLV A;  3ABW A;  4L35 A;  3QJQ B;  4LDO A;  2YCW A;  4AMI A;  3QVY A;  1QHJ A;  2XLD A;  1AP9 A;  3ZQV A;  3HNI A;  1IW9 A;  2KS9 A;  2YCZ A;  1JAF A;  1GQA A;  1H68 A;  1XJI A;  1YYJ A;  3TOL A;  4D4X A;  5H2I A;  3EH3 B;  1LM3 B;  3UTX A;  4GBR A;  4NC3 A;  1JFP A;  2F93 A;  4FPD A;  1YZA A;  1C3W A;  1U19 A;  1PXR A;  1F88 A;  3EH5 B;  3QBK A;  1NBB A;  3HAO A;  2L6X A;  4WGY A;  4ULV A;  2Z55 A;  2VT4 A;  3FOO A;  5AHY A;  3NMJ A;  1TN5 A;  3QJT B;  3A7K A;  1P8U A;  3BVD B;  4JE9 A;  3EH4 B;  3QBG A;  3NY9 A;  3S3C B;  5G2C A;  5AGF A;  2YL7 A;  1P8I A;  3NMK A;  4IB4 A;  1M0K A;  2I1X A;  3QJR B;  4FBZ A;  5B6X A;  3PDS A;  4JEA A;  3VG9 A;  1QPU A;  3C62 A;  1S51 A;  2YDV A;  3HAS A;  3NYA A;  2XLH A;  3ZPQ A;  1GZM A;  5B6V A;  4HWL A;  2X72 A;  4HYJ A;  2YL0 A;  1PY6 A;  3SN6 R;  3X3B A;  4U9E A;  1F50 A;  5DHH A;  4EA3 A;  2Y00 A;  4JKV A;  1VGO A;  5G2D A;  4GYC A;  4N4Y B;  4GP5 B;  4G7R B;  3EML A;  5B3I A;  2RH1 A;  4QID A;  2YLD A;  1TN0 A;  2J8W A;  3UZA A;  4BUO A;  3DQB A;  3V2Y A;  1BRX A;  5G54 A;  3QW0 A;  2XLM A;  1HZX A;  1JV7 A;  5G36 A;  2LNL A;  4BVN A;  4G70 B;  3WQJ A;  2KSA A;  3AYM A;  3KJ6 A;  1H2S A;  2YLG A;  1BRD A;  1S05 A;  3OE6 A;  5JUA A;  3OE8 A;  3D4S A;  1X0I 1;  2R4S A;  1UAZ A;  2M3G A;  5ITC A;  1VJM A;  3QW1 A;  2Y02 A;  3DDL A;  3ODU A;  5H2K A;  3S3D B;  3ZTZ A;  1Q5I A;  1XIO A;  5JT4 A;  4WAV A;  1YZC A;  3NY8 A;  3PBL A;  4IAR A;  4ER9 A;  4DJH A;  3ZQY A;  5DYS A;  1DZE A;  1QQ3 A;  1F4Z A;  3VHZ A;  2I20 A;  1FBB A;  3DE8 A;  3ZEV A;  1E84 A;  5H2H A;  1S8J A;  2ZIY A;  3HAQ A;  2CCY A;  1PXS A;  5H2M A;  5AX0 A;  3COD A;  4MD2 A;  1MGY A;  3U8P A;  2ZZL A;  4GP4 B;  4GRV A;  1KG9 A;  4IAQ A;  4MBS A;  3HAN A;  5H2L A;  3IQ5 A;  4WGZ A;  2YLI A;  3VRC A;  1EKY A;  3HAR A;  4QI1 A;  3C9L A;  5AZD A;  5B2N A;  2I35 A;  4XTO A;  3QDC A;  2F95 A;  3VW7 A;  2BC5 A;  4XT1 A;  5BR2 A;  5B34 A;  3QJS B;  4KLY A;  256B A;  5AX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...