4N4WA

Structure of the human smoothened receptor in complex with sant-1.
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
473
structure length
457
Chain Sequence
b'GGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSESKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQADCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b(562),Smoothened homolog
publication title Structural basis for Smoothened receptor modulation and chemoresistance to anticancer drugs.
pubmed doi rcsb
source organism Shigella flexneri 5 str. 8401
molecule tags Membrane protein, transport protein
total genus 186
structure length 457
sequence length 473
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n4wA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n4wA02
2YDVA 5ITEA 4GP8B 2YLDA 5B6YA 4BEYA 1KGBA 1VJMA 4GYCA 4G71B 4L6RA 1A7VA 5AX1A 1CPQA 3IQ5A 4AMJA 5AGFA 4XTNA 3QJRB 5H2PA 3S3CB 2PEDA 3VI0A 4GPOA 4DAJA 4FPDA 5A8EA 5H2MA 3V2YA 4IARA 3VRCA 4CDVA 1MQVA 2R4RA 4EA3A 2KSAA 1CPRA 3PDSA 2Y04A 3NMJA 1IXFA 3KJ6A 1XJIA 4JQ6A 1KMEA 1TN0A 1S8JA 3COCA 5EN0A 5JP7A 1UCQA 3HANA 4QRYA 3S3BB 2XLVA 1XIOA 4FBZA 3SN6R 4CDAA 3EMLA 2VT4A 4GP5B 3AYNA 4QIDA 2J4YA 3P0GA 5H2KA 3REYA 3U8PA 2CCYA 2YCXA 2I1XA 3ODUA 3QW0A 4G70B 1F50A 3AM6A 4XTLA 5A45A 4D4NA 4DJHA 2BC5A 4GP4B 1QHJA 2KSYA 2Y01A 3WQJA 2M3GA 1BBHA 3ZQYA 2XL6A 2XL8A 3VVKA 5C1MA 3HNJA 1M0LA 3QJUB 1M0KA 4MBSA 1F88A 3NMIA 3EH4B 3NMKA 2BRDA 3QJSB 3HASA 5H2JA 1Q5IA 3HAPA 4D4XA 1YZAA 1AT9A 3UG9A 4OV0A 1KG8A 2EI4A 4CDYA 5B6XA 4HWLA 2WJKA 5G54A 5JJNA 3ABWA 5JJEA 4MQTA 4N4WA 5B0WA 4WAVA 3HNIA 2Y03A 1S51A 4G7SB 4JEBA 1KG9A 5TGZA 5B34A 1E86A 4GBRA 4G7QB 1E85A 1JV6A 4AMIA 4ER9A 5JRAA 5DHHA 4CJGA 4ULVA 1FBKA 1S8LA 3QBGA 4IAQA 1GQAA 5A44A 4MQSA 1JV7A 2YKZA 5G2DA 1H68A 3QVZA 5H2LA 1H2SA 3ZPQA 1JFPA 256BA 3OE8A 1P8IA 2XM0A 4N6HA 2JAGA 3C63A 1IW6A 1MGYA 1U19A 1E12A 1PY6A 5FJGA 5B2NA 5B35A 3UTXA 4Y9HA 3NY8A 1AP9A 5AZDA 4BEZA 4JEAA 2L6XA 1DZEA 2WJLA 1CGOA 2R4SA 1LN6A 5B6ZA 5BR2A 2Y02A 1C3WA 3UTVA 3UTWA 2F93A 2XLEA 4U9EA 3ZWIA 3VW7A 3QW1A 2HPYA 5B3IA 1TN5A 2Y00A 2QPDB 4GRVA 3ZPRA 1F4ZA 2XLOA 5DHGA 2ZZLA 3UZCA 3HAOA 1HZXA 4HYJA 2YL3A 3FOPA 5H2HA 3QJQB 1PXRA 1S53A 1YZCA 3BVDB 5DYSA 5LWEA 2ZIYA 5JT4A 4TL3A 3OAXA 4KLYA 3OE9A 2KSBA 3X3BA 1CGNA 3L1MA 4L35A 2QPEB 1BRXA 2G87A 3OE6A 5G2AA 3X3CA 4WW3A 2KS9A 1S54A 3QAKA 1R84A 2ZFEA 3NS0A 3PWHA 4WGZA 3FOOA 1GZMA 2LNLA 3M15A 4FAAB 3ZEVA 4G7RB 1XMEB 3M79A 2J9BA 1L0MA 5JS5A 5H2OA 4XXJA 1M6TA 2YCYA 1L9HA 1E0PA 1O0AA 1QM8A 4G72B 2YL0A 2RH1A 2NTWA 2Z55A 4QI1A 4JKVA 4X32A 3S8GB 3QJTB 5JVEA 4PXFA 1GUEA 3HNLA 1X0I1 2YCWA 1P8HA 3DQBA 4DKLA 3ZQVA 3T45A 1C8SA 4PXKA 4A4MA 2Z73A 4JE9A 1E83A 4BWBA 3QBLA 3RFMA 1BRDA 1P8UA 3A7KA 5AWZA 4BVNA 2F95A 4UHRA 2XLHA 3CAPA 4NC3A 5G36A 3QAPA 3S3DB 1RCPA 2YL7A 3HARA 4LDEA 1JAFA 4EIYA 2YCZA 3ZTZA 3MBVA 4CIPA 5G28A 2YLIA 3AYMA 5AX0A 5H2IA 1M0MA 1C8RA 4CX9A 3QBIA 5BR5A 3DDLA 3PXOA 4JR8A 5AHYA 3VGAA 1BM1A 4BUOA 3EH3B 2YLGA 4MD2A 3QJVB 4XT3A 3IQ6A 2AT9A 3RZEA 1E84A 5JLIA 3OE0A 5AHZA 2I20A 2I21A 1APCA 1S52A 1BRRA 5F8UA 4BV0A 1QKPA 3C9LA 3C62A 1EHKB 5H2NA 1X0K1 1NBBA 5ETZA 3DE9A 2NTUA 5KKHA 1EKYA 1UAZA 1LM3B 3M4CA 1GU8A 1IW9A 5JJJA 1YYXA 1Q5JA 5JSLA 1CWQA 4MD1A 3TOMA 1JGJA 3DE8A 2X72A 5G2CA 3NY9A 3NYAA 2I35A 5ITCA 3UTYA 5J7AA 4HYXA 3CODA 4KNFA 5B6VA 3VHZA 4IB4A 3PQRA 3EH5B 3PBLA 3D4SA 1R2NA 4K5YA 3C9MA 2XLWA 3ZTMA 3M4BA 1PXSA 3TOLA 4X31A 2YDOA 2YL1A 2XM4A 4EJ4A 3QDCA 4U9DA 1VGOA 2JAFA 2XLMA 1QQ3A 3NSBA 4WGYA 4LDOA 1YYJA 4X1HA 3UONA 5JUAA 2QLAA 5B6WA 5G53A 4LDLA 2XLDA 4XTOA 1FBBA 3UZAA 3HAQA 3HNKA 3S8FB 2J8WA 1QKOA 4XT1A 3QVYA 4FA7B 4CJOA 1S05A 1X0SA 4UG2A 4N4YB 1QPUA 3VG9A 3QBKA 4J4QA 3V2WA
chains in the Genus database with same CATH superfamily
1SZIA 1SF8A 5ITEA 4BEYA 2Q7RA 2DYRC 3N0TA 3QZCA 3QJRB 5H2PA 3ABKC 2GA0A 2FGYA 4MTGA 1ZW2A 2EILC 1QZXA 4G7OF 4GPOA 2J9WA 4ANJA 2B0HA 1G5ZA 2R4RA 1Z5ZA 1R5ID 1TWAA 3W8IA 4Z9IA 3RQFA 3PDSA 3JCUQ 2Y04A 3DXJF 3SXKA 1S8JA 3COCA 5EN0A 4MQ9F 2A69F 4CIHA 1N1CA 3SZRA 3S3BB 4E0HA 3F47A 2XLVA 5L3VA 4EHPA 3SN6R 1MNDA 4GP5B 2A0UA 2GFHA 3AYNA 2WZFA 1EI7A 3O10A 2ZD9A 2CCYA 3K33A 2YCXA 3EJNA 2Y39A 3UGPA 4G70B 1UFBA 1F50A 4D4NA 3NDBB 4GP4B 3JSZA 1ZYRF 3SYNA 2KSYA 2Y01A 3RQEA 4CS8C 3RQGA 4NY3A 2L6FA 1V55C 3ZQYA 2XL8A 4FESA 1RKEA 4PFOA 4BJ6A 4MBSA 2Y3HA 1KNYA 1C02A 2XL4A 3HASA 1ST6A 3JZ0A 1OXBA 1QKRA 5B6XA 4HWLA 2HS5A 4GYTA 3POVA 1WATA 4N4WA 3V7OA 4P9TA 1MMGA 3HNIA 1HE9A 2Y03A 4G7SB 4JEBA 3AGTA 5E3CA 1KG9A 3C8GA 2QNLA 5TJ5E 4BPMA 4KNWA 1E85A 2L6HA 4CS9C 2W45A 4ER9A 2JX0A 1T6IA 3GM1A 3QBGA 3FAPB 1TKNA 4FAPB 1JFPA 1P8IA 5KYYB 3U0CA 1EQ1A 3RF3A 4RDAA 1W2WA 2G3KA 5EGYA 3EG9A 2HJMA 3UTXA 3NY8A 3SXZA 4JEAA 3ASOC 4EKWA 2NUTB 1ZVZA 2R7SA 3V5XA 3UTVA 3UTWA 2F93A 3FVYA 2QE9A 3KKBA 5B3IA 2KSFA 4U5CE 4MVOA 1TN5A 2QPDB 2Q9CA 2H7OA 2J9UA 3AQCA 3SXMA 2BL2A 4NQFA 5DHGA 2ZZLA 3UZCA 4I44A 3HAOA 4ULWA 3U2MA 2HSQA 3FOPA 3L34A 4CSAA 4PJJA 3S0XA 1YZCA 4YT4A 4C3BA 5L0FA 3WAQA 2YRFA 2ZIYA 3EGDA 3RYLA 2J7PA 2KSBA 4J7TA 3BRJA 3I4UA 4XWJA 3UR3C 3L1MA 1NFNA 2G87A 1D1BA 2KS9A 1R84A 4QI0A 2ZFEA 3FOOA 3EZIA 5GPGB 5DQTA 2Y3DA 1TQGA 2M4EA 2J9BA 1D1AA 4MNDA 2R25A 2YHSA 1MMAA 1OKKA 2J7PD 2Z55A 4QI1A 4JKVA 4H4KC 5DS4A 4AE4B 2YWAA 1T6UA 3B0PA 3DQBA 1OCRC 1OW7A 1NG1A 4A4MA 1TWHA 1ZHYA 3ABMC 4G78A 1FMWA 4MVSA 3OA1A 2IXOA 4E7ZA 2VCBA 1H9GA 1OKKD 1RKEB 3AGUA 4XLPF 5A6JA 4UHRA 3SP1A 4XPYA 2WB7A 2VCAA 1RCPA 2YL7A 3PMRA 3HARA 2WZGA 2D5RB 1IW7F 5B1BC 2I15A 3HKKA 1J8MF 5G28A 2XRHA 2A6EF 2YLIA 2L9JA 3T6BA 5L0DA 2V3CC 2HFIA 2DI3A 4DRHB 1M0MA 4CX9A 4DRJB 3QBIA 1B68A 4ONSA 4OIRF 5BR5A 4JR8A 3C8GB 2OU6A 3VAYA 2WVNA 4JJFA 2AT9A 3AG1C 3DM9B 1YA9A 5KYWA 2HKVA 2I21A 3U9MA 1S52A 2DYSC 5H2NA 1VYKA 5ETZA 4OIOF 3NYJA 3U9JA 1EKYA 3EHMA 1IW9A 5DLJA 1OXKA 3EG9B 1Q5JA 4BJ5C 5DS6A 3DI5A 1JGJA 5DQZA 2X72A 3IHUA 3CSKA 5G2CA 3X2QC 2IYLD 3VHZA 4JVSA 3PQRA 3EPVA 1FTSA 4JRZA 3EH5B 3PBLA 3WODF 1A7DA 4K5YA 2XLWA 1Q0FA 2M64A 4YK5A 3RW0A 2Q9AA 4EJ4A 2A6HF 3QDCA 4JW1A 3FDQA 2JAFA 3U8VA 5JUAA 4PR9A 1U89A 3LNMB 4YL1A 5G53A 2G3VA 2XLDA 1XZPA 4U5DE 3PCVA 3EGDB 3HAQA 3HNKA 2J46A 4N6CA 2AU5A 4CJOA 1S05A 3DM5A 1JRAA 2Q9BA 3GEHA 2CNWD 5K0IA 1T01A 4CS7A 2YLDA 5B6YA 4E17A 4G71B 4MTOA 2AVKA 1JPJA 1CPQA 3LS1A 3S27A 4XTKA 3VI0A 4FPDA 1QSPA 3V2YA 2KGOA 3IEEA 3JYHA 3JRMO 3GODA 1QVXA 4XPXA 3AQBA 1TFOB 2KSAA 3NMJA 1VOMA 4JQ6A 5B1AC 1KMEA 3Q7LA 4NTFA 3HANA 3KYJA 4QRYA 5COGA 3ZSUA 3ZG1A 1XIOA 3O55A 3DMDA 3ZDLA 1FMVA 4CDAA 3EMLA 2XXAB 5T3TA 3RKOF 3P0GA 3REYA 3U8PA 5D92A 1HE1A 2LQGA 3ODUA 3QW0A 1E2XA 4XTLA 3B71A 5KYWB 3WQJA 1C17M 1LIHA 5A6BD 2E87A 1VTMP 2JPUA 3VVKA 5C1MA 1M0LA 3QJUB 1F88A 3NMKA 2L81A 5H2JA 1BR4A 5KYUA 1Q5IA 4D4XA 2WVOA 4DRIB 3UG9A 4OV0A 3TK0A 1XZQA 1GM5A 4Q4ZF 4J7YA 5B0WA 1DOVA 1RKCA 2PBEA 4IWBA 2QY9A 5E33A 1L3PA 5TGZA 1WWPA 2PX0A 3NYLA 2OG2A 4CS8A 4J32B 3LAYA 3LNRA 1HMDA 3G4XA 4JJGA 2EPKX 4FWVA 4CJGA 4ULVA 1S8LA 2VC9A 5A44A 5G2DA 3QVZA 1NLXA 2Y3GA 3TQOA 256BA 4OIPF 4AX2A 1IW6A 1U19A 1FAPB 1ZHXA 4Y9HA 1FFTC 1H9TA 2EPMX 1AP9A 2B0JA 4BEZA 3I5PA 2R9RB 2WJLA 3GEIA 5BR2A 2Y02A 4NTAA 4ZLCA 4QDLA 4MVQA 1C3WA 2PNOA 2XLEA 2KC3A 3VW7A 3QW1A 4YJWA 2ICWG 4CS9A 4C7OA 1O5HA 2XLOA 2MYSA 3R2PA 4OIQF 3VF0A 3JSEO 1AUEA 3JRTA 2YL3A 2OKUA 2TMVP 3QJQB 1ORSC 4IGGA 1WTYA 5LWEA 4DXWA 4EWCA 5KYNA 4TL3A 4KLYA 2HJ3A 3H2UA 4OINF 4L35A 2HZ8A 5G2AA 3X3CA 4ZLDA 4WW3A 1S54A 3QAKA 3T9OA 3DJNB 3RFYA 4FAAB 4HEAJ 4G7RB 4O79A 3W4YA 5JS5A 3C7JA 5FZTA 3AG2C 4UDVA 2R7VA 2YCYA 1Z6AA 5BQIA 1E0PA 2EIKC 2ZXOA 1ZW3A 3LEVA 3R7CA 1GUEA 2I8BA 2YCWA 4O6YA 4Q5SF 2WL8A 4JE9A 1OR3A 5E2QA 1P8UA 5AWZA 3FXHA 2F95A 2XLHA 3LUTB 4NC3A 4MW8A 4EBBA 3S90A 5KYUB 4LDEA 2XSEA 1Q0MA 5HSWA 1Z7Qc 4CIPA 1VYIA 5E3AA 2KK1A 3TJ6A 4NTBA 2ZXWC 2R03A 2P1AA 3PXOA 5KYXA 1ZU4A 3EFOA 1OCOC 4R32A 4XT3A 2CGEA 3T6GB 2ASRA 3NG1A 2CYDA 3IQ6A 1T5OA 5BQGA 2W9YA 5JLIA 5AHZA 2I20A 3TJ5A 3ECSA 3GORA 1APCA 4BV0A 1QKPA 4G0HA 4YT8A 2NTUA 5CI8A 1G4US 4PJLA 1LM3B 2R7RA 3ATPA 4XPWA 1NU9C 1YYXA 3K1HA 1CWQA 3DE8A 3G4ZA 1JPNA 2C04A 2I35A 4LDKA 5J7AA 4HYXA 3A11A 4KNFA 1WOLA 4NCQA 3K7DA 4JTDB 2CW0F 3UNGC 1R2NA 2P6VA 3M4BA 4X31A 4C7OB 2DB4A 1V74B 2YL1A 1JR8A 1ZU5A 3ABLC 4PJMA 1A0BA 3LS0A 3LEOA 2XLMA 3WG7C 4LDOA 1WASA 4PFPA 4BJTA 2QLAA 4RD9A 1JOGA 4BEMJ 1D0XA 2LCHA 2JD3A 4RBNA 4BJ5A 3JTLO 1QKOA 3CAXA 5EK0A 1DOWA 2HSBA 1I4ZA 1QPUA 3ZIBA 1A41A 3VG9A 2YDVA 5CI9A 4GP8B 1TWCA 4GYCA 1LI5A 3DZAA 1A7VA 1LS1A 4AMJA 4XTNA 3S3CB 2PEDA 2WZLA 4DJ9A 1BZ4A 1R4TA 5A8EA 5H2MA 2R7UA 4Z9JA 3B9QA 4CDVA 3MFNA 1VB5A 1CPRA 4K0DA 1IXFA 3Q6NA 1TN0A 1Y4CA 4DBRA 1Z23A 2Y69C 3C18A 4O6NA 3W2VA 3B0VC 4O7GA 4FBZA 2R02A 2PF4E 2EINC 1M2VA 3CQZA 2KYHA 2VT4A 1KTMA 4P9FA 5T1DB 1K04A 4QIDA 3AG4C 2J4YA 1LE2A 1GS9A 4AK9A 2DGJA 5KYXB 3EFOB 3K1IC 2H7VC 5A45A 4DJHA 4QI2A 4E0IA 2M3GA 2V26A 3ASNC 2XL6A 3NYMA 3GANA 2VASA 4CBEA 5A69A 2Z15A 3EH4B 3K6BA 2BRDA 3QJSB 2UUHA 2CNWA 4AL1A 1KG8A 2R7OA 3T6JA 4CDYA 3GM2A 2NSGA 4HFFB 4K1OA 3V5YA 3S9OA 3CZ6A 1U0BB 1NFOA 4MQTA 1LE4A 3VM6A 4XLNF 3MYFA 5L0GA 2OCCC 2NUPA 1S51A 3UGOA 2Q3TA 1O3UA 4GBRA 4M63A 4G7QB 3T4RA 3U3BA 1JV6A 4AMIA 1BR1A 1I5NA 4U5HA 4IAOA 1GQAA 4JURI 3S29A 2YKZA 1H68A 1VK5A 3ITFA 1S7ZA 1L7CA 4N6HA 3C63A 3U5SA 1E12A 1AVOB 2EIMC 4LLCA 2L6XA 1DZEA 2NPUA 3H65A 1CGOA 2R4SA 1LN6A 3KMIA 1HY5A 2LK4A 3EQLF 1YA7O 3FAJA 4KBLA 4MW3A 2NSFA 2HPYA 3RVZA 1UG7A 2FAPB 5A6BA 2FFHA 2G62A 3AOUA 3ZPRA 1F4ZA 3NKEA 4XEVA 4IRUA 2QTVA 4MTFA 5H2HA 1Z3IX 2A1DD 3U3FA 1V4AA 3N2ZB 5DYSA 1K40A 4JCZA 3OE9A 3X3BA 4I3MA 3OE6A 2IOQA 1AEPA 3GWLA 3NS0A 4KC9A 1GZMA 4U5BE 2LNLA 3M15A 1M2VB 1D1CA 4DBQA 4OD5A 1XMEB 2RSEB 1L0MA 2A68F 5H2OA 4XXJA 1M56C 1M6TA 5AC4A 1L9HA 1O0AA 1C03A 2AP3A 2NTWA 3S28A 3HNLA 4K7BA 1SYQA 1X0I1 3HJCA 4DKLA 1C8SA 2LFDA 2LIGA 2Z73A 1K05A 3DAFA 4B6IA 1E83A 1M57C 3RFMA 4EBJA 4G7HF 1SMYF 4BVNA 2R7TA 3CAPA 3US6A 2ETSA 1T6QA 5G36A 3QAPA 3S3DB 3MLGA 4MVRA 4IJJA 1KU2A 1JAFA 4EIYA 4MVUA 2L7AA 4YN0B 4N06A 1RMVA 1C8RA 1WGWA 3IPMO 3SEOA 1BDJB 2NUPB 2R7XA 4BUOA 4MD2A 1Q0DA 1Q0KA 4DVZA 3U2LA 3KL4A 3BEHA 5D91A 2KNHA 2W4MA 4EBKA 2OJQA 5COFA 4X0RA 1H6GA 1BRRA 3C9LA 3C62A 2R05A 4LLEA 1X0K1 2D4UA 1BR2A 4P6IC 1VMAA 3DE9A 1NZEA 3QTHA 1UAZA 2YVKA 5L3QA 3M4CA 1IZMA 3KH2A 5CIVA 3J06A 2EPLX 5F28E 2OEVA 3TOMA 3LESA 2XS8A 5A6KA 1G8XA 3NYAA 3Q7GA 3RIPA 5ITCA 1VLTA 3UTYA 4AL0A 4AE4A 1HW2A 2KJGA 2HV7A 5L0JA 3NKDA 3MBGA 3D4SA 3G50A 5A6AA 3OWTA 3GWNA 3E9VA 3ZTMA 1PXSA 1OW8A 2LP4A 1WN0A 5HV9A 3TULA 2OEXA 4U9DA 2OOCA 1VGOA 1PD1A 3FMSA 3NSBA 4Q7CA 2IBFA 1YYJA 1Z63A 1NSGB 5BUOA 3EHNA 4LDLA 1T9KA 2KQ9A 4XTOA 1YARO 2GDCA 4GQHA 3S84A 2J0XA 3S8FB 2F22A 4XT1A 3EGXA 4JZAA 3VYWA 1X0SA 4UG2A 1RXQA 2C03A 1TWGA 3FHDA 3W2WA 4FX5A 3QBKA 1LI7A 2AWCA 3LLKA 1YJGA 3V2WA 1RJ9A 1KGBA 5DVWA 1VJMA 3Q6MA 4A2NB 4L6RA 5AX1A 1YAUO 3IQ5A 5AGFA 4DAJA 3HLZA 1YLMA 3C8GD 3SXYA 2X0CA 4IARA 3VRCA 1MQVA 4W8KA 2R7QA 4EA3A 3DJUB 1OQCA 4BJ6C 3KJ6A 1XJIA 3JT1A 5JP7A 1UCQA 4JCHA 2CDQA 3LLIA 4JTCB 5F5FA 2IM8A 2H8AA 1YDIA 5H2KA 5F5HA 2I1XA 2A0BA 3AM6A 3UMKA 5DS5A 2BC5A 1QHJA 1NU7D 3SNHA 3H2VA 1BBHA 2LSEA 2H7BA 1ORYA 3W8HA 3L8IA 3HNJA 4G7ZF 1M0KA 3NMIA 4Z9HA 3MX3A 3HAPA 1AT9A 1YZAA 2IXMA 2J45A 1MNEA 1ORJA 5BQHA 1U6HA 2BE5F 2LD6A 5B3SC 2EI4A 4O6MA 4GEHA 2WJKA 2Q00A 5G54A 3N24A 5JJNA 3ABWA 5JJEA 4JC7A 4HE8D 1FR0A 4KNVA 2YZSA 4WAVA 2GWWA 2MHRA 3PHF2 4I1OB 4I1MA 3K1IA 1F1MA 5B34A 2EPNA 1E86A 4YT5A 2ZPAA 4YL3A 3C8ZA 3RH3A 2X51A 5JRAA 5DHHA 1FBKA 4IAQA 2J0WA 4MQSA 1JV7A 1HMOA 1OCZC 5H2LA 4CSAC 1H2SA 3ZPQA 4DOZA 3OE8A 2XM0A 2JAGA 1ZHZA 2R7WA 4PACA 2XXAA 1MGYA 1PY6A 5FJGA 5B2NA 2QUPA 5B35A 3EGXB 5AZDA 3O6XA 3CEXA 5B6ZA 3DAGA 4JTAB 4J30B 4JIOA 4OD4A 1JMWA 4U9EA 2GAQA 3ZWIA 1RJ9B 3X1OA 5L0HA 2L6GA 5FCLA 1QLEC 3V5ZA 2Y00A 3KPHA 4GRVA 1HW1A 2HV6A 1O87A 3F46A 3LJBA 3K66A 2EIJC 3PDMP 4BJ1A 3DKAA 3IQCA 1LKXA 5L0CA 2Y3BA 3JYYA 1H7IA 4C3EA 1HZXA 4HYJA 3L8JA 1PXRA 4U5GA 5IY5C 4MS2A 3A9CA 1S53A 1ZHWA 2VB6A 3BVDB 5JT4A 3OAXA 2YQYA 3O39A 1CGNA 2QPEB 1VLSA 1BRXA 3B0UX 2ZXPA 2IXPA 3PWHA 4WGZA 2NG1A 2O9XA 1GGQA 1EA8A 4W8PA 3DD7A 2HMQA 3WHNA 3ZEVA 1PCXA 1MMNA 1OCCC 1ZZPA 3M79A 1YVIA 1MMDA 1LPEA 1OR2A 1QM8A 4G72B 2YL0A 2RH1A 2KW3C 4X32A 3S8GB 3QJTB 5JVEA 3KYIA 4PXFA 2P7VA 2IXNA 1TFKB 1P8HA 3OEOA 5EHHA 3ZQVA 3T45A 1A7EA 2ZXRA 4PXKA 4XEKA 4BG0A 2AWYA 4BWBA 3AG3C 3QBLA 3EZHA 3M1CB 4MVZA 1BRDA 1PD0A 3A7KA 1XWJA 4XEFA 3EH2A 1FFHA 4EUKB 4YWQA 3GEEA 2OJED 4LACB 3ZC4A 4YL0A 3MYIA 1D0YA 2P0NA 2YCZA 3UMHA 3ZTZA 1J8YF 1SR2A 3MBVA 4WJ0A 2RD9A 4MVMA 1Q0GA 3AYMA 5AX0A 2LFFA 5H2IA 3GM3A 1G4WR 1D0ZA 3TD7A 3L0IA 4PJNA 3DDLA 2MWQA 5AHYA 3VGAA 1BM1A 3EH3B 2YLGA 3QJVB 5T3WA 3RZEA 1E84A 3OE0A 1ZHTA 5L0IA 2W4BA 5F8UA 3ZVRA 4HFKB 4LDQA 1EHKB 4F4BA 1NBBA 4E7SA 4LDRA 5KKHA 1LVKA 1GU8A 2YEVA 3AJMA 5JJJA 2XS1A 4KI2A 4E18A 5JSLA 4MD1A 3IQTA 4U5EE 2J9VA 1M2OA 3NY9A 4A4AA 3CODA 2HUJA 2Q4FA 2VCCA 2P61A 5B6VA 2PP4A 4IB4A 3HTKC 1PV3A 1FNTc 3C9MA 3B29A 1TR2A 3TOLA 1V54C 2YDOA 2XM4A 4LERA 3NRHA 5AC5A 2VH3A 4PK4A 2OQMA 3QMKA 4H54A 4YT2A 4XQ1A 2HMZA 1QQ3A 1I4YA 4WGYA 3RVYA 3EH1A 4C3DA 2UUIA 4X1HA 3UONA 2PX3A 5B6WA 4BEJA 3DWWA 3E70C 1OW6A 1Y6DA 2PFDA 4U5FE 5KYYA 1FBBA 3UZAA 4DS7E 2J8WA 3QVYA 4FA7B 3UMIA 5COMA 4DVYP 4WABA 2WVQA 1CGME 4N4YB 3I5QA 2NUTA 4J4QA 2EPOA 1LS4A
chains in the Genus database with same CATH topology
2YDVA 5ITEA 4GP8B 2YLDA 5B6YA 4BEYA 1KGBA 1VJMA 4GYCA 4G71B 4L6RA 1A7VA 5AX1A 1CPQA 3IQ5A 4AMJA 5AGFA 4XTNA 3QJRB 5H2PA 3S3CB 2PEDA 3VI0A 4GPOA 4DAJA 4FPDA 5A8EA 5H2MA 3V2YA 4IARA 3VRCA 4CDVA 1MQVA 2R4RA 4EA3A 2KSAA 1CPRA 3PDSA 2Y04A 3NMJA 1IXFA 3KJ6A 1XJIA 4JQ6A 1KMEA 1TN0A 1S8JA 3COCA 5EN0A 5JP7A 1UCQA 3HANA 4QRYA 3S3BB 2XLVA 1XIOA 4FBZA 3SN6R 4CDAA 3EMLA 2VT4A 4GP5B 3AYNA 4QIDA 2J4YA 3P0GA 5H2KA 3REYA 3U8PA 2CCYA 2YCXA 2I1XA 3ODUA 3QW0A 4G70B 1F50A 3AM6A 4XTLA 5A45A 4D4NA 4DJHA 2BC5A 4GP4B 1QHJA 2KSYA 2Y01A 3WQJA 2M3GA 1BBHA 3ZQYA 2XL6A 2XL8A 3VVKA 5C1MA 3HNJA 1M0LA 3QJUB 1M0KA 4MBSA 1F88A 3NMIA 3EH4B 3NMKA 2BRDA 3QJSB 3HASA 5H2JA 1Q5IA 3HAPA 4D4XA 1YZAA 1AT9A 3UG9A 4OV0A 1KG8A 2EI4A 4CDYA 5B6XA 4HWLA 2WJKA 5G54A 5JJNA 3ABWA 5JJEA 4MQTA 4N4WA 5B0WA 4WAVA 3HNIA 2Y03A 1S51A 4G7SB 4JEBA 1KG9A 5TGZA 5B34A 1E86A 4GBRA 4G7QB 1E85A 1JV6A 4AMIA 4ER9A 5JRAA 5DHHA 4CJGA 4ULVA 1FBKA 1S8LA 3QBGA 4IAQA 1GQAA 5A44A 4MQSA 1JV7A 2YKZA 5G2DA 1H68A 3QVZA 5H2LA 1H2SA 3ZPQA 1JFPA 256BA 3OE8A 1P8IA 2XM0A 4N6HA 2JAGA 3C63A 1IW6A 1MGYA 1U19A 1E12A 1PY6A 5FJGA 5B2NA 5B35A 3UTXA 4Y9HA 3NY8A 1AP9A 5AZDA 4BEZA 4JEAA 2L6XA 1DZEA 2WJLA 1CGOA 2R4SA 1LN6A 5B6ZA 5BR2A 2Y02A 1C3WA 3UTVA 3UTWA 2F93A 2XLEA 4U9EA 3ZWIA 3VW7A 3QW1A 2HPYA 5B3IA 1TN5A 2Y00A 2QPDB 4GRVA 3ZPRA 1F4ZA 2XLOA 5DHGA 2ZZLA 3UZCA 3HAOA 1HZXA 4HYJA 2YL3A 3FOPA 5H2HA 3QJQB 1PXRA 1S53A 1YZCA 3BVDB 5DYSA 5LWEA 2ZIYA 5JT4A 4TL3A 3OAXA 4KLYA 3OE9A 2KSBA 3X3BA 1CGNA 3L1MA 4L35A 2QPEB 1BRXA 2G87A 3OE6A 5G2AA 3X3CA 4WW3A 2KS9A 1S54A 3QAKA 1R84A 2ZFEA 3NS0A 3PWHA 4WGZA 3FOOA 1GZMA 2LNLA 3M15A 4FAAB 3ZEVA 4G7RB 1XMEB 3M79A 2J9BA 1L0MA 5JS5A 5H2OA 4XXJA 1M6TA 2YCYA 1L9HA 1E0PA 1O0AA 1QM8A 4G72B 2YL0A 2RH1A 2NTWA 2Z55A 4QI1A 4JKVA 4X32A 3S8GB 3QJTB 5JVEA 4PXFA 1GUEA 3HNLA 1X0I1 2YCWA 1P8HA 3DQBA 4DKLA 3ZQVA 3T45A 1C8SA 4PXKA 4A4MA 2Z73A 4JE9A 1E83A 4BWBA 3QBLA 3RFMA 1BRDA 1P8UA 3A7KA 5AWZA 4BVNA 2F95A 4UHRA 2XLHA 3CAPA 4NC3A 5G36A 3QAPA 3S3DB 1RCPA 2YL7A 3HARA 4LDEA 1JAFA 4EIYA 2YCZA 3ZTZA 3MBVA 4CIPA 5G28A 2YLIA 3AYMA 5AX0A 5H2IA 1M0MA 1C8RA 4CX9A 3QBIA 5BR5A 3DDLA 3PXOA 4JR8A 5AHYA 3VGAA 1BM1A 4BUOA 3EH3B 2YLGA 4MD2A 3QJVB 4XT3A 3IQ6A 2AT9A 3RZEA 1E84A 5JLIA 3OE0A 5AHZA 2I20A 2I21A 1APCA 1S52A 1BRRA 5F8UA 4BV0A 1QKPA 3C9LA 3C62A 1EHKB 5H2NA 1X0K1 1NBBA 5ETZA 3DE9A 2NTUA 5KKHA 1EKYA 1UAZA 1LM3B 3M4CA 1GU8A 1IW9A 5JJJA 1YYXA 1Q5JA 5JSLA 1CWQA 4MD1A 3TOMA 1JGJA 3DE8A 2X72A 5G2CA 3NY9A 3NYAA 2I35A 5ITCA 3UTYA 5J7AA 4HYXA 3CODA 4KNFA 5B6VA 3VHZA 4IB4A 3PQRA 3EH5B 3PBLA 3D4SA 1R2NA 4K5YA 3C9MA 2XLWA 3ZTMA 3M4BA 1PXSA 3TOLA 4X31A 2YDOA 2YL1A 2XM4A 4EJ4A 3QDCA 4U9DA 1VGOA 2JAFA 2XLMA 1QQ3A 3NSBA 4WGYA 4LDOA 1YYJA 4X1HA 3UONA 5JUAA 2QLAA 5B6WA 5G53A 4LDLA 2XLDA 4XTOA 1FBBA 3UZAA 3HAQA 4DS7E 3HNKA 3S8FB 2J8WA 1QKOA 4XT1A 3QVYA 4FA7B 4CJOA 1S05A 1X0SA 4UG2A 4N4YB 1QPUA 3VG9A 3QBKA 4J4QA 3V2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YDV A;  5ITE A;  4GP8 B;  2YLD A;  5B6Y A;  4BEY A;  1KGB A;  1VJM A;  4GYC A;  4G71 B;  4L6R A;  1A7V A;  5AX1 A;  1CPQ A;  3IQ5 A;  4AMJ A;  5AGF A;  4XTN A;  3QJR B;  5H2P A;  3S3C B;  2PED A;  3VI0 A;  4GPO A;  4DAJ A;  4FPD A;  5A8E A;  5H2M A;  3V2Y A;  4IAR A;  3VRC A;  4CDV A;  1MQV A;  2R4R A;  4EA3 A;  2KSA A;  1CPR A;  3PDS A;  2Y04 A;  3NMJ A;  1IXF A;  3KJ6 A;  1XJI A;  4JQ6 A;  1KME A;  1TN0 A;  1S8J A;  3COC A;  5EN0 A;  5JP7 A;  1UCQ A;  3HAN A;  4QRY A;  3S3B B;  2XLV A;  1XIO A;  4FBZ A;  3SN6 R;  4CDA A;  3EML A;  2VT4 A;  4GP5 B;  3AYN A;  4QID A;  2J4Y A;  3P0G A;  5H2K A;  3REY A;  3U8P A;  2CCY A;  2YCX A;  2I1X A;  3ODU A;  3QW0 A;  4G70 B;  1F50 A;  3AM6 A;  4XTL A;  5A45 A;  4D4N A;  4DJH A;  2BC5 A;  4GP4 B;  1QHJ A;  2KSY A;  2Y01 A;  3WQJ A;  2M3G A;  1BBH A;  3ZQY A;  2XL6 A;  2XL8 A;  3VVK A;  5C1M A;  3HNJ A;  1M0L A;  3QJU B;  1M0K A;  4MBS A;  1F88 A;  3NMI A;  3EH4 B;  3NMK A;  2BRD A;  3QJS B;  3HAS A;  5H2J A;  1Q5I A;  3HAP A;  4D4X A;  1YZA A;  1AT9 A;  3UG9 A;  4OV0 A;  1KG8 A;  2EI4 A;  4CDY A;  5B6X A;  4HWL A;  2WJK A;  5G54 A;  5JJN A;  3ABW A;  5JJE A;  4MQT A;  4N4W A;  5B0W A;  4WAV A;  3HNI A;  2Y03 A;  1S51 A;  4G7S B;  4JEB A;  1KG9 A;  5TGZ A;  5B34 A;  1E86 A;  4GBR A;  4G7Q B;  1E85 A;  1JV6 A;  4AMI A;  4ER9 A;  5JRA A;  5DHH A;  4CJG A;  4ULV A;  1FBK A;  1S8L A;  3QBG A;  4IAQ A;  1GQA A;  5A44 A;  4MQS A;  1JV7 A;  2YKZ A;  5G2D A;  1H68 A;  3QVZ A;  5H2L A;  1H2S A;  3ZPQ A;  1JFP A;  256B A;  3OE8 A;  1P8I A;  2XM0 A;  4N6H A;  2JAG A;  3C63 A;  1IW6 A;  1MGY A;  1U19 A;  1E12 A;  1PY6 A;  5FJG A;  5B2N A;  5B35 A;  3UTX A;  4Y9H A;  3NY8 A;  1AP9 A;  5AZD A;  4BEZ A;  4JEA A;  2L6X A;  1DZE A;  2WJL A;  1CGO A;  2R4S A;  1LN6 A;  5B6Z A;  5BR2 A;  2Y02 A;  1C3W A;  3UTV A;  3UTW A;  2F93 A;  2XLE A;  4U9E A;  3ZWI A;  3VW7 A;  3QW1 A;  2HPY A;  5B3I A;  1TN5 A;  2Y00 A;  2QPD B;  4GRV A;  3ZPR A;  1F4Z A;  2XLO A;  5DHG A;  2ZZL A;  3UZC A;  3HAO A;  1HZX A;  4HYJ A;  2YL3 A;  3FOP A;  5H2H A;  3QJQ B;  1PXR A;  1S53 A;  1YZC A;  3BVD B;  5DYS A;  5LWE A;  2ZIY A;  5JT4 A;  4TL3 A;  3OAX A;  4KLY A;  3OE9 A;  2KSB A;  3X3B A;  1CGN A;  3L1M A;  4L35 A;  2QPE B;  1BRX A;  2G87 A;  3OE6 A;  5G2A A;  3X3C A;  4WW3 A;  2KS9 A;  1S54 A;  3QAK A;  1R84 A;  2ZFE A;  3NS0 A;  3PWH A;  4WGZ A;  3FOO A;  1GZM A;  2LNL A;  3M15 A;  4FAA B;  3ZEV A;  4G7R B;  1XME B;  3M79 A;  2J9B A;  1L0M A;  5JS5 A;  5H2O A;  4XXJ A;  1M6T A;  2YCY A;  1L9H A;  1E0P A;  1O0A A;  1QM8 A;  4G72 B;  2YL0 A;  2RH1 A;  2NTW A;  2Z55 A;  4QI1 A;  4JKV A;  4X32 A;  3S8G B;  3QJT B;  5JVE A;  4PXF A;  1GUE A;  3HNL A;  1X0I 1;  2YCW A;  1P8H A;  3DQB A;  4DKL A;  3ZQV A;  3T45 A;  1C8S A;  4PXK A;  4A4M A;  2Z73 A;  4JE9 A;  1E83 A;  4BWB A;  3QBL A;  3RFM A;  1BRD A;  1P8U A;  3A7K A;  5AWZ A;  4BVN A;  2F95 A;  4UHR A;  2XLH A;  3CAP A;  4NC3 A;  5G36 A;  3QAP A;  3S3D B;  1RCP A;  2YL7 A;  3HAR A;  4LDE A;  1JAF A;  4EIY A;  2YCZ A;  3ZTZ A;  3MBV A;  4CIP A;  5G28 A;  2YLI A;  3AYM A;  5AX0 A;  5H2I A;  1M0M A;  1C8R A;  4CX9 A;  3QBI A;  5BR5 A;  3DDL A;  3PXO A;  4JR8 A;  5AHY A;  3VGA A;  1BM1 A;  4BUO A;  3EH3 B;  2YLG A;  4MD2 A;  3QJV B;  4XT3 A;  3IQ6 A;  2AT9 A;  3RZE A;  1E84 A;  5JLI A;  3OE0 A;  5AHZ A;  2I20 A;  2I21 A;  1APC A;  1S52 A;  1BRR A;  5F8U A;  4BV0 A;  1QKP A;  3C9L A;  3C62 A;  1EHK B;  5H2N A;  1X0K 1;  1NBB A;  5ETZ A;  3DE9 A;  2NTU A;  5KKH A;  1EKY A;  1UAZ A;  1LM3 B;  3M4C A;  1GU8 A;  1IW9 A;  5JJJ A;  1YYX A;  1Q5J A;  5JSL A;  1CWQ A;  4MD1 A;  3TOM A;  1JGJ A;  3DE8 A;  2X72 A;  5G2C A;  3NY9 A;  3NYA A;  2I35 A;  5ITC A;  3UTY A;  5J7A A;  4HYX A;  3COD A;  4KNF A;  5B6V A;  3VHZ A;  4IB4 A;  3PQR A;  3EH5 B;  3PBL A;  3D4S A;  1R2N A;  4K5Y A;  3C9M A;  2XLW A;  3ZTM A;  3M4B A;  1PXS A;  3TOL A;  4X31 A;  2YDO A;  2YL1 A;  2XM4 A;  4EJ4 A;  3QDC A;  4U9D A;  1VGO A;  2JAF A;  2XLM A;  1QQ3 A;  3NSB A;  4WGY A;  4LDO A;  1YYJ A;  4X1H A;  3UON A;  5JUA A;  2QLA A;  5B6W A;  5G53 A;  4LDL A;  2XLD A;  4XTO A;  1FBB A;  3UZA A;  3HAQ A;  3HNK A;  3S8F B;  2J8W A;  1QKO A;  4XT1 A;  3QVY A;  4FA7 B;  4CJO A;  1S05 A;  1X0S A;  4UG2 A;  4N4Y B;  1QPU A;  3VG9 A;  3QBK A;  4J4Q A;  3V2W A; 
#chains in the Genus database with same CATH topology
 1SZI A;  1SF8 A;  5ITE A;  4BEY A;  2Q7R A;  2DYR C;  3N0T A;  3QZC A;  3QJR B;  5H2P A;  3ABK C;  2GA0 A;  2FGY A;  4MTG A;  1ZW2 A;  2EIL C;  1QZX A;  4G7O F;  4GPO A;  2J9W A;  4ANJ A;  2B0H A;  1G5Z A;  2R4R A;  1Z5Z A;  1R5I D;  1TWA A;  3W8I A;  4Z9I A;  3RQF A;  3PDS A;  3JCU Q;  2Y04 A;  3DXJ F;  3SXK A;  1S8J A;  3COC A;  5EN0 A;  4MQ9 F;  2A69 F;  4CIH A;  1N1C A;  3SZR A;  3S3B B;  4E0H A;  3F47 A;  2XLV A;  5L3V A;  4EHP A;  3SN6 R;  1MND A;  4GP5 B;  2A0U A;  2GFH A;  3AYN A;  2WZF A;  1EI7 A;  3O10 A;  2ZD9 A;  2CCY A;  3K33 A;  2YCX A;  3EJN A;  2Y39 A;  3UGP A;  4G70 B;  1UFB A;  1F50 A;  4D4N A;  3NDB B;  4GP4 B;  3JSZ A;  1ZYR F;  3SYN A;  2KSY A;  2Y01 A;  3RQE A;  4CS8 C;  3RQG A;  4NY3 A;  2L6F A;  1V55 C;  3ZQY A;  2XL8 A;  4FES A;  1RKE A;  4PFO A;  4BJ6 A;  4MBS A;  2Y3H A;  1KNY A;  1C02 A;  2XL4 A;  3HAS A;  1ST6 A;  3JZ0 A;  1OXB A;  1QKR A;  5B6X A;  4HWL A;  2HS5 A;  4GYT A;  3POV A;  1WAT A;  4N4W A;  3V7O A;  4P9T A;  1MMG A;  3HNI A;  1HE9 A;  2Y03 A;  4G7S B;  4JEB A;  3AGT A;  5E3C A;  1KG9 A;  3C8G A;  2QNL A;  5TJ5 E;  4BPM A;  4KNW A;  1E85 A;  2L6H A;  4CS9 C;  2W45 A;  4ER9 A;  2JX0 A;  1T6I A;  3GM1 A;  3QBG A;  3FAP B;  1TKN A;  4FAP B;  1JFP A;  1P8I A;  5KYY B;  3U0C A;  1EQ1 A;  3RF3 A;  4RDA A;  1W2W A;  2G3K A;  5EGY A;  3EG9 A;  2HJM A;  3UTX A;  3NY8 A;  3SXZ A;  4JEA A;  3ASO C;  4EKW A;  2NUT B;  1ZVZ A;  2R7S A;  3V5X A;  3UTV A;  3UTW A;  2F93 A;  3FVY A;  2QE9 A;  3KKB A;  5B3I A;  2KSF A;  4U5C E;  4MVO A;  1TN5 A;  2QPD B;  2Q9C A;  2H7O A;  2J9U A;  3AQC A;  3SXM A;  2BL2 A;  4NQF A;  5DHG A;  2ZZL A;  3UZC A;  4I44 A;  3HAO A;  4ULW A;  3U2M A;  2HSQ A;  3FOP A;  3L34 A;  4CSA A;  4PJJ A;  3S0X A;  1YZC A;  4YT4 A;  4C3B A;  5L0F A;  3WAQ A;  2YRF A;  2ZIY A;  3EGD A;  3RYL A;  2J7P A;  2KSB A;  4J7T A;  3BRJ A;  3I4U A;  4XWJ A;  3UR3 C;  3L1M A;  1NFN A;  2G87 A;  1D1B A;  2KS9 A;  1R84 A;  4QI0 A;  2ZFE A;  3FOO A;  3EZI A;  5GPG B;  5DQT A;  2Y3D A;  1TQG A;  2M4E A;  2J9B A;  1D1A A;  4MND A;  2R25 A;  2YHS A;  1MMA A;  1OKK A;  2J7P D;  2Z55 A;  4QI1 A;  4JKV A;  4H4K C;  5DS4 A;  4AE4 B;  2YWA A;  1T6U A;  3B0P A;  3DQB A;  1OCR C;  1OW7 A;  1NG1 A;  4A4M A;  1TWH A;  1ZHY A;  3ABM C;  4G78 A;  1FMW A;  4MVS A;  3OA1 A;  2IXO A;  4E7Z A;  2VCB A;  1H9G A;  1OKK D;  1RKE B;  3AGU A;  4XLP F;  5A6J A;  4UHR A;  3SP1 A;  4XPY A;  2WB7 A;  2VCA A;  1RCP A;  2YL7 A;  3PMR A;  3HAR A;  2WZG A;  2D5R B;  1IW7 F;  5B1B C;  2I15 A;  3HKK A;  1J8M F;  5G28 A;  2XRH A;  2A6E F;  2YLI A;  2L9J A;  3T6B A;  5L0D A;  2V3C C;  2HFI A;  2DI3 A;  4DRH B;  1M0M A;  4CX9 A;  4DRJ B;  3QBI A;  1B68 A;  4ONS A;  4OIR F;  5BR5 A;  4JR8 A;  3C8G B;  2OU6 A;  3VAY A;  2WVN A;  4JJF A;  2AT9 A;  3AG1 C;  3DM9 B;  1YA9 A;  5KYW A;  2HKV A;  2I21 A;  3U9M A;  1S52 A;  2DYS C;  5H2N A;  1VYK A;  5ETZ A;  4OIO F;  3NYJ A;  3U9J A;  1EKY A;  3EHM A;  1IW9 A;  5DLJ A;  1OXK A;  3EG9 B;  1Q5J A;  4BJ5 C;  5DS6 A;  3DI5 A;  1JGJ A;  5DQZ A;  2X72 A;  3IHU A;  3CSK A;  5G2C A;  3X2Q C;  2IYL D;  3VHZ A;  4JVS A;  3PQR A;  3EPV A;  1FTS A;  4JRZ A;  3EH5 B;  3PBL A;  3WOD F;  1A7D A;  4K5Y A;  2XLW A;  1Q0F A;  2M64 A;  4YK5 A;  3RW0 A;  2Q9A A;  4EJ4 A;  2A6H F;  3QDC A;  4JW1 A;  3FDQ A;  2JAF A;  3U8V A;  5JUA A;  4PR9 A;  1U89 A;  3LNM B;  4YL1 A;  5G53 A;  2G3V A;  2XLD A;  1XZP A;  4U5D E;  3PCV A;  3EGD B;  3HAQ A;  3HNK A;  2J46 A;  4N6C A;  2AU5 A;  4CJO A;  1S05 A;  3DM5 A;  1JRA A;  2Q9B A;  3GEH A;  2CNW D;  5K0I A;  1T01 A;  4CS7 A;  2YLD A;  5B6Y A;  4E17 A;  4G71 B;  4MTO A;  2AVK A;  1JPJ A;  1CPQ A;  3LS1 A;  3S27 A;  4XTK A;  3VI0 A;  4FPD A;  1QSP A;  3V2Y A;  2KGO A;  3IEE A;  3JYH A;  3JRM O;  3GOD A;  1QVX A;  4XPX A;  3AQB A;  1TFO B;  2KSA A;  3NMJ A;  1VOM A;  4JQ6 A;  5B1A C;  1KME A;  3Q7L A;  4NTF A;  3HAN A;  3KYJ A;  4QRY A;  5COG A;  3ZSU A;  3ZG1 A;  1XIO A;  3O55 A;  3DMD A;  3ZDL A;  1FMV A;  4CDA A;  3EML A;  2XXA B;  5T3T A;  3RKO F;  3P0G A;  3REY A;  3U8P A;  5D92 A;  1HE1 A;  2LQG A;  3ODU A;  3QW0 A;  1E2X A;  4XTL A;  3B71 A;  5KYW B;  3WQJ A;  1C17 M;  1LIH A;  5A6B D;  2E87 A;  1VTM P;  2JPU A;  3VVK A;  5C1M A;  1M0L A;  3QJU B;  1F88 A;  3NMK A;  2L81 A;  5H2J A;  1BR4 A;  5KYU A;  1Q5I A;  4D4X A;  2WVO A;  4DRI B;  3UG9 A;  4OV0 A;  3TK0 A;  1XZQ A;  1GM5 A;  4Q4Z F;  4J7Y A;  5B0W A;  1DOV A;  1RKC A;  2PBE A;  4IWB A;  2QY9 A;  5E33 A;  1L3P A;  5TGZ A;  1WWP A;  2PX0 A;  3NYL A;  2OG2 A;  4CS8 A;  4J32 B;  3LAY A;  3LNR A;  1HMD A;  3G4X A;  4JJG A;  2EPK X;  4FWV A;  4CJG A;  4ULV A;  1S8L A;  2VC9 A;  5A44 A;  5G2D A;  3QVZ A;  1NLX A;  2Y3G A;  3TQO A;  256B A;  4OIP F;  4AX2 A;  1IW6 A;  1U19 A;  1FAP B;  1ZHX A;  4Y9H A;  1FFT C;  1H9T A;  2EPM X;  1AP9 A;  2B0J A;  4BEZ A;  3I5P A;  2R9R B;  2WJL A;  3GEI A;  5BR2 A;  2Y02 A;  4NTA A;  4ZLC A;  4QDL A;  4MVQ A;  1C3W A;  2PNO A;  2XLE A;  2KC3 A;  3VW7 A;  3QW1 A;  4YJW A;  2ICW G;  4CS9 A;  4C7O A;  1O5H A;  2XLO A;  2MYS A;  3R2P A;  4OIQ F;  3VF0 A;  3JSE O;  1AUE A;  3JRT A;  2YL3 A;  2OKU A;  2TMV P;  3QJQ B;  1ORS C;  4IGG A;  1WTY A;  5LWE A;  4DXW A;  4EWC A;  5KYN A;  4TL3 A;  4KLY A;  2HJ3 A;  3H2U A;  4OIN F;  4L35 A;  2HZ8 A;  5G2A A;  3X3C A;  4ZLD A;  4WW3 A;  1S54 A;  3QAK A;  3T9O A;  3DJN B;  3RFY A;  4FAA B;  4HEA J;  4G7R B;  4O79 A;  3W4Y A;  5JS5 A;  3C7J A;  5FZT A;  3AG2 C;  4UDV A;  2R7V A;  2YCY A;  1Z6A A;  5BQI A;  1E0P A;  2EIK C;  2ZXO A;  1ZW3 A;  3LEV A;  3R7C A;  1GUE A;  2I8B A;  2YCW A;  4O6Y A;  4Q5S F;  2WL8 A;  4JE9 A;  1OR3 A;  5E2Q A;  1P8U A;  5AWZ A;  3FXH A;  2F95 A;  2XLH A;  3LUT B;  4NC3 A;  4MW8 A;  4EBB A;  3S90 A;  5KYU B;  4LDE A;  2XSE A;  1Q0M A;  5HSW A;  1Z7Q c;  4CIP A;  1VYI A;  5E3A A;  2KK1 A;  3TJ6 A;  4NTB A;  2ZXW C;  2R03 A;  2P1A A;  3PXO A;  5KYX A;  1ZU4 A;  3EFO A;  1OCO C;  4R32 A;  4XT3 A;  2CGE A;  3T6G B;  2ASR A;  3NG1 A;  2CYD A;  3IQ6 A;  1T5O A;  5BQG A;  2W9Y A;  5JLI A;  5AHZ A;  2I20 A;  3TJ5 A;  3ECS A;  3GOR A;  1APC A;  4BV0 A;  1QKP A;  4G0H A;  4YT8 A;  2NTU A;  5CI8 A;  1G4U S;  4PJL A;  1LM3 B;  2R7R A;  3ATP A;  4XPW A;  1NU9 C;  1YYX A;  3K1H A;  1CWQ A;  3DE8 A;  3G4Z A;  1JPN A;  2C04 A;  2I35 A;  4LDK A;  5J7A A;  4HYX A;  3A11 A;  4KNF A;  1WOL A;  4NCQ A;  3K7D A;  4JTD B;  2CW0 F;  3UNG C;  1R2N A;  2P6V A;  3M4B A;  4X31 A;  4C7O B;  2DB4 A;  1V74 B;  2YL1 A;  1JR8 A;  1ZU5 A;  3ABL C;  4PJM A;  1A0B A;  3LS0 A;  3LEO A;  2XLM A;  3WG7 C;  4LDO A;  1WAS A;  4PFP A;  4BJT A;  2QLA A;  4RD9 A;  1JOG A;  4BEM J;  1D0X A;  2LCH A;  2JD3 A;  4RBN A;  4BJ5 A;  3JTL O;  1QKO A;  3CAX A;  5EK0 A;  1DOW A;  2HSB A;  1I4Z A;  1QPU A;  3ZIB A;  1A41 A;  3VG9 A;  2YDV A;  5CI9 A;  4GP8 B;  1TWC A;  4GYC A;  1LI5 A;  3DZA A;  1A7V A;  1LS1 A;  4AMJ A;  4XTN A;  3S3C B;  2PED A;  2WZL A;  4DJ9 A;  1BZ4 A;  1R4T A;  5A8E A;  5H2M A;  2R7U A;  4Z9J A;  3B9Q A;  4CDV A;  3MFN A;  1VB5 A;  1CPR A;  4K0D A;  1IXF A;  3Q6N A;  1TN0 A;  1Y4C A;  4DBR A;  1Z23 A;  2Y69 C;  3C18 A;  4O6N A;  3W2V A;  3B0V C;  4O7G A;  4FBZ A;  2R02 A;  2PF4 E;  2EIN C;  1M2V A;  3CQZ A;  2KYH A;  2VT4 A;  1KTM A;  4P9F A;  5T1D B;  1K04 A;  4QID A;  3AG4 C;  2J4Y A;  1LE2 A;  1GS9 A;  4AK9 A;  2DGJ A;  5KYX B;  3EFO B;  3K1I C;  2H7V C;  5A45 A;  4DJH A;  4QI2 A;  4E0I A;  2M3G A;  2V26 A;  3ASN C;  2XL6 A;  3NYM A;  3GAN A;  2VAS A;  4CBE A;  5A69 A;  2Z15 A;  3EH4 B;  3K6B A;  2BRD A;  3QJS B;  2UUH A;  2CNW A;  4AL1 A;  1KG8 A;  2R7O A;  3T6J A;  4CDY A;  3GM2 A;  2NSG A;  4HFF B;  4K1O A;  3V5Y A;  3S9O A;  3CZ6 A;  1U0B B;  1NFO A;  4MQT A;  1LE4 A;  3VM6 A;  4XLN F;  3MYF A;  5L0G A;  2OCC C;  2NUP A;  1S51 A;  3UGO A;  2Q3T A;  1O3U A;  4GBR A;  4M63 A;  4G7Q B;  3T4R A;  3U3B A;  1JV6 A;  4AMI A;  1BR1 A;  1I5N A;  4U5H A;  4IAO A;  1GQA A;  4JUR I;  3S29 A;  2YKZ A;  1H68 A;  1VK5 A;  3ITF A;  1S7Z A;  1L7C A;  4N6H A;  3C63 A;  3U5S A;  1E12 A;  1AVO B;  2EIM C;  4LLC A;  2L6X A;  1DZE A;  2NPU A;  3H65 A;  1CGO A;  2R4S A;  1LN6 A;  3KMI A;  1HY5 A;  2LK4 A;  3EQL F;  1YA7 O;  3FAJ A;  4KBL A;  4MW3 A;  2NSF A;  2HPY A;  3RVZ A;  1UG7 A;  2FAP B;  5A6B A;  2FFH A;  2G62 A;  3AOU A;  3ZPR A;  1F4Z A;  3NKE A;  4XEV A;  4IRU A;  2QTV A;  4MTF A;  5H2H A;  1Z3I X;  2A1D D;  3U3F A;  1V4A A;  3N2Z B;  5DYS A;  1K40 A;  4JCZ A;  3OE9 A;  3X3B A;  4I3M A;  3OE6 A;  2IOQ A;  1AEP A;  3GWL A;  3NS0 A;  4KC9 A;  1GZM A;  4U5B E;  2LNL A;  3M15 A;  1M2V B;  1D1C A;  4DBQ A;  4OD5 A;  1XME B;  2RSE B;  1L0M A;  2A68 F;  5H2O A;  4XXJ A;  1M56 C;  1M6T A;  5AC4 A;  1L9H A;  1O0A A;  1C03 A;  2AP3 A;  2NTW A;  3S28 A;  3HNL A;  4K7B A;  1SYQ A;  1X0I 1;  3HJC A;  4DKL A;  1C8S A;  2LFD A;  2LIG A;  2Z73 A;  1K05 A;  3DAF A;  4B6I A;  1E83 A;  1M57 C;  3RFM A;  4EBJ A;  4G7H F;  1SMY F;  4BVN A;  2R7T A;  3CAP A;  3US6 A;  2ETS A;  1T6Q A;  5G36 A;  3QAP A;  3S3D B;  3MLG A;  4MVR A;  4IJJ A;  1KU2 A;  1JAF A;  4EIY A;  4MVU A;  2L7A A;  4YN0 B;  4N06 A;  1RMV A;  1C8R A;  1WGW A;  3IPM O;  3SEO A;  1BDJ B;  2NUP B;  2R7X A;  4BUO A;  4MD2 A;  1Q0D A;  1Q0K A;  4DVZ A;  3U2L A;  3KL4 A;  3BEH A;  5D91 A;  2KNH A;  2W4M A;  4EBK A;  2OJQ A;  5COF A;  4X0R A;  1H6G A;  1BRR A;  3C9L A;  3C62 A;  2R05 A;  4LLE A;  1X0K 1;  2D4U A;  1BR2 A;  4P6I C;  1VMA A;  3DE9 A;  1NZE A;  3QTH A;  1UAZ A;  2YVK A;  5L3Q A;  3M4C A;  1IZM A;  3KH2 A;  5CIV A;  3J06 A;  2EPL X;  5F28 E;  2OEV A;  3TOM A;  3LES A;  2XS8 A;  5A6K A;  1G8X A;  3NYA A;  3Q7G A;  3RIP A;  5ITC A;  1VLT A;  3UTY A;  4AL0 A;  4AE4 A;  1HW2 A;  2KJG A;  2HV7 A;  5L0J A;  3NKD A;  3MBG A;  3D4S A;  3G50 A;  5A6A A;  3OWT A;  3GWN A;  3E9V A;  3ZTM A;  1PXS A;  1OW8 A;  2LP4 A;  1WN0 A;  5HV9 A;  3TUL A;  2OEX A;  4U9D A;  2OOC A;  1VGO A;  1PD1 A;  3FMS A;  3NSB A;  4Q7C A;  2IBF A;  1YYJ A;  1Z63 A;  1NSG B;  5BUO A;  3EHN A;  4LDL A;  1T9K A;  2KQ9 A;  4XTO A;  1YAR O;  2GDC A;  4GQH A;  3S84 A;  2J0X A;  3S8F B;  2F22 A;  4XT1 A;  3EGX A;  4JZA A;  3VYW A;  1X0S A;  4UG2 A;  1RXQ A;  2C03 A;  1TWG A;  3FHD A;  3W2W A;  4FX5 A;  3QBK A;  1LI7 A;  2AWC A;  3LLK A;  1YJG A;  3V2W A;  1RJ9 A;  1KGB A;  5DVW A;  1VJM A;  3Q6M A;  4A2N B;  4L6R A;  5AX1 A;  1YAU O;  3IQ5 A;  5AGF A;  4DAJ A;  3HLZ A;  1YLM A;  3C8G D;  3SXY A;  2X0C A;  4IAR A;  3VRC A;  1MQV A;  4W8K A;  2R7Q A;  4EA3 A;  3DJU B;  1OQC A;  4BJ6 C;  3KJ6 A;  1XJI A;  3JT1 A;  5JP7 A;  1UCQ A;  4JCH A;  2CDQ A;  3LLI A;  4JTC B;  5F5F A;  2IM8 A;  2H8A A;  1YDI A;  5H2K A;  5F5H A;  2I1X A;  2A0B A;  3AM6 A;  3UMK A;  5DS5 A;  2BC5 A;  1QHJ A;  1NU7 D;  3SNH A;  3H2V A;  1BBH A;  2LSE A;  2H7B A;  1ORY A;  3W8H A;  3L8I A;  3HNJ A;  4G7Z F;  1M0K A;  3NMI A;  4Z9H A;  3MX3 A;  3HAP A;  1AT9 A;  1YZA A;  2IXM A;  2J45 A;  1MNE A;  1ORJ A;  5BQH A;  1U6H A;  2BE5 F;  2LD6 A;  5B3S C;  2EI4 A;  4O6M A;  4GEH A;  2WJK A;  2Q00 A;  5G54 A;  3N24 A;  5JJN A;  3ABW A;  5JJE A;  4JC7 A;  4HE8 D;  1FR0 A;  4KNV A;  2YZS A;  4WAV A;  2GWW A;  2MHR A;  3PHF 2;  4I1O B;  4I1M A;  3K1I A;  1F1M A;  5B34 A;  2EPN A;  1E86 A;  4YT5 A;  2ZPA A;  4YL3 A;  3C8Z A;  3RH3 A;  2X51 A;  5JRA A;  5DHH A;  1FBK A;  4IAQ A;  2J0W A;  4MQS A;  1JV7 A;  1HMO A;  1OCZ C;  5H2L A;  4CSA C;  1H2S A;  3ZPQ A;  4DOZ A;  3OE8 A;  2XM0 A;  2JAG A;  1ZHZ A;  2R7W A;  4PAC A;  2XXA A;  1MGY A;  1PY6 A;  5FJG A;  5B2N A;  2QUP A;  5B35 A;  3EGX B;  5AZD A;  3O6X A;  3CEX A;  5B6Z A;  3DAG A;  4JTA B;  4J30 B;  4JIO A;  4OD4 A;  1JMW A;  4U9E A;  2GAQ A;  3ZWI A;  1RJ9 B;  3X1O A;  5L0H A;  2L6G A;  5FCL A;  1QLE C;  3V5Z A;  2Y00 A;  3KPH A;  4GRV A;  1HW1 A;  2HV6 A;  1O87 A;  3F46 A;  3LJB A;  3K66 A;  2EIJ C;  3PDM P;  4BJ1 A;  3DKA A;  3IQC A;  1LKX A;  5L0C A;  2Y3B A;  3JYY A;  1H7I A;  4C3E A;  1HZX A;  4HYJ A;  3L8J A;  1PXR A;  4U5G A;  5IY5 C;  4MS2 A;  3A9C A;  1S53 A;  1ZHW A;  2VB6 A;  3BVD B;  5JT4 A;  3OAX A;  2YQY A;  3O39 A;  1CGN A;  2QPE B;  1VLS A;  1BRX A;  3B0U X;  2ZXP A;  2IXP A;  3PWH A;  4WGZ A;  2NG1 A;  2O9X A;  1GGQ A;  1EA8 A;  4W8P A;  3DD7 A;  2HMQ A;  3WHN A;  3ZEV A;  1PCX A;  1MMN A;  1OCC C;  1ZZP A;  3M79 A;  1YVI A;  1MMD A;  1LPE A;  1OR2 A;  1QM8 A;  4G72 B;  2YL0 A;  2RH1 A;  2KW3 C;  4X32 A;  3S8G B;  3QJT B;  5JVE A;  3KYI A;  4PXF A;  2P7V A;  2IXN A;  1TFK B;  1P8H A;  3OEO A;  5EHH A;  3ZQV A;  3T45 A;  1A7E A;  2ZXR A;  4PXK A;  4XEK A;  4BG0 A;  2AWY A;  4BWB A;  3AG3 C;  3QBL A;  3EZH A;  3M1C B;  4MVZ A;  1BRD A;  1PD0 A;  3A7K A;  1XWJ A;  4XEF A;  3EH2 A;  1FFH A;  4EUK B;  4YWQ A;  3GEE A;  2OJE D;  4LAC B;  3ZC4 A;  4YL0 A;  3MYI A;  1D0Y A;  2P0N A;  2YCZ A;  3UMH A;  3ZTZ A;  1J8Y F;  1SR2 A;  3MBV A;  4WJ0 A;  2RD9 A;  4MVM A;  1Q0G A;  3AYM A;  5AX0 A;  2LFF A;  5H2I A;  3GM3 A;  1G4W R;  1D0Z A;  3TD7 A;  3L0I A;  4PJN A;  3DDL A;  2MWQ A;  5AHY A;  3VGA A;  1BM1 A;  3EH3 B;  2YLG A;  3QJV B;  5T3W A;  3RZE A;  1E84 A;  3OE0 A;  1ZHT A;  5L0I A;  2W4B A;  5F8U A;  3ZVR A;  4HFK B;  4LDQ A;  1EHK B;  4F4B A;  1NBB A;  4E7S A;  4LDR A;  5KKH A;  1LVK A;  1GU8 A;  2YEV A;  3AJM A;  5JJJ A;  2XS1 A;  4KI2 A;  4E18 A;  5JSL A;  4MD1 A;  3IQT A;  4U5E E;  2J9V A;  1M2O A;  3NY9 A;  4A4A A;  3COD A;  2HUJ A;  2Q4F A;  2VCC A;  2P61 A;  5B6V A;  2PP4 A;  4IB4 A;  3HTK C;  1PV3 A;  1FNT c;  3C9M A;  3B29 A;  1TR2 A;  3TOL A;  1V54 C;  2YDO A;  2XM4 A;  4LER A;  3NRH A;  5AC5 A;  2VH3 A;  4PK4 A;  2OQM A;  3QMK A;  4H54 A;  4YT2 A;  4XQ1 A;  2HMZ A;  1QQ3 A;  1I4Y A;  4WGY A;  3RVY A;  3EH1 A;  4C3D A;  2UUI A;  4X1H A;  3UON A;  2PX3 A;  5B6W A;  4BEJ A;  3DWW A;  3E70 C;  1OW6 A;  1Y6D A;  2PFD A;  4U5F E;  5KYY A;  1FBB A;  3UZA A;  4DS7 E;  2J8W A;  3QVY A;  4FA7 B;  3UMI A;  5COM A;  4DVY P;  4WAB A;  2WVQ A;  1CGM E;  4N4Y B;  3I5Q A;  2NUT A;  4J4Q A;  2EPO A;  1LS4 A; 
#chains in the Genus database with same CATH homology
 2YDV A;  5ITE A;  4GP8 B;  2YLD A;  5B6Y A;  4BEY A;  1KGB A;  1VJM A;  4GYC A;  4G71 B;  4L6R A;  1A7V A;  5AX1 A;  1CPQ A;  3IQ5 A;  4AMJ A;  5AGF A;  4XTN A;  3QJR B;  5H2P A;  3S3C B;  2PED A;  3VI0 A;  4GPO A;  4DAJ A;  4FPD A;  5A8E A;  5H2M A;  3V2Y A;  4IAR A;  3VRC A;  4CDV A;  1MQV A;  2R4R A;  4EA3 A;  2KSA A;  1CPR A;  3PDS A;  2Y04 A;  3NMJ A;  1IXF A;  3KJ6 A;  1XJI A;  4JQ6 A;  1KME A;  1TN0 A;  1S8J A;  3COC A;  5EN0 A;  5JP7 A;  1UCQ A;  3HAN A;  4QRY A;  3S3B B;  2XLV A;  1XIO A;  4FBZ A;  3SN6 R;  4CDA A;  3EML A;  2VT4 A;  4GP5 B;  3AYN A;  4QID A;  2J4Y A;  3P0G A;  5H2K A;  3REY A;  3U8P A;  2CCY A;  2YCX A;  2I1X A;  3ODU A;  3QW0 A;  4G70 B;  1F50 A;  3AM6 A;  4XTL A;  5A45 A;  4D4N A;  4DJH A;  2BC5 A;  4GP4 B;  1QHJ A;  2KSY A;  2Y01 A;  3WQJ A;  2M3G A;  1BBH A;  3ZQY A;  2XL6 A;  2XL8 A;  3VVK A;  5C1M A;  3HNJ A;  1M0L A;  3QJU B;  1M0K A;  4MBS A;  1F88 A;  3NMI A;  3EH4 B;  3NMK A;  2BRD A;  3QJS B;  3HAS A;  5H2J A;  1Q5I A;  3HAP A;  4D4X A;  1YZA A;  1AT9 A;  3UG9 A;  4OV0 A;  1KG8 A;  2EI4 A;  4CDY A;  5B6X A;  4HWL A;  2WJK A;  5G54 A;  5JJN A;  3ABW A;  5JJE A;  4MQT A;  4N4W A;  5B0W A;  4WAV A;  3HNI A;  2Y03 A;  1S51 A;  4G7S B;  4JEB A;  1KG9 A;  5TGZ A;  5B34 A;  1E86 A;  4GBR A;  4G7Q B;  1E85 A;  1JV6 A;  4AMI A;  4ER9 A;  5JRA A;  5DHH A;  4CJG A;  4ULV A;  1FBK A;  1S8L A;  3QBG A;  4IAQ A;  1GQA A;  5A44 A;  4MQS A;  1JV7 A;  2YKZ A;  5G2D A;  1H68 A;  3QVZ A;  5H2L A;  1H2S A;  3ZPQ A;  1JFP A;  256B A;  3OE8 A;  1P8I A;  2XM0 A;  4N6H A;  2JAG A;  3C63 A;  1IW6 A;  1MGY A;  1U19 A;  1E12 A;  1PY6 A;  5FJG A;  5B2N A;  5B35 A;  3UTX A;  4Y9H A;  3NY8 A;  1AP9 A;  5AZD A;  4BEZ A;  4JEA A;  2L6X A;  1DZE A;  2WJL A;  1CGO A;  2R4S A;  1LN6 A;  5B6Z A;  5BR2 A;  2Y02 A;  1C3W A;  3UTV A;  3UTW A;  2F93 A;  2XLE A;  4U9E A;  3ZWI A;  3VW7 A;  3QW1 A;  2HPY A;  5B3I A;  1TN5 A;  2Y00 A;  2QPD B;  4GRV A;  3ZPR A;  1F4Z A;  2XLO A;  5DHG A;  2ZZL A;  3UZC A;  3HAO A;  1HZX A;  4HYJ A;  2YL3 A;  3FOP A;  5H2H A;  3QJQ B;  1PXR A;  1S53 A;  1YZC A;  3BVD B;  5DYS A;  5LWE A;  2ZIY A;  5JT4 A;  4TL3 A;  3OAX A;  4KLY A;  3OE9 A;  2KSB A;  3X3B A;  1CGN A;  3L1M A;  4L35 A;  2QPE B;  1BRX A;  2G87 A;  3OE6 A;  5G2A A;  3X3C A;  4WW3 A;  2KS9 A;  1S54 A;  3QAK A;  1R84 A;  2ZFE A;  3NS0 A;  3PWH A;  4WGZ A;  3FOO A;  1GZM A;  2LNL A;  3M15 A;  4FAA B;  3ZEV A;  4G7R B;  1XME B;  3M79 A;  2J9B A;  1L0M A;  5JS5 A;  5H2O A;  4XXJ A;  1M6T A;  2YCY A;  1L9H A;  1E0P A;  1O0A A;  1QM8 A;  4G72 B;  2YL0 A;  2RH1 A;  2NTW A;  2Z55 A;  4QI1 A;  4JKV A;  4X32 A;  3S8G B;  3QJT B;  5JVE A;  4PXF A;  1GUE A;  3HNL A;  1X0I 1;  2YCW A;  1P8H A;  3DQB A;  4DKL A;  3ZQV A;  3T45 A;  1C8S A;  4PXK A;  4A4M A;  2Z73 A;  4JE9 A;  1E83 A;  4BWB A;  3QBL A;  3RFM A;  1BRD A;  1P8U A;  3A7K A;  5AWZ A;  4BVN A;  2F95 A;  4UHR A;  2XLH A;  3CAP A;  4NC3 A;  5G36 A;  3QAP A;  3S3D B;  1RCP A;  2YL7 A;  3HAR A;  4LDE A;  1JAF A;  4EIY A;  2YCZ A;  3ZTZ A;  3MBV A;  4CIP A;  5G28 A;  2YLI A;  3AYM A;  5AX0 A;  5H2I A;  1M0M A;  1C8R A;  4CX9 A;  3QBI A;  5BR5 A;  3DDL A;  3PXO A;  4JR8 A;  5AHY A;  3VGA A;  1BM1 A;  4BUO A;  3EH3 B;  2YLG A;  4MD2 A;  3QJV B;  4XT3 A;  3IQ6 A;  2AT9 A;  3RZE A;  1E84 A;  5JLI A;  3OE0 A;  5AHZ A;  2I20 A;  2I21 A;  1APC A;  1S52 A;  1BRR A;  5F8U A;  4BV0 A;  1QKP A;  3C9L A;  3C62 A;  1EHK B;  5H2N A;  1X0K 1;  1NBB A;  5ETZ A;  3DE9 A;  2NTU A;  5KKH A;  1EKY A;  1UAZ A;  1LM3 B;  3M4C A;  1GU8 A;  1IW9 A;  5JJJ A;  1YYX A;  1Q5J A;  5JSL A;  1CWQ A;  4MD1 A;  3TOM A;  1JGJ A;  3DE8 A;  2X72 A;  5G2C A;  3NY9 A;  3NYA A;  2I35 A;  5ITC A;  3UTY A;  5J7A A;  4HYX A;  3COD A;  4KNF A;  5B6V A;  3VHZ A;  4IB4 A;  3PQR A;  3EH5 B;  3PBL A;  3D4S A;  1R2N A;  4K5Y A;  3C9M A;  2XLW A;  3ZTM A;  3M4B A;  1PXS A;  3TOL A;  4X31 A;  2YDO A;  2YL1 A;  2XM4 A;  4EJ4 A;  3QDC A;  4U9D A;  1VGO A;  2JAF A;  2XLM A;  1QQ3 A;  3NSB A;  4WGY A;  4LDO A;  1YYJ A;  4X1H A;  3UON A;  5JUA A;  2QLA A;  5B6W A;  5G53 A;  4LDL A;  2XLD A;  4XTO A;  1FBB A;  3UZA A;  3HAQ A;  4DS7 E;  3HNK A;  3S8F B;  2J8W A;  1QKO A;  4XT1 A;  3QVY A;  4FA7 B;  4CJO A;  1S05 A;  1X0S A;  4UG2 A;  4N4Y B;  1QPU A;  3VG9 A;  3QBK A;  4J4Q A;  3V2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...