4N4WA

Structure of the human smoothened receptor in complex with sant-1.
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
473
structure length
457
Chain Sequence
GGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSESKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQADCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Cytochrome b(562),Smoothened homolog
publication title Structural basis for Smoothened receptor modulation and chemoresistance to anticancer drugs.
pubmed doi rcsb
source organism Shigella flexneri 5 str. 8401
total genus 186
structure length 457
sequence length 473
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n4wA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n4wA02
4G72B 3QBLA 4U9DA 3P0GA 3HNLA 1S53A 2PEDA 5G54A 4L6RA 5AZDA 2JAGA 2YLDA 4EJ4A 2Z73A 3A7KA 4LDEA 5AX1A 4BEZA 2QPDB 3EH4B 5A8EA 1YYXA 1R84A 1M0MA 4G7RB 1YYJA 4MQSA 2XLOA 5B6VA 2Y01A 3KJ6A 3VW7A 1KG9A 5TGZA 3HAPA 2JAFA 4XTLA 3UZCA 1CGOA 2KSAA 4N4WA 5B3IA 5ITEA 5BR5A 1KGBA 4GP4B 3AM6A 4PXFA 5ETZA 1E0PA 2KS9A 5H2JA 1S05A 5JJEA 4XT1A 3OE6A 4GYCA 1CGNA 4A4MA 4XT3A 4MD2A 3C9LA 1S8JA 4EIYA 5H2NA 4G7QB 3COCA 5B35A 1CWQA 3UTWA 4DJHA 5AGFA 3PQRA 1VJMA 4KLYA 5DYSA 2CCYA 1IW9A 5H2LA 3M4BA 4X32A 3UTYA 1NBBA 4HYJA 4UHRA 2YLIA 1X0SA 2ZIYA 2F93A 5B0WA 1KG8A 3ABWA 3TOLA 4PXKA 1M6TA 5JVEA 1E84A 3D4SA 4X31A 3HANA 3VI0A 4ULVA 3OE0A 3C9MA 3VHZA 4WW3A 4FAAB 3OE8A 3C62A 5H2OA 4XTOA 1KMEA 3EH3B 4CDYA 5J7AA 1C8SA 3OAXA 2WJLA 4CJOA 2J8WA 2L6XA 5BR2A 3UONA 1TN5A 4BEYA 1QPUA 3AYMA 1VGOA 2YL0A 3QVZA 4CDAA 4DKLA 4MQTA 1F88A 4QIDA 4GRVA 4U9EA 4IARA 3HNJA 4EA3A 1E86A 3OE9A 2J4YA 1QKPA 4WGZA 3ZWIA 1JV6A 3HNKA 3M4CA 5B6WA 5DHGA 1AT9A 3QJTB 1JV7A 3NYAA 3QJRB 5G2DA 4G7SB 4JE9A 3NMIA 2BRDA 1C3WA 5JUAA 1DZEA 1X0K1 1PXRA 1X0I1 1UAZA 3PXOA 1PY6A 1BBHA 2M3GA 2I21A 3ZEVA 3PWHA 4CX9A 3HASA 5ITCA 5DHHA 3UTVA 3IQ5A 4AMJA 3UG9A 4LDOA 5JJJA 5LWEA 3ZQVA 1L9HA 3QDCA 2XLMA 1APCA 1E85A 1S51A 5B6XA 4L35A 2LNLA 1BM1A 1LM3B 5G28A 3S3DB 3ZPRA 5AHYA 3VRCA 1QKOA 2YL3A 5JT4A 4CJGA 1S52A 3QAPA 1AP9A 1QM8A 4GPOA 1HZXA 3ODUA 4XTNA 3V2WA 2XM4A 5B6YA 2XLHA 2YDOA 5AX0A 1CPRA 4BVNA 5G53A 2YL1A 256BA 3DDLA 5F8UA 3VG9A 5JSLA 2XLWA 1M0KA 3HNIA 3QW1A 5FJGA 2WJKA 1YZAA 1XJIA 2EI4A 3V2YA 4LDLA 2Y00A 4G71B 5H2KA 1XIOA 1H2SA 4JEAA 1F4ZA 2XL6A 4FPDA 2KSBA 3RZEA 3QAKA 4WGYA 4BWBA 4X1HA 3NSBA 5AHZA 3QBGA 3VVKA 3NMJA 1L0MA 3DE9A 3S3BB 3REYA 4G70B 1JFPA 4CIPA 4IAQA 4BV0A 3FOOA 3BVDB 4AMIA 1A7VA 2XM0A 4FBZA 1LN6A 4D4NA 2AT9A 2YCWA 2J9BA 1QQ3A 3UTXA 4XXJA 5H2PA 1S8LA 2YCXA 1O0AA 3EH5B 4CDVA 1GUEA 1FBBA 4NC3A 1QHJA 2KSYA 5H2MA 4WAVA 3NS0A 2YDVA 4MD1A 1JGJA 3FOPA 3QJSB 2YKZA 3DE8A 1EKYA 2RH1A 1P8UA 4HYXA 2F95A 3QJUB 3VGAA 1BRXA 4IB4A 1RCPA 5G36A 3NMKA 2XLDA 3C63A 1M0LA 1PXSA 3QJVB 1BRDA 1XMEB 2Z55A 3TOMA 2VT4A 2I20A 1CPQA 5B6ZA 4D4XA 4QI1A 3RFMA 4ER9A 4QRYA 1TN0A 3SN6R 3S8GB 3CAPA 4HWLA 3DQBA 2ZZLA 4KNFA 3ZTMA 3S3CB 4N4YB 3ZPQA 3HARA 4K5YA 1P8IA 3IQ6A 3QW0A 4GP5B 5KKHA 1EHKB 3WQJA 5JS5A 4DAJA 2XL8A 2YCYA 3EMLA 1GQAA 1IW6A 5JRAA 2Y02A 5B34A 1JAFA 5JJNA 1GU8A 3ZQYA 1FBKA 1F50A 4JR8A 4UG2A 3PBLA 3NY8A 2G87A 1C8RA 2HPYA 2R4SA 3UZAA 3PDSA 2NTWA 3QBIA 1R2NA 4BUOA 3QJQB 3CODA 2I35A 5JLIA 5G2AA 3T45A 5JP7A 1U19A 2ZFEA 3S8FB 3HAOA 1MQVA 5C1MA 1Q5JA 4JKVA 5H2HA 3L1MA 4JEBA 4J4QA 2XLVA 1MGYA 5AWZA 2R4RA 3QBKA 3QVYA 2YL7A 5H2IA 3NY9A 1BRRA 3X3CA 4TL3A 5EN0A 2I1XA 2YCZA 1H68A 1Q5IA 1P8HA 2BC5A 2NTUA 2X72A 4Y9HA 1GZMA 3M15A 1UCQA 3AYNA 5A45A 2XLEA 4FA7B 2Y04A 1YZCA 2QLAA 2QPEB 1E12A 1E83A 1S54A 4GBRA 3ZTZA 4OV0A 4GP8B 3U8PA 5B2NA 3X3BA 2YLGA 1IXFA 3HAQA 3M79A 2Y03A 5A44A 4N6HA 4JQ6A 3MBVA 5G2CA 4MBSA
chains in the Genus database with same CATH superfamily
2A6HF 2FGYA 3RVYA 1SR2A 5G54A 3T6GB 1FR0A 1I4YA 4B6IA 1M0MA 3ABLC 4XPWA 4MQSA 2XLOA 2J9VA 4XPXA 1T01A 3ZG1A 4XEFA 2HSBA 4N4WA 3W2VA 1C17M 4H4KC 4JJFA 4CS8C 4DBRA 3K1HA 3O6XA 5ETZA 1E0PA 2VB6A 4GYCA 4A4MA 3ZVRA 4EIYA 4EKWA 2LSEA 3COCA 3ZC4A 5AGFA 3FAJA 1VJMA 1IW9A 2L6HA 3BEHA 5L0IA 2YQYA 1ZW2A 2PFDA 4AE4A 4X32A 3UTYA 3B29A 4HYJA 4YT2A 3EG9B 3ABWA 1RKEB 5B0WA 4PXKA 1NLXA 2Y39A 5HV9A 3K6BA 5L3VA 3OE0A 3OE8A 1ZZPA 1XZPA 1V4AA 1C8SA 4MVMA 4JTDB 4EHPA 2WJLA 5E33A 2G3VA 1D0YA 3UONA 1VGOA 2YL0A 3MLGA 4FAPB 3B0UX 4IARA 1D0XA 3K1IC 1G8XA 4XEVA 4KNWA 1E86A 3OE9A 2W45A 4JZAA 1QKPA 1HE9A 2BE5F 2PBEA 2EIMC 3V7OA 3CAXA 1O5HA 3QJRB 1OKKA 3AG1C 3MX3A 4G7SB 4JE9A 3DJUB 3AGUA 4AK9A 2OCCC 3A9CA 4C7OA 3GODA 3N0TA 1UAZA 3PXOA 1G4WR 4MVSA 1FMWA 3ZEVA 4DXWA 5ITCA 5DHHA 3EH1A 5JJJA 1S7ZA 2R7OA 3U5SA 2JD3A 4E18A 1APCA 2Y3BA 4I44A 5G28A 1WTYA 3EZHA 5AHYA 1SF8A 1QKOA 5JT4A 4KBLA 4LLCA 2Z15A 1QM8A 3DM9B 3EHMA 3V2WA 2XM4A 2XLHA 4OD4A 4FX5A 5BQIA 1M2OA 3DDLA 2DB4A 5KYWB 5JSLA 2XLWA 1A7EA 2VCCA 2WJKA 5CI9A 1AVOB 3LUTB 2LP4A 1WASA 3RQFA 1SZIA 3EGXB 3C7JA 3S9OA 3TJ6A 4C3DA 1D1CA 3ABKC 1BZ4A 3AQBA 4WGYA 1NSGB 5AHZA 3FHDA 3GM1A 3QMKA 1H9GA 1IW7F 3REYA 5BQGA 2A1DD 1LE2A 3FOOA 4AMIA 3LESA 1RKCA 3HJCA 2XM0A 2PP4A 1OCOC 1QQ3A 2WVOA 1V55C 2CYDA 2RSEB 2XSEA 2YCXA 1QVXA 1O0AA 3EH5B 4CDVA 3SEOA 2Q9AA 2KW3C 4CS8A 1QHJA 3LNRA 2IXNA 2TMVP 1TFKB 3NS0A 1GGQA 1T5OA 3K66A 1J8MF 1JGJA 2QTVA 1U89A 4G0HA 3LAYA 1HMDA 1EKYA 3JTLO 4YN0B 2R02A 1V74B 2KQ9A 1YDIA 3H65A 3NYJA 1LVKA 3VGAA 2J45A 3NMKA 3CQZA 2C03A 4OIRF 1Y6DA 4PFOA 3TOMA 1CPQA 5B6ZA 4Q4ZF 3EQLF 4AE4B 2WVQA 2AWCA 1WGWA 1OCZC 4QRYA 3V5YA 5KYYA 1R5ID 2R03A 3CAPA 1GM5A 1LPEA 4OD5A 3ASNC 4EUKB 3ZPQA 2JPUA 1P8IA 3JYHA 3WQJA 1QKRA 2XL8A 1GQAA 3T6JA 3IEEA 3RQEA 3S29A 3ZQYA 4C3BA 3K1IA 5BUOA 4JR8A 3ZDLA 2A0UA 4Z9JA 5A6KA 1C8RA 4CS9C 2R4SA 4DRHB 3PDSA 4DVZA 2MWQA 2J0XA 1YVIA 4BUOA 3QJQB 1Q0FA 2DI3A 3UGOA 5G2AA 3T45A 3GEEA 2EPKX 1U19A 1OQCA 3N24A 4Z9IA 3HAOA 3S8FB 5C1MA 1ZHTA 5IY5C 1JRAA 1D1BA 2EPLX 5H2HA 3SP1A 4JEBA 3SXMA 4KC9A 1U0BB 2R4RA 2YL7A 1T9KA 4C7OB 3I5PA 1BRRA 5A69A 4TL3A 1Z3IX 1O87A 5EN0A 4RDAA 4AL1A 4XPYA 3IQTA 1H68A 4XLPF 2NTUA 2NUPA 4PJJA 2FAPB 3M15A 3JRTA 3S27A 5AC5A 4WJ0A 2QLAA 4Z9HA 2QPEB 2KNHA 1E12A 4MW8A 1VLSA 2D5RB 2GWWA 4LDKA 4EBBA 3U8PA 2R7TA 1VTMP 1IXFA 3T9OA 4O6NA 1EA8A 3L8IA 5G2CA 4G72B 3QBLA 1S53A 2CNWA 3L0IA 3KL4A 3A7KA 3RVZA 1JMWA 4U5DE 2WZLA 1YYXA 3WAQA 2P7VA 4G7RB 1YYJA 2L7AA 2AP3A 1IZMA 2YEVA 2ICWG 3TD7A 2KSAA 1KU2A 4F4BA 4PACA 5BR5A 4MTOA 2Y3HA 5H2JA 1YA7O 2F22A 1I4ZA 1S8JA 4YT5A 2B0HA 4E7SA 2R7SA 5EK0A 4JTAB 5B35A 1CWQA 4DOZA 5L3QA 2R7RA 1TKNA 1YLMA 1G4US 1KNYA 2WZGA 4BJ6C 3G4ZA 4BEJA 3OWTA 2NUTA 4UHRA 5AC4A 3DMDA 1X0SA 1VLTA 3VYWA 2OEVA 4G7HF 2ZIYA 3C8GD 4CBEA 5JVEA 1E84A 2EPNA 4X31A 3ECSA 4I3MA 4ZLDA 4ULVA 2P1AA 5B3SC 5E2QA 3WG7C 4DBQA 4YT4A 1H7IA 1A41A 5H2OA 4XTOA 3OAXA 5A6BD 3UNGC 3O39A 4CJOA 2J8WA 3U2MA 2L6XA 2XS8A 4E7ZA 2XS1A 3KKBA 3J06A 3AYMA 4GQHA 4W8PA 4GRVA 4EA3A 4X0RA 5KYYB 3S84A 4RD9A 2J4YA 1JV6A 2ZXWC 2Q3TA 1Q0MA 2ZXPA 3HNKA 2NSFA 5B6WA 5DHGA 1AEPA 1JV7A 3NYAA 1VK5A 4HFFB 1Z63A 1X0K1 1PXRA 2WB7A 1X0I1 5COFA 5F5FA 5FZTA 1UG7A 5T3TA 3ZIBA 3E9VA 2Q4FA 4CX9A 2DYRC 3UTVA 5GPGB 3UG9A 1OCRC 1FFHA 4P9TA 3U9JA 2HJ3A 3ABMC 4L35A 3QTHA 1OXKA 4H54A 1BR4A 2HMZA 3IQCA 3ZPRA 3VRCA 2L6GA 1S52A 3QAPA 1ORSC 4P9FA 3DKAA 1M57C 3CZ6A 4BVNA 5G53A 1MMNA 4PK4A 2ASRA 4CIHA 4YK5A 3VG9A 2NG1A 2R7QA 3U8VA 1TWAA 3RQGA 4N6CA 2Q9BA 4QI2A 2EI4A 3V2YA 4LDLA 1VYKA 4G71B 3MYFA 4IGGA 4FPDA 2MHRA 2YRFA 3RZEA 2CW0F 3QAKA 2OU6A 2A68F 4BWBA 3NSBA 3QBGA 3NMJA 1FMVA 2LIGA 3DE9A 3S3BB 3DI5A 2EILC 1KTMA 4FBZA 4FWVA 4U5GA 4DRJB 5D92A 1S8LA 1LI7A 1K04A 1GUEA 3DAFA 2MYSA 4DVYP 2OOCA 4NC3A 4HFKB 2YDVA 4U5BE 4MD1A 4OINF 1QZXA 5HSWA 3QJSB 1VOMA 4E17A 3V5ZA 4XTKA 3KPHA 1P8UA 4HYXA 5K0IA 5KYXA 2JX0A 2IYLD 4BJ6A 3MYIA 1RCPA 5G36A 3EHNA 5COMA 4OIPF 3EGDB 3OA1A 3S90A 4DJ9A 1R4TA 3RF3A 2ZD9A 3H2UA 2W4BA 3SN6R 4KNVA 4YWQA 3JZ0A 1RXQA 4N4YB 3AJMA 1GS9A 1WWPA 2H7OA 1WOLA 3QW0A 4GP5B 2NPUA 5KKHA 1EHKB 3GORA 5JS5A 1ZU4A 4BEMJ 3GWLA 5T1DB 5JRAA 3NG1A 2Y02A 5B34A 5JJNA 2HSQA 1UFBA 2VC9A 1OR2A 2G87A 2G3KA 2L81A 3UZAA 4LLEA 3TQOA 3QBIA 1G5ZA 4YT8A 3CODA 3GEIA 4NY3A 2I35A 5JLIA 3PDMP 2IOQA 3F47A 5A6JA 2XXAA 2Y3DA 3US6A 1OKKD 2O9XA 5AWZA 3DJNB 1T6IA 2V3CC 1L7CA 3JYYA 3ASOC 2KJGA 5DLJA 4MTGA 1JR8A 1ORJA 2I1XA 3RH3A 3TJ5A 3FVYA 2I8BA 1FTSA 2XLEA 1YZCA 2X51A 1H6GA 1S54A 4GBRA 3ZTZA 4OV0A 4BJTA 4GP8B 1WN0A 1FFTC 3DD7A 3I5QA 4BJ5C 1ZU5A 3HAQA 2QE9A 5A44A 3MBVA 3P0GA 3SXYA 3HNLA 1PCXA 3A11A 5AZDA 3RFYA 2W9YA 2JAGA 4EJ4A 2E87A 3AG2C 5T3WA 1R84A 2H8AA 5B6VA 2Y01A 1KG9A 3KMIA 3HAPA 1QSPA 2JAFA 3SXZA 3IHUA 1CGOA 3UZCA 2KGOA 4MS2A 2Q9CA 4HE8D 5B3IA 2YZSA 5ITEA 3KYJA 2CDQA 1KGBA 5DS5A 3AM6A 2D4UA 3SNHA 4JCZA 3DZAA 4IRUA 2KS9A 1S05A 5JJEA 3AG4C 3OE6A 2I15A 2DYSC 4YL3A 3PMRA 2HV7A 4BJ1A 4MD2A 5TJ5E 5H2NA 4G7QB 2J9UA 4LERA 3UTWA 1MNEA 1YARO 3PQRA 1YAUO 5DYSA 1Z7Qc 2CCYA 2H7BA 3L8JA 1Z5ZA 3M4BA 4EBKA 4JIOA 2YWAA 4I1MA 5E3AA 3BRJA 5DS6A 1D1AA 2EIKC 3L34A 2F93A 2ETSA 5EHHA 3D4SA 3VI0A 1LS4A 3X2QC 3C9MA 4IAOA 3H2VA 1L3PA 3VHZA 4FAAB 3UGPA 3T4RA 5KYXB 1ZVZA 4CDYA 5J7AA 2NSGA 5L0JA 3EJNA 1H9TA 1ZYRF 3RYLA 5BR2A 1TN5A 4BEYA 2X0CA 3QVZA 1JPJA 4MQTA 3HNJA 3LNMB 2XRHA 1OW8A 4GEHA 1O3UA 3Q6MA 4MQ9F 4WGZA 4DS7E 3ZWIA 2HMQA 2VH3A 3JSZA 4YL0A 3C8GA 4MVZA 2HZ8A 2LFFA 4O6MA 5G2DA 2BRDA 3NMIA 4G7OF 1C3WA 2HUJA 3GEHA 2OKUA 5A6BA 1BR1A 3NYLA 1TR2A 2M3GA 2OJED 2I21A 2W4MA 3W8HA 3LS0A 1JOGA 3HASA 1N1CA 3CEXA 3LS1A 3JCUQ 3FXHA 4FESA 4P6IC 3IQ5A 3W2WA 4LDOA 4XQ1A 4U5CE 3UMIA 5D91A 5LWEA 1K40A 1MNDA 1L9HA 1S51A 2HKVA 1E85A 2J9WA 3HKKA 4N06A 1BM1A 2IBFA 4W8KA 3S3DB 2XXAB 3W4YA 1Q0KA 4CJGA 3O55A 1AP9A 1HZXA 1E2XA 3ODUA 2EIJC 4XTNA 5B6YA 3JRMO 4U5EE 5COGA 5AX0A 4GYTA 1CPRA 4JC7A 4JRZA 3B71A 1TWHA 4PR9A 2Y3GA 1M0KA 4J7YA 3HNIA 2V26A 5FJGA 3U3BA 2VASA 2P6VA 4BJ5A 2ZXRA 1T6UA 4BG0A 5H2KA 1XIOA 1RMVA 4NTBA 2GFHA 4EWCA 3U9MA 1NU9C 4X1HA 4Q5SF 2QNLA 1L0MA 3MBGA 4G70B 4Q7CA 3POVA 4IAQA 4BV0A 3BVDB 1TFOB 1LN6A 4D4NA 2AT9A 3EPVA 5KYUA 3Q7GA 3UTXA 2GDCA 2R7XA 2PX0A 2A0BA 3S28A 1FBBA 3VAYA 4PFPA 3OEOA 2AWYA 2YKZA 3DE8A 1QLEC 1FNTc 3E70C 4KI2A 3B9QA 3QJUB 4CS9A 3KYIA 4K7BA 4IB4A 2P0NA 2J7PD 4NTFA 3ITFA 4LDRA 3QJVB 2Z55A 4MNDA 3F46A 4ER9A 4A2NB 4OIOF 3WODF 3S8GB 4JVSA 4HWLA 1ST6A 3DQBA 4CSAC 1PV3A 3TULA 3EFOA 3DWWA 3FAPB 3ZSUA 4K5YA 3HTKC 3IQ6A 4K0DA 4AX2A 2ZPAA 1DOWA 2KC3A 4NCQA 2HFIA 4DAJA 2YCYA 3TK0A 2GA0A 4AL0A 1Z6AA 1GU8A 1B68A 2P61A 4MVOA 1FBKA 5BQHA 4O7GA 1HY5A 1J8YF 2NUPB 4U5HA 3GWNA 3UR3C 3I4UA 1PD1A 3LJBA 2YHSA 2HPYA 1T6QA 4MW3A 2NTWA 2KYHA 4NQFA 1ZHZA 1M2VA 2PNOA 3DAGA 1PD0A 4G78A 2ZFEA 1MQVA 3C8GB 1Q5JA 2R7VA 3C18A 4M63A 2ZXOA 2L9JA 4RBNA 4J4QA 1MGYA 3QVYA 3QZCA 5H2IA 3NY9A 3ATPA 2YCZA 3MFNA 1A0BA 1Q5IA 1P8HA 1C02A 1UCQA 2BL2A 2QY9A 1V54C 3FDQA 4QDLA 4FA7B 2LCHA 1K05A 1ZHYA 4PJLA 1HW2A 2J46A 3LEOA 3LEVA 5B2NA 3NKDA 1TWCA 3EZIA 1LIHA 3M79A 3V5XA 2Y03A 4JQ6A 3LLKA 1OW7A 4U9DA 2PEDA 4L6RA 4BPMA 2YLDA 2Z73A 4LDEA 3SXKA 5AX1A 5F5HA 2QPDB 3EH4B 3AOUA 1ZW3A 2R7WA 4BEZA 5A8EA 3R7CA 3JT1A 3NDBB 1XWJA 2NUTB 1MMGA 3KJ6A 3FMSA 3VW7A 3RIPA 4LDQA 5TGZA 5CIVA 4UDVA 4O79A 3KH2A 4JURI 4XTLA 4A4AA 5E3CA 2WL8A 2HS5A 3O10A 3NYMA 4GP4B 4PXFA 4OIQF 4XT1A 1I5NA 1FAPB 1RJ9A 2LK4A 2LFDA 1CGNA 1Y4CA 4XT3A 4MTFA 3C9LA 3JSEO 4ONSA 2GAQA 1EQ1A 4PJNA 4DJHA 2OQMA 4KLYA 3UMHA 5H2LA 3W8IA 1LKXA 2LQGA 3N2ZB 1ORYA 5KYUB 4G7ZF 2A69F 1NBBA 1JPNA 3G4XA 3IPMO 2YLIA 2PF4E 1SMYF 1YA9A 5B1BC 2IM8A 4LACB 1KG8A 3TOLA 5DQZA 1M6TA 4J32B 3HANA 2KSFA 3GM3A 1NG1A 2Q00A 3EH2A 4WW3A 3C62A 1KMEA 3EH3B 1MMAA 1NFOA 2HV6A 1EI7A 1QPUA 2C04A 3DM5A 2WZFA 2J0WA 4CDAA 5L0CA 4DKLA 1F88A 4QIDA 4U9EA 1CGME 5CI8A 4CSAA 3C8ZA 1TQGA 3VM6A 2IXMA 2M4EA 4EBJA 3WHNA 3M1CB 3EFOB 1TWGA 2R9RB 3M4CA 1AT9A 3QJTB 1U6HA 2XL4A 4JJGA 1ZHXA 5JUAA 1LS1A 1DZEA 1Q0DA 2IXOA 2RD9A 2AVKA 2PX3A 3NRHA 5EGYA 1PY6A 3S0XA 1BBHA 4ANJA 2Q7RA 3PWHA 3B0PA 3PCVA 2KK1A 2FFHA 2B0JA 4AMJA 1BDJB 3RW0A 3ZQVA 2R25A 1LI5A 2XLMA 1F1MA 4ULWA 3QDCA 5B6XA 1M2VB 3U2LA 5B1AC 2LNLA 1LM3B 4JCHA 1NU7D 1W2WA 3VF0A 3Q7LA 1NZEA 1M56C 1HMOA 2YL3A 2L6FA 4GPOA 2UUHA 3K33A 4JW1A 2IXPA 1A7DA 2R7UA 2YDOA 4CS7A 4MVUA 1VYIA 3HLZA 2A6EF 2YL1A 256BA 2QUPA 5F8UA 4PJMA 3CSKA 3QW1A 2R05A 1SYQA 2CGEA 1YZAA 1XJIA 2Y00A 4C3EA 3U0CA 1H2SA 4JEAA 1F4ZA 2XL6A 4WABA 2KSBA 4J30B 3T6BA 1Q0GA 3VVKA 5L0GA 1HW1A 1JFPA 4CIPA 2UUIA 1A7VA 2YCWA 2J9BA 5L0FA 4XXJA 4XWJA 2EINC 5H2PA 4XEKA 1YJGA 1BR2A 3PHF2 4K1OA 2KSYA 5H2MA 4WAVA 3EG9A 1RKEA 2VCAA 3FOPA 4XLNF 5A6AA 2OG2A 2RH1A 1OXBA 1RJ9B 2F95A 1OR3A 1BRXA 3AG3C 2XLDA 3C63A 1M0LA 1PXSA 1BRDA 2EPMX 1XMEB 2VT4A 2I20A 4D4XA 2G62A 3UMKA 4QI1A 3RFMA 4E0HA 4DRIB 5KYNA 1TN0A 3RKOF 3K7DA 2ZZLA 2EPOA 4KNFA 3SZRA 3ZTMA 3S3CB 3G50A 3HARA 1C03A 3EMLA 1WATA 1IW6A 3GANA 3GM2A 4YJWA 4I1OB 1LE4A 1NFNA 1XZQA 1JAFA 2Y69C 1F50A 2J7PA 4UG2A 4MVRA 3EGDA 1HE1A 3PBLA 4ZLCA 3NY8A 3NKEA 3B0VC 1R2NA 4MVQA 2VCBA 5DQTA 2LD6A 5DS4A 2OJQA 4NTAA 1ZHWA 5JP7A 3DXJF 2OEXA 4JKVA 3L1MA 3SYNA 1OW6A 3U3FA 1VMAA 3Q6NA 2XLVA 2CNWD 1AUEA 4R32A 3QBKA 1Z23A 5F28E 3X1OA 5FCLA 4HEAJ 3R2PA 3X3CA 1DOVA 4E0IA 4IJJA 2YVKA 2H7VC 2WVNA 4O6YA 5KYWA 4QI0A 4IWBA 2BC5A 1D0ZA 1VB5A 2X72A 4Y9HA 2AU5A 4JTCB 1OCCC 5L0DA 2M64A 1GZMA 3AYNA 5L0HA 5A45A 4J7TA 4U5FE 3EGXA 2Y04A 1E83A 4YL1A 3AGTA 3X3BA 2YLGA 1MMDA 2HJMA 2DGJA 3LLIA 5DVWA 3AQCA 4N6HA 4MBSA
chains in the Genus database with same CATH topology
4G72B 3QBLA 4U9DA 3P0GA 3HNLA 1S53A 2PEDA 5G54A 4L6RA 5AZDA 2JAGA 2YLDA 4EJ4A 2Z73A 3A7KA 4LDEA 5AX1A 4BEZA 2QPDB 3EH4B 5A8EA 1YYXA 1R84A 1M0MA 4G7RB 1YYJA 4MQSA 2XLOA 5B6VA 2Y01A 3KJ6A 3VW7A 1KG9A 5TGZA 3HAPA 2JAFA 4XTLA 3UZCA 1CGOA 2KSAA 4N4WA 5B3IA 5ITEA 5BR5A 1KGBA 4GP4B 3AM6A 4PXFA 5ETZA 1E0PA 2KS9A 5H2JA 1S05A 5JJEA 4XT1A 3OE6A 4GYCA 1CGNA 4A4MA 4XT3A 4MD2A 3C9LA 1S8JA 4EIYA 5H2NA 4G7QB 3COCA 5B35A 1CWQA 3UTWA 4DJHA 5AGFA 3PQRA 1VJMA 4KLYA 5DYSA 2CCYA 1IW9A 5H2LA 3M4BA 4X32A 3UTYA 1NBBA 4HYJA 4UHRA 2YLIA 1X0SA 2ZIYA 2F93A 5B0WA 1KG8A 3ABWA 3TOLA 4PXKA 1M6TA 5JVEA 1E84A 3D4SA 4X31A 3HANA 3VI0A 4ULVA 3OE0A 3C9MA 3VHZA 4WW3A 4FAAB 3OE8A 3C62A 5H2OA 4XTOA 1KMEA 3EH3B 4CDYA 5J7AA 1C8SA 3OAXA 2WJLA 4CJOA 2J8WA 2L6XA 5BR2A 3UONA 1TN5A 4BEYA 1QPUA 3AYMA 1VGOA 2YL0A 3QVZA 4CDAA 4DKLA 4MQTA 1F88A 4QIDA 4GRVA 4U9EA 4IARA 3HNJA 4EA3A 1E86A 3OE9A 2J4YA 1QKPA 4WGZA 4DS7E 3ZWIA 1JV6A 3HNKA 3M4CA 5B6WA 5DHGA 1AT9A 3QJTB 1JV7A 3NYAA 3QJRB 5G2DA 4G7SB 4JE9A 3NMIA 2BRDA 1C3WA 5JUAA 1DZEA 1X0K1 1PXRA 1X0I1 1UAZA 3PXOA 1PY6A 1BBHA 2M3GA 2I21A 3ZEVA 3PWHA 4CX9A 3HASA 5ITCA 5DHHA 3UTVA 3IQ5A 4AMJA 3UG9A 4LDOA 5JJJA 5LWEA 3ZQVA 1L9HA 3QDCA 2XLMA 1APCA 1E85A 1S51A 5B6XA 4L35A 2LNLA 1BM1A 1LM3B 5G28A 3S3DB 3ZPRA 5AHYA 3VRCA 1QKOA 2YL3A 5JT4A 4CJGA 1S52A 3QAPA 1AP9A 1QM8A 4GPOA 1HZXA 3ODUA 4XTNA 3V2WA 2XM4A 5B6YA 2XLHA 2YDOA 5AX0A 1CPRA 4BVNA 5G53A 2YL1A 256BA 3DDLA 5F8UA 3VG9A 5JSLA 2XLWA 1M0KA 3HNIA 3QW1A 5FJGA 2WJKA 1YZAA 1XJIA 2EI4A 3V2YA 4LDLA 2Y00A 4G71B 5H2KA 1XIOA 1H2SA 4JEAA 1F4ZA 2XL6A 4FPDA 2KSBA 3RZEA 3QAKA 4WGYA 4BWBA 4X1HA 3NSBA 5AHZA 3QBGA 3VVKA 3NMJA 1L0MA 3DE9A 3S3BB 3REYA 4G70B 1JFPA 4CIPA 4IAQA 4BV0A 3FOOA 3BVDB 4AMIA 1A7VA 2XM0A 4FBZA 1LN6A 4D4NA 2AT9A 2YCWA 2J9BA 1QQ3A 3UTXA 4XXJA 5H2PA 1S8LA 2YCXA 1O0AA 3EH5B 4CDVA 1GUEA 1FBBA 4NC3A 1QHJA 2KSYA 5H2MA 4WAVA 3NS0A 2YDVA 4MD1A 1JGJA 3FOPA 3QJSB 2YKZA 3DE8A 1EKYA 2RH1A 1P8UA 4HYXA 2F95A 3QJUB 3VGAA 1BRXA 4IB4A 1RCPA 5G36A 3NMKA 2XLDA 3C63A 1M0LA 1PXSA 3QJVB 1BRDA 1XMEB 2Z55A 3TOMA 2VT4A 2I20A 1CPQA 5B6ZA 4D4XA 4QI1A 3RFMA 4ER9A 4QRYA 1TN0A 3SN6R 3S8GB 3CAPA 4HWLA 3DQBA 2ZZLA 4KNFA 3ZTMA 3S3CB 4N4YB 3ZPQA 3HARA 4K5YA 1P8IA 3IQ6A 3QW0A 4GP5B 5KKHA 1EHKB 3WQJA 5JS5A 4DAJA 2XL8A 2YCYA 3EMLA 1GQAA 1IW6A 5JRAA 2Y02A 5B34A 1JAFA 5JJNA 1GU8A 3ZQYA 1FBKA 1F50A 4JR8A 4UG2A 3PBLA 3NY8A 2G87A 1C8RA 2HPYA 2R4SA 3UZAA 3PDSA 2NTWA 3QBIA 1R2NA 4BUOA 3QJQB 3CODA 2I35A 5JLIA 5G2AA 3T45A 5JP7A 1U19A 2ZFEA 3S8FB 3HAOA 1MQVA 5C1MA 1Q5JA 4JKVA 5H2HA 3L1MA 4JEBA 4J4QA 2XLVA 1MGYA 5AWZA 2R4RA 3QBKA 3QVYA 2YL7A 5H2IA 3NY9A 1BRRA 3X3CA 4TL3A 5EN0A 2I1XA 2YCZA 1H68A 1Q5IA 1P8HA 2BC5A 2NTUA 2X72A 4Y9HA 1GZMA 3M15A 1UCQA 3AYNA 5A45A 2XLEA 4FA7B 2Y04A 1YZCA 2QLAA 2QPEB 1E12A 1E83A 1S54A 4GBRA 3ZTZA 4OV0A 4GP8B 3U8PA 5B2NA 3X3BA 2YLGA 1IXFA 3HAQA 3M79A 2Y03A 5A44A 4N6HA 4JQ6A 3MBVA 5G2CA 4MBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G72 B;  3QBL A;  4U9D A;  3P0G A;  3HNL A;  1S53 A;  2PED A;  5G54 A;  4L6R A;  5AZD A;  2JAG A;  2YLD A;  4EJ4 A;  2Z73 A;  3A7K A;  4LDE A;  5AX1 A;  4BEZ A;  2QPD B;  3EH4 B;  5A8E A;  1YYX A;  1R84 A;  1M0M A;  4G7R B;  1YYJ A;  4MQS A;  2XLO A;  5B6V A;  2Y01 A;  3KJ6 A;  3VW7 A;  1KG9 A;  5TGZ A;  3HAP A;  2JAF A;  4XTL A;  3UZC A;  1CGO A;  2KSA A;  4N4W A;  5B3I A;  5ITE A;  5BR5 A;  1KGB A;  4GP4 B;  3AM6 A;  4PXF A;  5ETZ A;  1E0P A;  2KS9 A;  5H2J A;  1S05 A;  5JJE A;  4XT1 A;  3OE6 A;  4GYC A;  1CGN A;  4A4M A;  4XT3 A;  4MD2 A;  3C9L A;  1S8J A;  4EIY A;  5H2N A;  4G7Q B;  3COC A;  5B35 A;  1CWQ A;  3UTW A;  4DJH A;  5AGF A;  3PQR A;  1VJM A;  4KLY A;  5DYS A;  2CCY A;  1IW9 A;  5H2L A;  3M4B A;  4X32 A;  3UTY A;  1NBB A;  4HYJ A;  4UHR A;  2YLI A;  1X0S A;  2ZIY A;  2F93 A;  5B0W A;  1KG8 A;  3ABW A;  3TOL A;  4PXK A;  1M6T A;  5JVE A;  1E84 A;  3D4S A;  4X31 A;  3HAN A;  3VI0 A;  4ULV A;  3OE0 A;  3C9M A;  3VHZ A;  4WW3 A;  4FAA B;  3OE8 A;  3C62 A;  5H2O A;  4XTO A;  1KME A;  3EH3 B;  4CDY A;  5J7A A;  1C8S A;  3OAX A;  2WJL A;  4CJO A;  2J8W A;  2L6X A;  5BR2 A;  3UON A;  1TN5 A;  4BEY A;  1QPU A;  3AYM A;  1VGO A;  2YL0 A;  3QVZ A;  4CDA A;  4DKL A;  4MQT A;  1F88 A;  4QID A;  4GRV A;  4U9E A;  4IAR A;  3HNJ A;  4EA3 A;  1E86 A;  3OE9 A;  2J4Y A;  1QKP A;  4WGZ A;  3ZWI A;  1JV6 A;  3HNK A;  3M4C A;  5B6W A;  5DHG A;  1AT9 A;  3QJT B;  1JV7 A;  3NYA A;  3QJR B;  5G2D A;  4G7S B;  4JE9 A;  3NMI A;  2BRD A;  1C3W A;  5JUA A;  1DZE A;  1X0K 1;  1PXR A;  1X0I 1;  1UAZ A;  3PXO A;  1PY6 A;  1BBH A;  2M3G A;  2I21 A;  3ZEV A;  3PWH A;  4CX9 A;  3HAS A;  5ITC A;  5DHH A;  3UTV A;  3IQ5 A;  4AMJ A;  3UG9 A;  4LDO A;  5JJJ A;  5LWE A;  3ZQV A;  1L9H A;  3QDC A;  2XLM A;  1APC A;  1E85 A;  1S51 A;  5B6X A;  4L35 A;  2LNL A;  1BM1 A;  1LM3 B;  5G28 A;  3S3D B;  3ZPR A;  5AHY A;  3VRC A;  1QKO A;  2YL3 A;  5JT4 A;  4CJG A;  1S52 A;  3QAP A;  1AP9 A;  1QM8 A;  4GPO A;  1HZX A;  3ODU A;  4XTN A;  3V2W A;  2XM4 A;  5B6Y A;  2XLH A;  2YDO A;  5AX0 A;  1CPR A;  4BVN A;  5G53 A;  2YL1 A;  256B A;  3DDL A;  5F8U A;  3VG9 A;  5JSL A;  2XLW A;  1M0K A;  3HNI A;  3QW1 A;  5FJG A;  2WJK A;  1YZA A;  1XJI A;  2EI4 A;  3V2Y A;  4LDL A;  2Y00 A;  4G71 B;  5H2K A;  1XIO A;  1H2S A;  4JEA A;  1F4Z A;  2XL6 A;  4FPD A;  2KSB A;  3RZE A;  3QAK A;  4WGY A;  4BWB A;  4X1H A;  3NSB A;  5AHZ A;  3QBG A;  3VVK A;  3NMJ A;  1L0M A;  3DE9 A;  3S3B B;  3REY A;  4G70 B;  1JFP A;  4CIP A;  4IAQ A;  4BV0 A;  3FOO A;  3BVD B;  4AMI A;  1A7V A;  2XM0 A;  4FBZ A;  1LN6 A;  4D4N A;  2AT9 A;  2YCW A;  2J9B A;  1QQ3 A;  3UTX A;  4XXJ A;  5H2P A;  1S8L A;  2YCX A;  1O0A A;  3EH5 B;  4CDV A;  1GUE A;  1FBB A;  4NC3 A;  1QHJ A;  2KSY A;  5H2M A;  4WAV A;  3NS0 A;  2YDV A;  4MD1 A;  1JGJ A;  3FOP A;  3QJS B;  2YKZ A;  3DE8 A;  1EKY A;  2RH1 A;  1P8U A;  4HYX A;  2F95 A;  3QJU B;  3VGA A;  1BRX A;  4IB4 A;  1RCP A;  5G36 A;  3NMK A;  2XLD A;  3C63 A;  1M0L A;  1PXS A;  3QJV B;  1BRD A;  1XME B;  2Z55 A;  3TOM A;  2VT4 A;  2I20 A;  1CPQ A;  5B6Z A;  4D4X A;  4QI1 A;  3RFM A;  4ER9 A;  4QRY A;  1TN0 A;  3SN6 R;  3S8G B;  3CAP A;  4HWL A;  3DQB A;  2ZZL A;  4KNF A;  3ZTM A;  3S3C B;  4N4Y B;  3ZPQ A;  3HAR A;  4K5Y A;  1P8I A;  3IQ6 A;  3QW0 A;  4GP5 B;  5KKH A;  1EHK B;  3WQJ A;  5JS5 A;  4DAJ A;  2XL8 A;  2YCY A;  3EML A;  1GQA A;  1IW6 A;  5JRA A;  2Y02 A;  5B34 A;  1JAF A;  5JJN A;  1GU8 A;  3ZQY A;  1FBK A;  1F50 A;  4JR8 A;  4UG2 A;  3PBL A;  3NY8 A;  2G87 A;  1C8R A;  2HPY A;  2R4S A;  3UZA A;  3PDS A;  2NTW A;  3QBI A;  1R2N A;  4BUO A;  3QJQ B;  3COD A;  2I35 A;  5JLI A;  5G2A A;  3T45 A;  5JP7 A;  1U19 A;  2ZFE A;  3S8F B;  3HAO A;  1MQV A;  5C1M A;  1Q5J A;  4JKV A;  5H2H A;  3L1M A;  4JEB A;  4J4Q A;  2XLV A;  1MGY A;  5AWZ A;  2R4R A;  3QBK A;  3QVY A;  2YL7 A;  5H2I A;  3NY9 A;  1BRR A;  3X3C A;  4TL3 A;  5EN0 A;  2I1X A;  2YCZ A;  1H68 A;  1Q5I A;  1P8H A;  2BC5 A;  2NTU A;  2X72 A;  4Y9H A;  1GZM A;  3M15 A;  1UCQ A;  3AYN A;  5A45 A;  2XLE A;  4FA7 B;  2Y04 A;  1YZC A;  2QLA A;  2QPE B;  1E12 A;  1E83 A;  1S54 A;  4GBR A;  3ZTZ A;  4OV0 A;  4GP8 B;  3U8P A;  5B2N A;  3X3B A;  2YLG A;  1IXF A;  3HAQ A;  3M79 A;  2Y03 A;  5A44 A;  4N6H A;  4JQ6 A;  3MBV A;  5G2C A;  4MBS A; 
#chains in the Genus database with same CATH topology
 2A6H F;  2FGY A;  3RVY A;  1SR2 A;  5G54 A;  3T6G B;  1FR0 A;  1I4Y A;  4B6I A;  1M0M A;  3ABL C;  4XPW A;  4MQS A;  2XLO A;  2J9V A;  4XPX A;  1T01 A;  3ZG1 A;  4XEF A;  2HSB A;  4N4W A;  3W2V A;  1C17 M;  4H4K C;  4JJF A;  4CS8 C;  4DBR A;  3K1H A;  3O6X A;  5ETZ A;  1E0P A;  2VB6 A;  4GYC A;  4A4M A;  3ZVR A;  4EIY A;  4EKW A;  2LSE A;  3COC A;  3ZC4 A;  5AGF A;  3FAJ A;  1VJM A;  1IW9 A;  2L6H A;  3BEH A;  5L0I A;  2YQY A;  1ZW2 A;  2PFD A;  4AE4 A;  4X32 A;  3UTY A;  3B29 A;  4HYJ A;  4YT2 A;  3EG9 B;  3ABW A;  1RKE B;  5B0W A;  4PXK A;  1NLX A;  2Y39 A;  5HV9 A;  3K6B A;  5L3V A;  3OE0 A;  3OE8 A;  1ZZP A;  1XZP A;  1V4A A;  1C8S A;  4MVM A;  4JTD B;  4EHP A;  2WJL A;  5E33 A;  2G3V A;  1D0Y A;  3UON A;  1VGO A;  2YL0 A;  3MLG A;  4FAP B;  3B0U X;  4IAR A;  1D0X A;  3K1I C;  1G8X A;  4XEV A;  4KNW A;  1E86 A;  3OE9 A;  2W45 A;  4JZA A;  1QKP A;  1HE9 A;  2BE5 F;  2PBE A;  2EIM C;  3V7O A;  3CAX A;  1O5H A;  3QJR B;  1OKK A;  3AG1 C;  3MX3 A;  4G7S B;  4JE9 A;  3DJU B;  3AGU A;  4AK9 A;  2OCC C;  3A9C A;  4C7O A;  3GOD A;  3N0T A;  1UAZ A;  3PXO A;  1G4W R;  4MVS A;  1FMW A;  3ZEV A;  4DXW A;  5ITC A;  5DHH A;  3EH1 A;  5JJJ A;  1S7Z A;  2R7O A;  3U5S A;  2JD3 A;  4E18 A;  1APC A;  2Y3B A;  4I44 A;  5G28 A;  1WTY A;  3EZH A;  5AHY A;  1SF8 A;  1QKO A;  5JT4 A;  4KBL A;  4LLC A;  2Z15 A;  1QM8 A;  3DM9 B;  3EHM A;  3V2W A;  2XM4 A;  2XLH A;  4OD4 A;  4FX5 A;  5BQI A;  1M2O A;  3DDL A;  2DB4 A;  5KYW B;  5JSL A;  2XLW A;  1A7E A;  2VCC A;  2WJK A;  5CI9 A;  1AVO B;  3LUT B;  2LP4 A;  1WAS A;  3RQF A;  1SZI A;  3EGX B;  3C7J A;  3S9O A;  3TJ6 A;  4C3D A;  1D1C A;  3ABK C;  1BZ4 A;  3AQB A;  4WGY A;  1NSG B;  5AHZ A;  3FHD A;  3GM1 A;  3QMK A;  1H9G A;  1IW7 F;  3REY A;  5BQG A;  2A1D D;  1LE2 A;  3FOO A;  4AMI A;  3LES A;  1RKC A;  3HJC A;  2XM0 A;  2PP4 A;  1OCO C;  1QQ3 A;  2WVO A;  1V55 C;  2CYD A;  2RSE B;  2XSE A;  2YCX A;  1QVX A;  1O0A A;  3EH5 B;  4CDV A;  3SEO A;  2Q9A A;  2KW3 C;  4CS8 A;  1QHJ A;  3LNR A;  2IXN A;  2TMV P;  1TFK B;  3NS0 A;  1GGQ A;  1T5O A;  3K66 A;  1J8M F;  1JGJ A;  2QTV A;  1U89 A;  4G0H A;  3LAY A;  1HMD A;  1EKY A;  3JTL O;  4YN0 B;  2R02 A;  1V74 B;  2KQ9 A;  1YDI A;  3H65 A;  3NYJ A;  1LVK A;  3VGA A;  2J45 A;  3NMK A;  3CQZ A;  2C03 A;  4OIR F;  1Y6D A;  4PFO A;  3TOM A;  1CPQ A;  5B6Z A;  4Q4Z F;  3EQL F;  4AE4 B;  2WVQ A;  2AWC A;  1WGW A;  1OCZ C;  4QRY A;  3V5Y A;  5KYY A;  1R5I D;  2R03 A;  3CAP A;  1GM5 A;  1LPE A;  4OD5 A;  3ASN C;  4EUK B;  3ZPQ A;  2JPU A;  1P8I A;  3JYH A;  3WQJ A;  1QKR A;  2XL8 A;  1GQA A;  3T6J A;  3IEE A;  3RQE A;  3S29 A;  3ZQY A;  4C3B A;  3K1I A;  5BUO A;  4JR8 A;  3ZDL A;  2A0U A;  4Z9J A;  5A6K A;  1C8R A;  4CS9 C;  2R4S A;  4DRH B;  3PDS A;  4DVZ A;  2MWQ A;  2J0X A;  1YVI A;  4BUO A;  3QJQ B;  1Q0F A;  2DI3 A;  3UGO A;  5G2A A;  3T45 A;  3GEE A;  2EPK X;  1U19 A;  1OQC A;  3N24 A;  4Z9I A;  3HAO A;  3S8F B;  5C1M A;  1ZHT A;  5IY5 C;  1JRA A;  1D1B A;  2EPL X;  5H2H A;  3SP1 A;  4JEB A;  3SXM A;  4KC9 A;  1U0B B;  2R4R A;  2YL7 A;  1T9K A;  4C7O B;  3I5P A;  1BRR A;  5A69 A;  4TL3 A;  1Z3I X;  1O87 A;  5EN0 A;  4RDA A;  4AL1 A;  4XPY A;  3IQT A;  1H68 A;  4XLP F;  2NTU A;  2NUP A;  4PJJ A;  2FAP B;  3M15 A;  3JRT A;  3S27 A;  5AC5 A;  4WJ0 A;  2QLA A;  4Z9H A;  2QPE B;  2KNH A;  1E12 A;  4MW8 A;  1VLS A;  2D5R B;  2GWW A;  4LDK A;  4EBB A;  3U8P A;  2R7T A;  1VTM P;  1IXF A;  3T9O A;  4O6N A;  1EA8 A;  3L8I A;  5G2C A;  4G72 B;  3QBL A;  1S53 A;  2CNW A;  3L0I A;  3KL4 A;  3A7K A;  3RVZ A;  1JMW A;  4U5D E;  2WZL A;  1YYX A;  3WAQ A;  2P7V A;  4G7R B;  1YYJ A;  2L7A A;  2AP3 A;  1IZM A;  2YEV A;  2ICW G;  3TD7 A;  2KSA A;  1KU2 A;  4F4B A;  4PAC A;  5BR5 A;  4MTO A;  2Y3H A;  5H2J A;  1YA7 O;  2F22 A;  1I4Z A;  1S8J A;  4YT5 A;  2B0H A;  4E7S A;  2R7S A;  5EK0 A;  4JTA B;  5B35 A;  1CWQ A;  4DOZ A;  5L3Q A;  2R7R A;  1TKN A;  1YLM A;  1G4U S;  1KNY A;  2WZG A;  4BJ6 C;  3G4Z A;  4BEJ A;  3OWT A;  2NUT A;  4UHR A;  5AC4 A;  3DMD A;  1X0S A;  1VLT A;  3VYW A;  2OEV A;  4G7H F;  2ZIY A;  3C8G D;  4CBE A;  5JVE A;  1E84 A;  2EPN A;  4X31 A;  3ECS A;  4I3M A;  4ZLD A;  4ULV A;  2P1A A;  5B3S C;  5E2Q A;  3WG7 C;  4DBQ A;  4YT4 A;  1H7I A;  1A41 A;  5H2O A;  4XTO A;  3OAX A;  5A6B D;  3UNG C;  3O39 A;  4CJO A;  2J8W A;  3U2M A;  2L6X A;  2XS8 A;  4E7Z A;  2XS1 A;  3KKB A;  3J06 A;  3AYM A;  4GQH A;  4W8P A;  4GRV A;  4EA3 A;  4X0R A;  5KYY B;  3S84 A;  4RD9 A;  2J4Y A;  1JV6 A;  2ZXW C;  2Q3T A;  1Q0M A;  2ZXP A;  3HNK A;  2NSF A;  5B6W A;  5DHG A;  1AEP A;  1JV7 A;  3NYA A;  1VK5 A;  4HFF B;  1Z63 A;  1X0K 1;  1PXR A;  2WB7 A;  1X0I 1;  5COF A;  5F5F A;  5FZT A;  1UG7 A;  5T3T A;  3ZIB A;  3E9V A;  2Q4F A;  4CX9 A;  2DYR C;  3UTV A;  5GPG B;  3UG9 A;  1OCR C;  1FFH A;  4P9T A;  3U9J A;  2HJ3 A;  3ABM C;  4L35 A;  3QTH A;  1OXK A;  4H54 A;  1BR4 A;  2HMZ A;  3IQC A;  3ZPR A;  3VRC A;  2L6G A;  1S52 A;  3QAP A;  1ORS C;  4P9F A;  3DKA A;  1M57 C;  3CZ6 A;  4BVN A;  5G53 A;  1MMN A;  4PK4 A;  2ASR A;  4CIH A;  4YK5 A;  3VG9 A;  2NG1 A;  2R7Q A;  3U8V A;  1TWA A;  3RQG A;  4N6C A;  2Q9B A;  4QI2 A;  2EI4 A;  3V2Y A;  4LDL A;  1VYK A;  4G71 B;  3MYF A;  4IGG A;  4FPD A;  2MHR A;  2YRF A;  3RZE A;  2CW0 F;  3QAK A;  2OU6 A;  2A68 F;  4BWB A;  3NSB A;  3QBG A;  3NMJ A;  1FMV A;  2LIG A;  3DE9 A;  3S3B B;  3DI5 A;  2EIL C;  1KTM A;  4FBZ A;  4FWV A;  4U5G A;  4DRJ B;  5D92 A;  1S8L A;  1LI7 A;  1K04 A;  1GUE A;  3DAF A;  2MYS A;  4DVY P;  2OOC A;  4NC3 A;  4HFK B;  2YDV A;  4U5B E;  4MD1 A;  4OIN F;  1QZX A;  5HSW A;  3QJS B;  1VOM A;  4E17 A;  3V5Z A;  4XTK A;  3KPH A;  1P8U A;  4HYX A;  5K0I A;  5KYX A;  2JX0 A;  2IYL D;  4BJ6 A;  3MYI A;  1RCP A;  5G36 A;  3EHN A;  5COM A;  4OIP F;  3EGD B;  3OA1 A;  3S90 A;  4DJ9 A;  1R4T A;  3RF3 A;  2ZD9 A;  3H2U A;  2W4B A;  3SN6 R;  4KNV A;  4YWQ A;  3JZ0 A;  1RXQ A;  4N4Y B;  3AJM A;  1GS9 A;  1WWP A;  2H7O A;  1WOL A;  3QW0 A;  4GP5 B;  2NPU A;  5KKH A;  1EHK B;  3GOR A;  5JS5 A;  1ZU4 A;  4BEM J;  3GWL A;  5T1D B;  5JRA A;  3NG1 A;  2Y02 A;  5B34 A;  5JJN A;  2HSQ A;  1UFB A;  2VC9 A;  1OR2 A;  2G87 A;  2G3K A;  2L81 A;  3UZA A;  4LLE A;  3TQO A;  3QBI A;  1G5Z A;  4YT8 A;  3COD A;  3GEI A;  4NY3 A;  2I35 A;  5JLI A;  3PDM P;  2IOQ A;  3F47 A;  5A6J A;  2XXA A;  2Y3D A;  3US6 A;  1OKK D;  2O9X A;  5AWZ A;  3DJN B;  1T6I A;  2V3C C;  1L7C A;  3JYY A;  3ASO C;  2KJG A;  5DLJ A;  4MTG A;  1JR8 A;  1ORJ A;  2I1X A;  3RH3 A;  3TJ5 A;  3FVY A;  2I8B A;  1FTS A;  2XLE A;  1YZC A;  2X51 A;  1H6G A;  1S54 A;  4GBR A;  3ZTZ A;  4OV0 A;  4BJT A;  4GP8 B;  1WN0 A;  1FFT C;  3DD7 A;  3I5Q A;  4BJ5 C;  1ZU5 A;  3HAQ A;  2QE9 A;  5A44 A;  3MBV A;  3P0G A;  3SXY A;  3HNL A;  1PCX A;  3A11 A;  5AZD A;  3RFY A;  2W9Y A;  2JAG A;  4EJ4 A;  2E87 A;  3AG2 C;  5T3W A;  1R84 A;  2H8A A;  5B6V A;  2Y01 A;  1KG9 A;  3KMI A;  3HAP A;  1QSP A;  2JAF A;  3SXZ A;  3IHU A;  1CGO A;  3UZC A;  2KGO A;  4MS2 A;  2Q9C A;  4HE8 D;  5B3I A;  2YZS A;  5ITE A;  3KYJ A;  2CDQ A;  1KGB A;  5DS5 A;  3AM6 A;  2D4U A;  3SNH A;  4JCZ A;  3DZA A;  4IRU A;  2KS9 A;  1S05 A;  5JJE A;  3AG4 C;  3OE6 A;  2I15 A;  2DYS C;  4YL3 A;  3PMR A;  2HV7 A;  4BJ1 A;  4MD2 A;  5TJ5 E;  5H2N A;  4G7Q B;  2J9U A;  4LER A;  3UTW A;  1MNE A;  1YAR O;  3PQR A;  1YAU O;  5DYS A;  1Z7Q c;  2CCY A;  2H7B A;  3L8J A;  1Z5Z A;  3M4B A;  4EBK A;  4JIO A;  2YWA A;  4I1M A;  5E3A A;  3BRJ A;  5DS6 A;  1D1A A;  2EIK C;  3L34 A;  2F93 A;  2ETS A;  5EHH A;  3D4S A;  3VI0 A;  1LS4 A;  3X2Q C;  3C9M A;  4IAO A;  3H2V A;  1L3P A;  3VHZ A;  4FAA B;  3UGP A;  3T4R A;  5KYX B;  1ZVZ A;  4CDY A;  5J7A A;  2NSG A;  5L0J A;  3EJN A;  1H9T A;  1ZYR F;  3RYL A;  5BR2 A;  1TN5 A;  4BEY A;  2X0C A;  3QVZ A;  1JPJ A;  4MQT A;  3HNJ A;  3LNM B;  2XRH A;  1OW8 A;  4GEH A;  1O3U A;  3Q6M A;  4MQ9 F;  4WGZ A;  4DS7 E;  3ZWI A;  2HMQ A;  2VH3 A;  3JSZ A;  4YL0 A;  3C8G A;  4MVZ A;  2HZ8 A;  2LFF A;  4O6M A;  5G2D A;  2BRD A;  3NMI A;  4G7O F;  1C3W A;  2HUJ A;  3GEH A;  2OKU A;  5A6B A;  1BR1 A;  3NYL A;  1TR2 A;  2M3G A;  2OJE D;  2I21 A;  2W4M A;  3W8H A;  3LS0 A;  1JOG A;  3HAS A;  1N1C A;  3CEX A;  3LS1 A;  3JCU Q;  3FXH A;  4FES A;  4P6I C;  3IQ5 A;  3W2W A;  4LDO A;  4XQ1 A;  4U5C E;  3UMI A;  5D91 A;  5LWE A;  1K40 A;  1MND A;  1L9H A;  1S51 A;  2HKV A;  1E85 A;  2J9W A;  3HKK A;  4N06 A;  1BM1 A;  2IBF A;  4W8K A;  3S3D B;  2XXA B;  3W4Y A;  1Q0K A;  4CJG A;  3O55 A;  1AP9 A;  1HZX A;  1E2X A;  3ODU A;  2EIJ C;  4XTN A;  5B6Y A;  3JRM O;  4U5E E;  5COG A;  5AX0 A;  4GYT A;  1CPR A;  4JC7 A;  4JRZ A;  3B71 A;  1TWH A;  4PR9 A;  2Y3G A;  1M0K A;  4J7Y A;  3HNI A;  2V26 A;  5FJG A;  3U3B A;  2VAS A;  2P6V A;  4BJ5 A;  2ZXR A;  1T6U A;  4BG0 A;  5H2K A;  1XIO A;  1RMV A;  4NTB A;  2GFH A;  4EWC A;  3U9M A;  1NU9 C;  4X1H A;  4Q5S F;  2QNL A;  1L0M A;  3MBG A;  4G70 B;  4Q7C A;  3POV A;  4IAQ A;  4BV0 A;  3BVD B;  1TFO B;  1LN6 A;  4D4N A;  2AT9 A;  3EPV A;  5KYU A;  3Q7G A;  3UTX A;  2GDC A;  2R7X A;  2PX0 A;  2A0B A;  3S28 A;  1FBB A;  3VAY A;  4PFP A;  3OEO A;  2AWY A;  2YKZ A;  3DE8 A;  1QLE C;  1FNT c;  3E70 C;  4KI2 A;  3B9Q A;  3QJU B;  4CS9 A;  3KYI A;  4K7B A;  4IB4 A;  2P0N A;  2J7P D;  4NTF A;  3ITF A;  4LDR A;  3QJV B;  2Z55 A;  4MND A;  3F46 A;  4ER9 A;  4A2N B;  4OIO F;  3WOD F;  3S8G B;  4JVS A;  4HWL A;  1ST6 A;  3DQB A;  4CSA C;  1PV3 A;  3TUL A;  3EFO A;  3DWW A;  3FAP B;  3ZSU A;  4K5Y A;  3HTK C;  3IQ6 A;  4K0D A;  4AX2 A;  2ZPA A;  1DOW A;  2KC3 A;  4NCQ A;  2HFI A;  4DAJ A;  2YCY A;  3TK0 A;  2GA0 A;  4AL0 A;  1Z6A A;  1GU8 A;  1B68 A;  2P61 A;  4MVO A;  1FBK A;  5BQH A;  4O7G A;  1HY5 A;  1J8Y F;  2NUP B;  4U5H A;  3GWN A;  3UR3 C;  3I4U A;  1PD1 A;  3LJB A;  2YHS A;  2HPY A;  1T6Q A;  4MW3 A;  2NTW A;  2KYH A;  4NQF A;  1ZHZ A;  1M2V A;  2PNO A;  3DAG A;  1PD0 A;  4G78 A;  2ZFE A;  1MQV A;  3C8G B;  1Q5J A;  2R7V A;  3C18 A;  4M63 A;  2ZXO A;  2L9J A;  4RBN A;  4J4Q A;  1MGY A;  3QVY A;  3QZC A;  5H2I A;  3NY9 A;  3ATP A;  2YCZ A;  3MFN A;  1A0B A;  1Q5I A;  1P8H A;  1C02 A;  1UCQ A;  2BL2 A;  2QY9 A;  1V54 C;  3FDQ A;  4QDL A;  4FA7 B;  2LCH A;  1K05 A;  1ZHY A;  4PJL A;  1HW2 A;  2J46 A;  3LEO A;  3LEV A;  5B2N A;  3NKD A;  1TWC A;  3EZI A;  1LIH A;  3M79 A;  3V5X A;  2Y03 A;  4JQ6 A;  3LLK A;  1OW7 A;  4U9D A;  2PED A;  4L6R A;  4BPM A;  2YLD A;  2Z73 A;  4LDE A;  3SXK A;  5AX1 A;  5F5H A;  2QPD B;  3EH4 B;  3AOU A;  1ZW3 A;  2R7W A;  4BEZ A;  5A8E A;  3R7C A;  3JT1 A;  3NDB B;  1XWJ A;  2NUT B;  1MMG A;  3KJ6 A;  3FMS A;  3VW7 A;  3RIP A;  4LDQ A;  5TGZ A;  5CIV A;  4UDV A;  4O79 A;  3KH2 A;  4JUR I;  4XTL A;  4A4A A;  5E3C A;  2WL8 A;  2HS5 A;  3O10 A;  3NYM A;  4GP4 B;  4PXF A;  4OIQ F;  4XT1 A;  1I5N A;  1FAP B;  1RJ9 A;  2LK4 A;  2LFD A;  1CGN A;  1Y4C A;  4XT3 A;  4MTF A;  3C9L A;  3JSE O;  4ONS A;  2GAQ A;  1EQ1 A;  4PJN A;  4DJH A;  2OQM A;  4KLY A;  3UMH A;  5H2L A;  3W8I A;  1LKX A;  2LQG A;  3N2Z B;  1ORY A;  5KYU B;  4G7Z F;  2A69 F;  1NBB A;  1JPN A;  3G4X A;  3IPM O;  2YLI A;  2PF4 E;  1SMY F;  1YA9 A;  5B1B C;  2IM8 A;  4LAC B;  1KG8 A;  3TOL A;  5DQZ A;  1M6T A;  4J32 B;  3HAN A;  2KSF A;  3GM3 A;  1NG1 A;  2Q00 A;  3EH2 A;  4WW3 A;  3C62 A;  1KME A;  3EH3 B;  1MMA A;  1NFO A;  2HV6 A;  1EI7 A;  1QPU A;  2C04 A;  3DM5 A;  2WZF A;  2J0W A;  4CDA A;  5L0C A;  4DKL A;  1F88 A;  4QID A;  4U9E A;  1CGM E;  5CI8 A;  4CSA A;  3C8Z A;  1TQG A;  3VM6 A;  2IXM A;  2M4E A;  4EBJ A;  3WHN A;  3M1C B;  3EFO B;  1TWG A;  2R9R B;  3M4C A;  1AT9 A;  3QJT B;  1U6H A;  2XL4 A;  4JJG A;  1ZHX A;  5JUA A;  1LS1 A;  1DZE A;  1Q0D A;  2IXO A;  2RD9 A;  2AVK A;  2PX3 A;  3NRH A;  5EGY A;  1PY6 A;  3S0X A;  1BBH A;  4ANJ A;  2Q7R A;  3PWH A;  3B0P A;  3PCV A;  2KK1 A;  2FFH A;  2B0J A;  4AMJ A;  1BDJ B;  3RW0 A;  3ZQV A;  2R25 A;  1LI5 A;  2XLM A;  1F1M A;  4ULW A;  3QDC A;  5B6X A;  1M2V B;  3U2L A;  5B1A C;  2LNL A;  1LM3 B;  4JCH A;  1NU7 D;  1W2W A;  3VF0 A;  3Q7L A;  1NZE A;  1M56 C;  1HMO A;  2YL3 A;  2L6F A;  4GPO A;  2UUH A;  3K33 A;  4JW1 A;  2IXP A;  1A7D A;  2R7U A;  2YDO A;  4CS7 A;  4MVU A;  1VYI A;  3HLZ A;  2A6E F;  2YL1 A;  256B A;  2QUP A;  5F8U A;  4PJM A;  3CSK A;  3QW1 A;  2R05 A;  1SYQ A;  2CGE A;  1YZA A;  1XJI A;  2Y00 A;  4C3E A;  3U0C A;  1H2S A;  4JEA A;  1F4Z A;  2XL6 A;  4WAB A;  2KSB A;  4J30 B;  3T6B A;  1Q0G A;  3VVK A;  5L0G A;  1HW1 A;  1JFP A;  4CIP A;  2UUI A;  1A7V A;  2YCW A;  2J9B A;  5L0F A;  4XXJ A;  4XWJ A;  2EIN C;  5H2P A;  4XEK A;  1YJG A;  1BR2 A;  3PHF 2;  4K1O A;  2KSY A;  5H2M A;  4WAV A;  3EG9 A;  1RKE A;  2VCA A;  3FOP A;  4XLN F;  5A6A A;  2OG2 A;  2RH1 A;  1OXB A;  1RJ9 B;  2F95 A;  1OR3 A;  1BRX A;  3AG3 C;  2XLD A;  3C63 A;  1M0L A;  1PXS A;  1BRD A;  2EPM X;  1XME B;  2VT4 A;  2I20 A;  4D4X A;  2G62 A;  3UMK A;  4QI1 A;  3RFM A;  4E0H A;  4DRI B;  5KYN A;  1TN0 A;  3RKO F;  3K7D A;  2ZZL A;  2EPO A;  4KNF A;  3SZR A;  3ZTM A;  3S3C B;  3G50 A;  3HAR A;  1C03 A;  3EML A;  1WAT A;  1IW6 A;  3GAN A;  3GM2 A;  4YJW A;  4I1O B;  1LE4 A;  1NFN A;  1XZQ A;  1JAF A;  2Y69 C;  1F50 A;  2J7P A;  4UG2 A;  4MVR A;  3EGD A;  1HE1 A;  3PBL A;  4ZLC A;  3NY8 A;  3NKE A;  3B0V C;  1R2N A;  4MVQ A;  2VCB A;  5DQT A;  2LD6 A;  5DS4 A;  2OJQ A;  4NTA A;  1ZHW A;  5JP7 A;  3DXJ F;  2OEX A;  4JKV A;  3L1M A;  3SYN A;  1OW6 A;  3U3F A;  1VMA A;  3Q6N A;  2XLV A;  2CNW D;  1AUE A;  4R32 A;  3QBK A;  1Z23 A;  5F28 E;  3X1O A;  5FCL A;  4HEA J;  3R2P A;  3X3C A;  1DOV A;  4E0I A;  4IJJ A;  2YVK A;  2H7V C;  2WVN A;  4O6Y A;  5KYW A;  4QI0 A;  4IWB A;  2BC5 A;  1D0Z A;  1VB5 A;  2X72 A;  4Y9H A;  2AU5 A;  4JTC B;  1OCC C;  5L0D A;  2M64 A;  1GZM A;  3AYN A;  5L0H A;  5A45 A;  4J7T A;  4U5F E;  3EGX A;  2Y04 A;  1E83 A;  4YL1 A;  3AGT A;  3X3B A;  2YLG A;  1MMD A;  2HJM A;  2DGJ A;  3LLI A;  5DVW A;  3AQC A;  4N6H A;  4MBS A; 
#chains in the Genus database with same CATH homology
 4G72 B;  3QBL A;  4U9D A;  3P0G A;  3HNL A;  1S53 A;  2PED A;  5G54 A;  4L6R A;  5AZD A;  2JAG A;  2YLD A;  4EJ4 A;  2Z73 A;  3A7K A;  4LDE A;  5AX1 A;  4BEZ A;  2QPD B;  3EH4 B;  5A8E A;  1YYX A;  1R84 A;  1M0M A;  4G7R B;  1YYJ A;  4MQS A;  2XLO A;  5B6V A;  2Y01 A;  3KJ6 A;  3VW7 A;  1KG9 A;  5TGZ A;  3HAP A;  2JAF A;  4XTL A;  3UZC A;  1CGO A;  2KSA A;  4N4W A;  5B3I A;  5ITE A;  5BR5 A;  1KGB A;  4GP4 B;  3AM6 A;  4PXF A;  5ETZ A;  1E0P A;  2KS9 A;  5H2J A;  1S05 A;  5JJE A;  4XT1 A;  3OE6 A;  4GYC A;  1CGN A;  4A4M A;  4XT3 A;  4MD2 A;  3C9L A;  1S8J A;  4EIY A;  5H2N A;  4G7Q B;  3COC A;  5B35 A;  1CWQ A;  3UTW A;  4DJH A;  5AGF A;  3PQR A;  1VJM A;  4KLY A;  5DYS A;  2CCY A;  1IW9 A;  5H2L A;  3M4B A;  4X32 A;  3UTY A;  1NBB A;  4HYJ A;  4UHR A;  2YLI A;  1X0S A;  2ZIY A;  2F93 A;  5B0W A;  1KG8 A;  3ABW A;  3TOL A;  4PXK A;  1M6T A;  5JVE A;  1E84 A;  3D4S A;  4X31 A;  3HAN A;  3VI0 A;  4ULV A;  3OE0 A;  3C9M A;  3VHZ A;  4WW3 A;  4FAA B;  3OE8 A;  3C62 A;  5H2O A;  4XTO A;  1KME A;  3EH3 B;  4CDY A;  5J7A A;  1C8S A;  3OAX A;  2WJL A;  4CJO A;  2J8W A;  2L6X A;  5BR2 A;  3UON A;  1TN5 A;  4BEY A;  1QPU A;  3AYM A;  1VGO A;  2YL0 A;  3QVZ A;  4CDA A;  4DKL A;  4MQT A;  1F88 A;  4QID A;  4GRV A;  4U9E A;  4IAR A;  3HNJ A;  4EA3 A;  1E86 A;  3OE9 A;  2J4Y A;  1QKP A;  4WGZ A;  4DS7 E;  3ZWI A;  1JV6 A;  3HNK A;  3M4C A;  5B6W A;  5DHG A;  1AT9 A;  3QJT B;  1JV7 A;  3NYA A;  3QJR B;  5G2D A;  4G7S B;  4JE9 A;  3NMI A;  2BRD A;  1C3W A;  5JUA A;  1DZE A;  1X0K 1;  1PXR A;  1X0I 1;  1UAZ A;  3PXO A;  1PY6 A;  1BBH A;  2M3G A;  2I21 A;  3ZEV A;  3PWH A;  4CX9 A;  3HAS A;  5ITC A;  5DHH A;  3UTV A;  3IQ5 A;  4AMJ A;  3UG9 A;  4LDO A;  5JJJ A;  5LWE A;  3ZQV A;  1L9H A;  3QDC A;  2XLM A;  1APC A;  1E85 A;  1S51 A;  5B6X A;  4L35 A;  2LNL A;  1BM1 A;  1LM3 B;  5G28 A;  3S3D B;  3ZPR A;  5AHY A;  3VRC A;  1QKO A;  2YL3 A;  5JT4 A;  4CJG A;  1S52 A;  3QAP A;  1AP9 A;  1QM8 A;  4GPO A;  1HZX A;  3ODU A;  4XTN A;  3V2W A;  2XM4 A;  5B6Y A;  2XLH A;  2YDO A;  5AX0 A;  1CPR A;  4BVN A;  5G53 A;  2YL1 A;  256B A;  3DDL A;  5F8U A;  3VG9 A;  5JSL A;  2XLW A;  1M0K A;  3HNI A;  3QW1 A;  5FJG A;  2WJK A;  1YZA A;  1XJI A;  2EI4 A;  3V2Y A;  4LDL A;  2Y00 A;  4G71 B;  5H2K A;  1XIO A;  1H2S A;  4JEA A;  1F4Z A;  2XL6 A;  4FPD A;  2KSB A;  3RZE A;  3QAK A;  4WGY A;  4BWB A;  4X1H A;  3NSB A;  5AHZ A;  3QBG A;  3VVK A;  3NMJ A;  1L0M A;  3DE9 A;  3S3B B;  3REY A;  4G70 B;  1JFP A;  4CIP A;  4IAQ A;  4BV0 A;  3FOO A;  3BVD B;  4AMI A;  1A7V A;  2XM0 A;  4FBZ A;  1LN6 A;  4D4N A;  2AT9 A;  2YCW A;  2J9B A;  1QQ3 A;  3UTX A;  4XXJ A;  5H2P A;  1S8L A;  2YCX A;  1O0A A;  3EH5 B;  4CDV A;  1GUE A;  1FBB A;  4NC3 A;  1QHJ A;  2KSY A;  5H2M A;  4WAV A;  3NS0 A;  2YDV A;  4MD1 A;  1JGJ A;  3FOP A;  3QJS B;  2YKZ A;  3DE8 A;  1EKY A;  2RH1 A;  1P8U A;  4HYX A;  2F95 A;  3QJU B;  3VGA A;  1BRX A;  4IB4 A;  1RCP A;  5G36 A;  3NMK A;  2XLD A;  3C63 A;  1M0L A;  1PXS A;  3QJV B;  1BRD A;  1XME B;  2Z55 A;  3TOM A;  2VT4 A;  2I20 A;  1CPQ A;  5B6Z A;  4D4X A;  4QI1 A;  3RFM A;  4ER9 A;  4QRY A;  1TN0 A;  3SN6 R;  3S8G B;  3CAP A;  4HWL A;  3DQB A;  2ZZL A;  4KNF A;  3ZTM A;  3S3C B;  4N4Y B;  3ZPQ A;  3HAR A;  4K5Y A;  1P8I A;  3IQ6 A;  3QW0 A;  4GP5 B;  5KKH A;  1EHK B;  3WQJ A;  5JS5 A;  4DAJ A;  2XL8 A;  2YCY A;  3EML A;  1GQA A;  1IW6 A;  5JRA A;  2Y02 A;  5B34 A;  1JAF A;  5JJN A;  1GU8 A;  3ZQY A;  1FBK A;  1F50 A;  4JR8 A;  4UG2 A;  3PBL A;  3NY8 A;  2G87 A;  1C8R A;  2HPY A;  2R4S A;  3UZA A;  3PDS A;  2NTW A;  3QBI A;  1R2N A;  4BUO A;  3QJQ B;  3COD A;  2I35 A;  5JLI A;  5G2A A;  3T45 A;  5JP7 A;  1U19 A;  2ZFE A;  3S8F B;  3HAO A;  1MQV A;  5C1M A;  1Q5J A;  4JKV A;  5H2H A;  3L1M A;  4JEB A;  4J4Q A;  2XLV A;  1MGY A;  5AWZ A;  2R4R A;  3QBK A;  3QVY A;  2YL7 A;  5H2I A;  3NY9 A;  1BRR A;  3X3C A;  4TL3 A;  5EN0 A;  2I1X A;  2YCZ A;  1H68 A;  1Q5I A;  1P8H A;  2BC5 A;  2NTU A;  2X72 A;  4Y9H A;  1GZM A;  3M15 A;  1UCQ A;  3AYN A;  5A45 A;  2XLE A;  4FA7 B;  2Y04 A;  1YZC A;  2QLA A;  2QPE B;  1E12 A;  1E83 A;  1S54 A;  4GBR A;  3ZTZ A;  4OV0 A;  4GP8 B;  3U8P A;  5B2N A;  3X3B A;  2YLG A;  1IXF A;  3HAQ A;  3M79 A;  2Y03 A;  5A44 A;  4N6H A;  4JQ6 A;  3MBV A;  5G2C A;  4MBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...