4N4WA

Structure of the human smoothened receptor in complex with sant-1.
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
473
structure length
457
Chain Sequence
GGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSESKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQADCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b(562),Smoothened homolog
publication title Structural basis for Smoothened receptor modulation and chemoresistance to anticancer drugs.
pubmed doi rcsb
source organism Shigella flexneri 5 str. 8401
molecule tags Membrane protein, transport protein
total genus 186
structure length 457
sequence length 473
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF01534 Frizzled Frizzled/Smoothened family membrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4n4wA01
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n4wA02
4L35A 1FBKA 3HAPA 2ZFEA 2YL0A 4CDAA 3UONA 3ZEVA 4WGZA 3CODA 4UHRA 4L6RA 3C63A 5JUAA 1HZXA 4CIPA 2WJKA 1VGOA 1M0MA 4X1HA 3OE8A 3HASA 3QJRB 4G70B 5A44A 1S52A 5DHGA 3UZCA 4DJHA 5JJEA 1P8IA 1AT9A 3NMKA 1QM8A 1U19A 4U9DA 2PEDA 1PXSA 5JRAA 5JP7A 1R2NA 5B6ZA 2HPYA 5J7AA 1YZCA 5H2NA 1QPUA 2F95A 2YDVA 4CDVA 3HARA 4HWLA 1C8SA 3RFMA 1M0LA 3NMJA 2ZIYA 5EN0A 4JEAA 3QJUB 5H2LA 1DZEA 1E86A 4CJOA 1X0K1 1KG9A 4JR8A 1YYJA 2F93A 3VVKA 3ABWA 3IQ5A 4XTOA 3VG9A 4GP8B 3VW7A 5AHZA 3SN6R 3EMLA 5ITCA 2J8WA 3QAPA 2YCXA 5AGFA 5JS5A 3FOPA 2AT9A 2YCZA 5KKHA 3DQBA 3VI0A 4AMJA 1GQAA 2Y00A 2NTWA 2Z73A 2XLDA 5BR5A 4WGYA 4LDOA 4A4MA 1H2SA 5JT4A 2Y04A 3OE6A 3UTWA 1F50A 1S05A 3DE8A 1P8HA 4MQSA 5B34A 2J4YA 4K5YA 2R4SA 2RH1A 1XJIA 1YYXA 1L9HA 2YL7A 1JGJA 5AHYA 3AM6A 1FBBA 1TN0A 5G36A 5G53A 3NS0A 2YLIA 4LDEA 1JAFA 1KG8A 2L6XA 3QBIA 5H2IA 4BWBA 4DKLA 4MBSA 5H2MA 3CAPA 4ULVA 3M15A 1EKYA 2I20A 3S8GB 5G2AA 3VRCA 5G2DA 3EH3B 4UG2A 4BEZA 2XLWA 4N6HA 4CDYA 1VJMA 3ZPQA 1CPRA 5B6WA 4QRYA 1CPQA 4JE9A 4WW3A 3NSBA 1PY6A 4QI1A 3HNJA 4EA3A 3VHZA 2M3GA 4XT3A 5G54A 5JVEA 1S8LA 3PXOA 4CX9A 2XLOA 1QHJA 1BBHA 1X0SA 5H2PA 3C9LA 1QQ3A 2Y02A 2XLHA 4XXJA 1APCA 4D4NA 4G7RB 3EH4B 3BVDB 5FJGA 5B6YA 3UZAA 4IB4A 3M4BA 4G7SB 1C3WA 3QDCA 1YZAA 4MD1A 4MQTA 1IXFA 1CWQA 5BR2A 1L0MA 1P8UA 3NMIA 5AZDA 4X31A 4J4QA 1M0KA 1Q5IA 3ZWIA 2YL3A 5AX0A 2KSBA 3X3BA 1BRRA 5AWZA 1JV7A 5DHHA 4GP5B 2R4RA 2LNLA 2Z55A 4XTLA 1F4ZA 5JJJA 3KJ6A 3D4SA 3NY8A 4OV0A 2BC5A 4BEYA 4N4WA 3RZEA 1CGOA 2J9BA 5B35A 3QJQB 4BVNA 2CCYA 3HNIA 3L1MA 4KLYA 2XL8A 4XTNA 1XIOA 3OE0A 1E0PA 2XLVA 1TN5A 3TOLA 4CJGA 3C62A 4FAAB 3V2WA 4JEBA 5ITEA 3QBLA 1EHKB 1CGNA 2NTUA 4N4YB 3DDLA 4TL3A 2XLMA 3HANA 3COCA 4BUOA 1X0I1 3V2YA 1S54A 5H2OA 3UTVA 1R84A 3ZQYA 3QJSB 4AMIA 2XL6A 1A7VA 4GBRA 3A7KA 3OE9A 3PWHA 4EIYA 4JQ6A 3REYA 4X32A 1O0AA 2YDOA 5B3IA 4FA7B 4GRVA 4DAJA 1M6TA 5A8EA 3S3DB 2QPDB 4PXFA 3PBLA 3HAOA 3M79A 2BRDA 3ZPRA 4G7QB 2VT4A 2XM4A 5DYSA 3UTYA 5LWEA 5G2CA 1UCQA 2Y01A 2YL1A 5AX1A 1S8JA 2YLGA 2KSAA 3ODUA 2QPEB 1E83A 3IQ6A 1JFPA 3UG9A 2Y03A 5H2KA 4G72B 3MBVA 3AYMA 1GUEA 1IW9A 5H2HA 1S51A 2ZZLA 4IAQA 4GP4B 3HAQA 3HNKA 5H2JA 2QLAA 5G28A 5F8UA 3QBGA 3AYNA 2YCWA 3T45A 4ER9A 1XMEB 1QKOA 1F88A 4EJ4A 3DE9A 1GU8A 4IARA 3X3CA 3PDSA 4U9EA 2I35A 1S53A 2YLDA 3S3BB 3ZTMA 3QJVB 1E12A 1QKPA 2JAFA 1E85A 4KNFA 3VGAA 3S3CB 1Q5JA 5B6XA 1JV6A 3QW0A 5JSLA 4PXKA 2XLEA 1GZMA 2EI4A 1NBBA 1AP9A 3QVZA 3ZTZA 3QVYA 4HYJA 1H68A 1MGYA 3TOMA 2KSYA 4HYXA 2X72A 1BRXA 4BV0A 5B2NA 2I1XA 3QW1A 4GYCA 1BRDA 1MQVA 3S8FB 4GPOA 3P0GA 4XT1A 3QAKA 3FOOA 1KGBA 5JLIA 1UAZA 5JJNA 5B0WA 3NYAA 1LN6A 3M4CA 4NC3A 3ZQVA 1IW6A 1RCPA 3WQJA 3PQRA 2JAGA 2XM0A 3C9MA 4JKVA 4MD2A 2G87A 5TGZA 1BM1A 4FPDA 2I21A 5C1MA 2KS9A 4D4XA 3QJTB 4FBZA 3UTXA 2YCYA 3HNLA 1KMEA 3OAXA 4LDLA 1E84A 5B6VA 3EH5B 4QIDA 1C8RA 5A45A 4WAVA 1LM3B 2WJLA 5ETZA 3NY9A 3U8PA 3QBKA 1PXRA 4Y9HA 256BA 2YKZA 4G71B
chains in the Genus database with same CATH superfamily
3LS0A 2P6VA 5L0IA 1OCZC 3ECSA 3CODA 5BQGA 4NTFA 4L6RA 4CIPA 2ZD9A 1VGOA 1EI7A 3OE8A 4LLCA 3VF0A 3HASA 1L7CA 4DRJB 3QJRB 1S52A 5DQZA 3KPHA 3NMKA 1U19A 3L0IA 1A41A 1OW8A 4MVZA 1K05A 3S28A 2OJED 3SP1A 2KC3A 2KSFA 2GAQA 2R25A 4Z9HA 1M0LA 4JEAA 2GDCA 3EG9A 4CJOA 1KG9A 3S29A 2P0NA 3DD7A 1YYJA 2YZSA 1TWCA 5AHZA 3UGOA 5JS5A 2AT9A 3O55A 3DQBA 4AMJA 2Y00A 1B68A 4NTAA 3O6XA 2DB4A 1FNTc 1U0BB 3CEXA 3U9MA 5JT4A 2PX0A 2R7SA 3UTWA 1OKKD 5EHHA 1F50A 4YL3A 3B29A 4J7YA 2PBEA 4YT2A 3C8GD 3RH3A 1XJIA 2J0XA 1JGJA 5AHYA 2VC9A 5KYNA 1FBBA 1TN0A 5G53A 1ZHWA 3T6JA 2Q3TA 1SF8A 4O6YA 1VMAA 4F4BA 2J7PD 4U5BE 2L6XA 1MMGA 3S0XA 1V54C 4DKLA 3GM3A 2KNHA 1XZQA 5H2MA 3CAPA 2O9XA 4XPXA 5DVWA 5D92A 2GA0A 3S8GB 3V5ZA 2XSEA 4LERA 4BEZA 4CDYA 1VJMA 1HE9A 4FWVA 5B6WA 4QRYA 1CPQA 4JE9A 3V5YA 1BR4A 3TJ5A 4DBRA 3VHZA 4WABA 4P9TA 3UMKA 2OKUA 3EG9B 4BPMA 4CX9A 5COFA 1QHJA 4PJMA 4D4NA 4G7RB 3EH4B 3HTKC 4AE4B 3BVDB 3KYIA 4KC9A 3IEEA 3QDCA 2Z15A 3N0TA 1L0MA 4J4QA 2OOCA 3ZWIA 5B1AC 2YL3A 3X3BA 2KSBA 1BRRA 2IXOA 4YWQA 3ASOC 1RMVA 3NKEA 4PJNA 5DHHA 2VCAA 3U3BA 4U5CE 2BC5A 3EHNA 4BJ6C 4LDQA 4WJ0A 2KK1A 5B35A 1YJGA 3QJQB 1M2VA 3QZCA 3VAYA 2XL8A 2L81A 3WAQA 4E7SA 3EZHA 2VH3A 2LCHA 4MVMA 5CI8A 5D91A 3SXYA 4PR9A 5ITEA 4W8PA 1FFHA 1BR1A 3OA1A 1V55C 2HMQA 3DDLA 3HANA 3JRTA 2R7XA 3DXJF 2ASRA 3QJSB 2PP4A 4KBLA 4EUKB 1A7VA 4U5GA 3PWHA 3O10A 3GEHA 4JRZA 3SYNA 4JQ6A 2YEVA 3SXMA 2UUIA 1O0AA 5L0JA 3TULA 1I4YA 3CQZA 4PXFA 2R7OA 1A0BA 2P7VA 3M79A 3ZPRA 1H6GA 1NU7D 2HV6A 2WZGA 4OIOF 2DGJA 2YL1A 4XEKA 4G7ZF 2ETSA 5FZTA 4DVYP 1FMVA 3FMSA 2LQGA 3H2UA 1M2VB 3U8VA 4U5FE 4ANJA 3RIPA 4G72B 4FESA 4OIRF 4U5EE 3DJUB 3AYMA 1GUEA 4YJWA 2NPUA 1S51A 5A69A 3ZC4A 3HNKA 5F8UA 3QBGA 3W2WA 3R2PA 1ORJA 4MTGA 4I1OB 2NUPA 4EJ4A 2MWQA 3IPMO 3S9OA 3EJNA 2E87A 3UGPA 3ZTMA 1N1CA 3BRJA 2IM8A 1TWHA 4OIQF 5L0GA 3WODF 4PXKA 1ZHXA 1I4ZA 2EI4A 1ZHYA 1NBBA 3ZTZA 3GANA 3RQGA 1HE1A 1Q0GA 2KSYA 2VASA 3AG4C 3DZAA 1VOMA 1Z23A 5E3CA 4MTFA 3NYJA 5A6BA 4YL1A 1MQVA 3S8FB 4GPOA 4XT1A 2AWYA 5B0WA 3DM9B 3JSEO 3M4CA 3DAFA 4O79A 4HFFB 5BUOA 3PQRA 3C9MA 4JKVA 2G87A 5TGZA 2V26A 3GWNA 2J9WA 1ORSC 2IXNA 3UTXA 4BJ6A 4IJJA 2YCYA 5FCLA 4PFPA 3TJ6A 3EH5B 1C8RA 4E17A 3FDQA 1OCCC 4WAVA 1YA7O 1YDIA 3RW0A 3QBKA 2HJMA 4Y9HA 4EBBA 4G71B 4E18A 5DS6A 2YL0A 4CDAA 2A0BA 5F5FA 4Q5SF 3OEOA 4CS7A 5JUAA 4PK4A 1M0MA 2G3KA 1XZPA 1ZZPA 4O6NA 5CI9A 4RBNA 5A44A 1TWAA 3MYIA 5DHGA 3UZCA 4DJHA 5JJEA 4U9DA 1K04A 1R4TA 1R2NA 2F95A 1VK5A 4XLNF 3WHNA 1GGQA 4JC7A 3U0CA 3HARA 2Q4FA 3NMJA 2ZIYA 4BJ5A 1HMOA 2KQ9A 2H7OA 3L34A 4X0RA 2Y3BA 4JR8A 3VVKA 4G78A 3VG9A 3ITFA 3S90A 3VYWA 3SN6R 5L0HA 5ITCA 2J8WA 1U89A 3X1OA 3G4ZA 3DWWA 2XS1A 5AC4A 2Z73A 1OR3A 4EWCA 2H7VC 1V4AA 2XLDA 5F28E 5BR5A 3W2VA 4LDOA 1H2SA 1QLEC 2Y04A 2IXPA 4ONSA 4M63A 5E3AA 3AG2C 1S05A 3RQFA 3DE8A 2R7QA 3KL4A 2XXAA 5B34A 4K5YA 2R4SA 4E7ZA 5IY5C 1YYXA 2EIKC 1MNEA 3PCVA 2YL7A 2LFDA 3C7JA 4RDAA 4MW8A 4QDLA 3JSZA 3NS0A 4EBKA 4I3MA 3TD7A 4OD4A 5K0IA 3QBIA 4OIPF 4BWBA 5KYWA 1C02A 3ABLC 2LK4A 1EKYA 1OXBA 1Z3IX 2EPNA 3VRCA 2ICWG 3EH3B 3MBGA 1ST6A 1OCOC 1JPNA 3SXKA 4MVUA 3LESA 3HNJA 4EA3A 1SR2A 2Y39A 2DI3A 2M3GA 2EPKX 1JOGA 2R7TA 5G54A 2CNWA 1WASA 2BL2A 5H2PA 2MYSA 1KTMA 4XXJA 1APCA 3S84A 1WN0A 4YL0A 5B6YA 3UZAA 2QTVA 2VB6A 3RQEA 2L6HA 1M56C 1S7ZA 4G7SB 4MD1A 1O5HA 2B0JA 4CSAC 2EPMX 4X31A 1V74B 1A7DA 1Q5IA 5AX0A 4BG0A 1KU2A 2XXAB 4N6CA 3US6A 5AWZA 3UMHA 2Z55A 3LUTB 4XTLA 2YWAA 1HW1A 4DS7E 4AE4A 4N4WA 3RZEA 1CGOA 2CCYA 4KLYA 4KNWA 3RF3A 5DS4A 5KYUB 5KYWB 2C04A 2R7UA 4XEVA 2Y3DA 2NUTA 2Q7RA 3AG3C 3V2WA 2QNLA 3SZRA 1D1AA 2OEXA 3UNGC 2JPUA 4JTCB 5EK0A 2GWWA 1JR8A 2R7VA 5EGYA 4MVQA 3RYLA 2QY9A 4YN0B 4ZLDA 3COCA 2A0UA 1X0I1 4BUOA 3V2YA 3FXHA 4G7HF 1R84A 1K40A 1VLSA 3A7KA 3TQOA 4EKWA 4DBQA 4H4KC 4X32A 2YDOA 3KYJA 3LLKA 5A8EA 4CS8C 3PBLA 4A2NB 4JW1A 2BRDA 1ZU4A 2XM4A 1ZYRF 1OXKA 5L0DA 5DYSA 1NLXA 1D1CA 5E33A 1JPJA 3AOUA 1S8JA 4QI2A 2QPEB 3IQ6A 2AP3A 3L8IA 5GPGB 3GORA 3NDBB 2NUTB 2B0HA 5L0FA 2ZZLA 4JJFA 5G28A 3BEHA 1C03A 4P6IC 1F88A 3DE9A 5A6BD 1AEPA 3N2ZB 3X2QC 1O3UA 2JAFA 1TKNA 3QW0A 5JSLA 3Q7GA 3GEIA 2LIGA 1LS1A 5CIVA 3GEEA 3JTLO 4HYJA 2A68F 2X72A 2ZXRA 1LKXA 1BRXA 5B2NA 4JCHA 2I1XA 3L8JA 1R5ID 2H8AA 3TK0A 3QW1A 4I1MA 4GYCA 1BRDA 2C03A 4XWJA 1JRAA 4CSAA 4IWBA 3ZSUA 3H65A 2EIMC 3J06A 5JJNA 3PDMP 3KMIA 1J8YF 3ZQVA 4PACA 3JZ0A 4MVSA 3I5QA 4CBEA 2XM0A 4DOZA 3B0UX 5KYYB 1BM1A 4FPDA 2I21A 3RFYA 3C18A 4GYTA 4BJ5C 2OU6A 1YAUO 1D0YA 3HNLA 1MMNA 1OKKA 2NSFA 4LDLA 5B6VA 2KGOA 3IHUA 4QIDA 2P1AA 1RKEA 1T6UA 5ETZA 3U8PA 4IAOA 4C3DA 1PXRA 256BA 1PD1A 1LI7A 2J46A 1FBKA 1EA8A 2ZFEA 3CSKA 3NYMA 4ZLCA 3ZEVA 4WGZA 4EHPA 4UHRA 3K1IA 1G4WR 3C63A 3FAPB 1HZXA 2WJKA 5B3SC 2PNOA 2J7PA 2RSEB 5L0CA 3JCUQ 1LE2A 2Y3GA 2PEDA 1PXSA 5JP7A 2MHRA 5B6ZA 2X51A 1YZCA 1RXQA 1QPUA 4E0IA 3ZDLA 1C8SA 4Q7CA 2H7BA 3RFMA 1GS9A 5EN0A 3U2LA 4CS8A 3QJUB 5H2LA 1DZEA 1E86A 2EINC 2F93A 3ABWA 3LAYA 1YA9A 3WG7C 4G7OF 4GP8B 3VW7A 3EMLA 4JCZA 2A6HF 5AGFA 3FOPA 2YCZA 5KKHA 3EH1A 2HS5A 4AL1A 3VI0A 1WATA 2NTWA 1FMWA 3F46A 3ABKC 2KYHA 3MYFA 4A4MA 3I4UA 3E9VA 4G0HA 1P8HA 3Q7LA 4MQSA 1RKEB 1OW6A 2RH1A 3C8GB 2I15A 1T9KA 1RKCA 4LDRA 3V7OA 3AM6A 1A7EA 4YT8A 5G36A 2YLIA 4AK9A 1ZHZA 2LSEA 4XLPF 1JAFA 1KG8A 1RJ9A 2HZ8A 1O87A 1QZXA 4MQ9F 4MBSA 3M15A 3M1CB 2I20A 1ZVZA 2OJQA 5A6JA 5G2AA 5G2DA 3EHMA 5KYXB 1JMWA 4UG2A 2A1DD 3FHDA 4OD5A 2XLWA 4DXWA 1Z5ZA 2G62A 4WW3A 1BR2A 2PFDA 3NSBA 1PY6A 2CGEA 2V3CC 3AGUA 2HSBA 4XT3A 5JVEA 1NG1A 2XLOA 1BBHA 4NY3A 1X0SA 2NG1A 3C9LA 1MMAA 3RVZA 4AX2A 2Y02A 2W9YA 2R02A 3SEOA 2P61A 4IB4A 1Z7Qc 4KI2A 4J7TA 4ULWA 1YZAA 1CWQA 4R32A 4MVOA 1P8UA 1ZW3A 4BJ1A 3B0VC 3AJMA 1LS4A 3T4RA 3T9OA 3POVA 1JV7A 4GP5B 2LNLA 2Q9AA 2WVNA 4BEJA 1NU9C 4OV0A 2IOQA 5DS5A 3B0PA 1ZHTA 2W45A 3HNIA 3L1MA 1RJ9B 4NTBA 1XIOA 1PD0A 1AVOB 2R7RA 1TN5A 1E0PA 1H9GA 3G50A 3TOLA 3LNMB 1TR2A 3C62A 3NKDA 4FAAB 2DYSC 3GWLA 1WTYA 4LDKA 3QBLA 1T01A 1EHKB 1BDJB 2NTUA 1ZW2A 4N4YB 4TL3A 2XLMA 1BZ4A 3N24A 3RKOF 2YQYA 5COGA 3JYHA 5KYUA 2XL6A 4J30B 2ZXPA 4EIYA 1OQCA 2EILC 3REYA 4C3EA 1LPEA 2CDQA 4GRVA 4DAJA 3ASNC 3B9QA 2QPDB 2HSQA 4DVZA 1PCXA 1LIHA 2LD6A 2VT4A 4C3BA 1SZIA 5LWEA 2KW3C 2Y01A 1Z63A 5AX1A 1ORYA 1D0XA 2XS8A 4PFOA 3E70C 2Y03A 2HJ3A 4YK5A 2OG2A 2ZXWC 3U3FA 3W4YA 1VYKA 3JT1A 5H2HA 4YT4A 3NG1A 2R03A 3HAQA 2QLAA 1VYIA 2W4MA 4MW3A 3T45A 4YT5A 3U2MA 4GEHA 4N06A 1GU8A 1FAPB 1WWPA 3KKBA 3LEOA 4P9FA 3A9CA 2I35A 2YLDA 1W2WA 1E12A 4HE8D 4NCQA 3R7CA 2PF4E 3DI5A 2OEVA 1JV6A 2CYDA 2VCBA 2YRFA 1F1MA 4CS9A 1GZMA 1AP9A 3U9JA 1NFNA 4K0DA 4PJJA 3V5XA 2XL4A 1E2XA 1HMDA 1H68A 2PX3A 1MGYA 4HYXA 3K66A 3MX3A 4BV0A 3DMDA 3K1IC 3LJBA 4EBJA 2JX0A 1VLTA 1VB5A 2L9JA 2WZLA 3EGDA 3P0GA 2DYRC 3QAKA 1KGBA 4DRHB 1Q0DA 3IQTA 5TJ5E 1YARO 4NC3A 2Q9BA 2UUHA 4DRIB 2EPOA 1RCPA 2WZFA 3WQJA 2FAPB 3PMRA 4XTKA 4MD2A 1G5ZA 5C1MA 4D4XA 2OQMA 2R9RB 3QJTB 4FBZA 3UR3C 2JD3A 1KMEA 3K1HA 1E84A 1Z6AA 5A45A 3DKAA 2EPLX 4JTDB 5A6AA 1LM3B 2WJLA 1YVIA 3DM5A 4MVRA 3EPVA 4L35A 2CW0F 1FFTC 2LP4A 2NSGA 3HAPA 2FFHA 2HKVA 1U6HA 3FVYA 2WVQA 5KYYA 3UONA 4J32B 2EIJC 1Q0FA 4O7GA 4X1HA 2XRHA 4XPWA 2Q00A 4G70B 2FGYA 4KNVA 1P8IA 1AT9A 1QM8A 1UFBA 5JRAA 2L7AA 3K7DA 1QSPA 1GM5A 2HPYA 3G4XA 4O6MA 5J7AA 1WGWA 5H2NA 1Q0KA 2YDVA 4B6IA 4CDVA 2A69F 4HWLA 2W4BA 4HEAJ 3EGDB 4XQ1A 5B1BC 2Q9CA 5F5HA 1X0K1 4U5HA 3NYLA 2L6FA 3IQ5A 4BJTA 4XTOA 4H54A 5E2QA 4LACB 3B71A 2AVKA 1NZEA 3DAGA 2GFHA 3QAPA 2YCXA 4K7BA 2HV7A 1GQAA 3PHF2 2M4EA 4GQHA 2Y69C 4WGYA 1TFOB 3EQLF 3SNHA 3S27A 3OE6A 4RD9A 4U5DE 2G3VA 3MLGA 1YLMA 3EFOA 2J4YA 2RD9A 5COMA 1L9HA 3OWTA 4IGGA 1LVKA 3JRMO 3AQCA 1H9TA 3AG1C 4JIOA 4LDEA 4QI0A 3LNRA 1M2OA 4BEMJ 1HY5A 3VM6A 5H2IA 2OCCC 2R7WA 3KH2A 4ULVA 1L3PA 1XWJA 1M57C 1HW2A 4I44A 1SMYF 1ZU5A 3AGTA 2A6EF 2TMVP 2J9VA 4N6HA 3C8GA 3ZPQA 1G4US 1CPRA 3I5PA 4JURI 4QI1A 1IW7F 4Z9IA 3T6GB 3RVYA 1Q0MA 1S8LA 3PXOA 3SXZA 3HJCA 1QQ3A 2XLHA 2KJGA 5FJGA 1OR2A 2AU5A 4A4AA 5DQTA 1D1BA 2ZPAA 5KYXA 3M4BA 2YVKA 4K1OA 1C3WA 3ABMC 1TQGA 4MQTA 1IXFA 5BR2A 3F47A 3NMIA 5AZDA 1M0KA 1OW7A 3GODA 3EFOB 1CGME 4PJLA 1H7IA 2R4RA 1NSGB 2M64A 3EZIA 3JYYA 1F4ZA 5JJJA 3KJ6A 3CZ6A 3D4SA 3NY8A 4BEYA 2IYLD 5T3WA 3W8IA 4Z9JA 5BQIA 3GM1A 4HFKB 1DOVA 2J9BA 4BVNA 3T6BA 3QTHA 1Y4CA 1MNDA 4XTNA 4MNDA 4JZAA 3EGXA 4CIHA 3OE0A 4JJGA 2XLVA 4UDVA 1T6IA 4CJGA 1LE4A 2R05A 4JEBA 1WOLA 1T5OA 2QUPA 1TWGA 1C17M 4MTOA 1CGNA 2WL8A 3H2VA 2CNWD 3MFNA 1UG7A 3Q6NA 1S54A 5H2OA 1VTMP 3UTVA 3ZQYA 4AMIA 3O39A 1EQ1A 3C8ZA 1FTSA 4GBRA 3OE9A 3K33A 3LS1A 4XPYA 1TFKB 3W8HA 5B3IA 4FA7B 4FAPB 3HKKA 1M6TA 3S3DB 3Q6MA 2X0CA 4LLEA 2YHSA 2J9UA 3QMKA 3HAOA 1NFOA 2Y3HA 1IZMA 4G7QB 4CS9C 3UTYA 2J0WA 2HMZA 2NUPB 1UCQA 5G2CA 1J8MF 1KNYA 2YLGA 2KSAA 2IBFA 2HFIA 3ODUA 1E83A 2J45A 2D5RB 1JFPA 4C7OA 4IRUA 3UG9A 3CAXA 5H2KA 5HSWA 3MBVA 1OCRC 3EGXB 1IW9A 2LFFA 2I8BA 4IAQA 4Q4ZF 3GM2A 4GP4B 4DJ9A 5H2JA 3UMIA 2WB7A 2ZXOA 2YCWA 3AYNA 2VCCA 4ER9A 1XMEB 1QKOA 4W8KA 2D4UA 4IARA 5BQHA 3LLIA 3X3CA 2L6GA 3ATPA 3PDSA 4U9EA 5AC5A 1SYQA 1S53A 5L3VA 3S3BB 4OINF 3QJVB 2AWCA 1QKPA 1D0ZA 1G8XA 1I5NA 1E85A 1QKRA 3EH2A 4KNFA 3VGAA 3S3CB 1Q5JA 5B6XA 1LI5A 1QVXA 2XLEA 4NQFA 1T6QA 3QVZA 4AL0A 3QVYA 2IXMA 4JVSA 5A6KA 3TOMA 4FX5A 1MMDA 2HUJA 3NRHA 3ZG1A 5T1DB 3K6BA 5L3QA 4JTAB 3AQBA 4XEFA 3FAJA 3FOOA 5JLIA 1UAZA 3ZVRA 3NYAA 1LN6A 3LEVA 4E0HA 1FR0A 1Y6DA 1IW6A 2F22A 4C7OB 2JAGA 2WVOA 4MS2A 5HV9A 2KS9A 3HLZA 1PV3A 3A11A 1DOWA 1AUEA 3ZIBA 2QE9A 3OAXA 5T3TA 3U5SA 5DLJA 3IQCA 3DJNB 3NY9A 2YKZA 2BE5F
chains in the Genus database with same CATH topology
4L35A 1FBKA 3HAPA 2ZFEA 2YL0A 4CDAA 3UONA 3ZEVA 4WGZA 3CODA 4UHRA 4L6RA 3C63A 5JUAA 1HZXA 4CIPA 2WJKA 1VGOA 1M0MA 4X1HA 3OE8A 3HASA 3QJRB 4G70B 5A44A 1S52A 5DHGA 3UZCA 4DJHA 5JJEA 1P8IA 1AT9A 3NMKA 1QM8A 1U19A 4U9DA 2PEDA 1PXSA 5JRAA 5JP7A 1R2NA 5B6ZA 2HPYA 5J7AA 1YZCA 5H2NA 1QPUA 2F95A 2YDVA 4CDVA 3HARA 4HWLA 1C8SA 3RFMA 1M0LA 3NMJA 2ZIYA 5EN0A 4JEAA 3QJUB 5H2LA 1DZEA 1E86A 4CJOA 1X0K1 1KG9A 4JR8A 1YYJA 2F93A 3VVKA 3ABWA 3IQ5A 4XTOA 3VG9A 4GP8B 3VW7A 5AHZA 3SN6R 3EMLA 5ITCA 2J8WA 3QAPA 2YCXA 5AGFA 5JS5A 3FOPA 2AT9A 2YCZA 5KKHA 3DQBA 3VI0A 4AMJA 1GQAA 2Y00A 2NTWA 2Z73A 2XLDA 5BR5A 4WGYA 4LDOA 4A4MA 1H2SA 5JT4A 2Y04A 3OE6A 3UTWA 1F50A 1S05A 3DE8A 1P8HA 4MQSA 5B34A 2J4YA 4K5YA 2R4SA 2RH1A 1XJIA 1YYXA 1L9HA 2YL7A 1JGJA 5AHYA 3AM6A 1FBBA 1TN0A 5G36A 5G53A 3NS0A 2YLIA 4LDEA 1JAFA 1KG8A 2L6XA 3QBIA 5H2IA 4BWBA 4DKLA 4MBSA 5H2MA 3CAPA 4ULVA 3M15A 1EKYA 2I20A 3S8GB 5G2AA 3VRCA 5G2DA 3EH3B 4UG2A 4BEZA 2XLWA 4N6HA 4CDYA 1VJMA 3ZPQA 1CPRA 5B6WA 4QRYA 1CPQA 4JE9A 4WW3A 3NSBA 1PY6A 4QI1A 3HNJA 4EA3A 3VHZA 2M3GA 4XT3A 5G54A 5JVEA 1S8LA 3PXOA 4CX9A 2XLOA 1QHJA 1BBHA 1X0SA 5H2PA 3C9LA 1QQ3A 2Y02A 2XLHA 4XXJA 1APCA 4D4NA 4G7RB 3EH4B 3BVDB 5FJGA 5B6YA 3UZAA 4IB4A 3M4BA 4G7SB 1C3WA 3QDCA 1YZAA 4MD1A 4MQTA 1IXFA 1CWQA 5BR2A 1L0MA 1P8UA 3NMIA 5AZDA 4X31A 4J4QA 1M0KA 1Q5IA 3ZWIA 2YL3A 5AX0A 2KSBA 3X3BA 1BRRA 5AWZA 1JV7A 5DHHA 4GP5B 2R4RA 2LNLA 2Z55A 4XTLA 1F4ZA 5JJJA 3KJ6A 3D4SA 3NY8A 4OV0A 2BC5A 4BEYA 4DS7E 4N4WA 3RZEA 1CGOA 2J9BA 5B35A 3QJQB 4BVNA 2CCYA 3HNIA 3L1MA 4KLYA 2XL8A 4XTNA 1XIOA 3OE0A 1E0PA 2XLVA 1TN5A 3TOLA 4CJGA 3C62A 4FAAB 3V2WA 4JEBA 5ITEA 3QBLA 1EHKB 1CGNA 2NTUA 4N4YB 3DDLA 4TL3A 2XLMA 3HANA 3COCA 4BUOA 1X0I1 3V2YA 1S54A 5H2OA 3UTVA 1R84A 3ZQYA 3QJSB 4AMIA 2XL6A 1A7VA 4GBRA 3A7KA 3OE9A 3PWHA 4EIYA 4JQ6A 3REYA 4X32A 1O0AA 2YDOA 5B3IA 4FA7B 4GRVA 4DAJA 1M6TA 5A8EA 3S3DB 2QPDB 4PXFA 3PBLA 3HAOA 3M79A 2BRDA 3ZPRA 4G7QB 2VT4A 2XM4A 5DYSA 3UTYA 5LWEA 5G2CA 1UCQA 2Y01A 2YL1A 5AX1A 1S8JA 2YLGA 2KSAA 3ODUA 2QPEB 1E83A 3IQ6A 1JFPA 3UG9A 2Y03A 5H2KA 4G72B 3MBVA 3AYMA 1GUEA 1IW9A 5H2HA 1S51A 2ZZLA 4IAQA 4GP4B 3HAQA 3HNKA 5H2JA 2QLAA 5G28A 5F8UA 3QBGA 3AYNA 2YCWA 3T45A 4ER9A 1XMEB 1QKOA 1F88A 4EJ4A 3DE9A 1GU8A 4IARA 3X3CA 3PDSA 4U9EA 2I35A 1S53A 2YLDA 3S3BB 3ZTMA 3QJVB 1E12A 1QKPA 2JAFA 1E85A 4KNFA 3VGAA 3S3CB 1Q5JA 5B6XA 1JV6A 3QW0A 5JSLA 4PXKA 2XLEA 1GZMA 2EI4A 1NBBA 1AP9A 3QVZA 3ZTZA 3QVYA 4HYJA 1H68A 1MGYA 3TOMA 2KSYA 4HYXA 2X72A 1BRXA 4BV0A 5B2NA 2I1XA 3QW1A 4GYCA 1BRDA 1MQVA 3S8FB 4GPOA 3P0GA 4XT1A 3QAKA 3FOOA 1KGBA 5JLIA 1UAZA 5JJNA 5B0WA 3NYAA 1LN6A 3M4CA 4NC3A 3ZQVA 1IW6A 1RCPA 3WQJA 3PQRA 2JAGA 2XM0A 3C9MA 4JKVA 4MD2A 2G87A 5TGZA 1BM1A 4FPDA 2I21A 5C1MA 2KS9A 4D4XA 3QJTB 4FBZA 3UTXA 2YCYA 3HNLA 1KMEA 3OAXA 4LDLA 1E84A 5B6VA 3EH5B 4QIDA 1C8RA 5A45A 4WAVA 1LM3B 2WJLA 5ETZA 3NY9A 3U8PA 3QBKA 1PXRA 4Y9HA 256BA 2YKZA 4G71B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L35 A;  1FBK A;  3HAP A;  2ZFE A;  2YL0 A;  4CDA A;  3UON A;  3ZEV A;  4WGZ A;  3COD A;  4UHR A;  4L6R A;  3C63 A;  5JUA A;  1HZX A;  4CIP A;  2WJK A;  1VGO A;  1M0M A;  4X1H A;  3OE8 A;  3HAS A;  3QJR B;  4G70 B;  5A44 A;  1S52 A;  5DHG A;  3UZC A;  4DJH A;  5JJE A;  1P8I A;  1AT9 A;  3NMK A;  1QM8 A;  1U19 A;  4U9D A;  2PED A;  1PXS A;  5JRA A;  5JP7 A;  1R2N A;  5B6Z A;  2HPY A;  5J7A A;  1YZC A;  5H2N A;  1QPU A;  2F95 A;  2YDV A;  4CDV A;  3HAR A;  4HWL A;  1C8S A;  3RFM A;  1M0L A;  3NMJ A;  2ZIY A;  5EN0 A;  4JEA A;  3QJU B;  5H2L A;  1DZE A;  1E86 A;  4CJO A;  1X0K 1;  1KG9 A;  4JR8 A;  1YYJ A;  2F93 A;  3VVK A;  3ABW A;  3IQ5 A;  4XTO A;  3VG9 A;  4GP8 B;  3VW7 A;  5AHZ A;  3SN6 R;  3EML A;  5ITC A;  2J8W A;  3QAP A;  2YCX A;  5AGF A;  5JS5 A;  3FOP A;  2AT9 A;  2YCZ A;  5KKH A;  3DQB A;  3VI0 A;  4AMJ A;  1GQA A;  2Y00 A;  2NTW A;  2Z73 A;  2XLD A;  5BR5 A;  4WGY A;  4LDO A;  4A4M A;  1H2S A;  5JT4 A;  2Y04 A;  3OE6 A;  3UTW A;  1F50 A;  1S05 A;  3DE8 A;  1P8H A;  4MQS A;  5B34 A;  2J4Y A;  4K5Y A;  2R4S A;  2RH1 A;  1XJI A;  1YYX A;  1L9H A;  2YL7 A;  1JGJ A;  5AHY A;  3AM6 A;  1FBB A;  1TN0 A;  5G36 A;  5G53 A;  3NS0 A;  2YLI A;  4LDE A;  1JAF A;  1KG8 A;  2L6X A;  3QBI A;  5H2I A;  4BWB A;  4DKL A;  4MBS A;  5H2M A;  3CAP A;  4ULV A;  3M15 A;  1EKY A;  2I20 A;  3S8G B;  5G2A A;  3VRC A;  5G2D A;  3EH3 B;  4UG2 A;  4BEZ A;  2XLW A;  4N6H A;  4CDY A;  1VJM A;  3ZPQ A;  1CPR A;  5B6W A;  4QRY A;  1CPQ A;  4JE9 A;  4WW3 A;  3NSB A;  1PY6 A;  4QI1 A;  3HNJ A;  4EA3 A;  3VHZ A;  2M3G A;  4XT3 A;  5G54 A;  5JVE A;  1S8L A;  3PXO A;  4CX9 A;  2XLO A;  1QHJ A;  1BBH A;  1X0S A;  5H2P A;  3C9L A;  1QQ3 A;  2Y02 A;  2XLH A;  4XXJ A;  1APC A;  4D4N A;  4G7R B;  3EH4 B;  3BVD B;  5FJG A;  5B6Y A;  3UZA A;  4IB4 A;  3M4B A;  4G7S B;  1C3W A;  3QDC A;  1YZA A;  4MD1 A;  4MQT A;  1IXF A;  1CWQ A;  5BR2 A;  1L0M A;  1P8U A;  3NMI A;  5AZD A;  4X31 A;  4J4Q A;  1M0K A;  1Q5I A;  3ZWI A;  2YL3 A;  5AX0 A;  2KSB A;  3X3B A;  1BRR A;  5AWZ A;  1JV7 A;  5DHH A;  4GP5 B;  2R4R A;  2LNL A;  2Z55 A;  4XTL A;  1F4Z A;  5JJJ A;  3KJ6 A;  3D4S A;  3NY8 A;  4OV0 A;  2BC5 A;  4BEY A;  4N4W A;  3RZE A;  1CGO A;  2J9B A;  5B35 A;  3QJQ B;  4BVN A;  2CCY A;  3HNI A;  3L1M A;  4KLY A;  2XL8 A;  4XTN A;  1XIO A;  3OE0 A;  1E0P A;  2XLV A;  1TN5 A;  3TOL A;  4CJG A;  3C62 A;  4FAA B;  3V2W A;  4JEB A;  5ITE A;  3QBL A;  1EHK B;  1CGN A;  2NTU A;  4N4Y B;  3DDL A;  4TL3 A;  2XLM A;  3HAN A;  3COC A;  4BUO A;  1X0I 1;  3V2Y A;  1S54 A;  5H2O A;  3UTV A;  1R84 A;  3ZQY A;  3QJS B;  4AMI A;  2XL6 A;  1A7V A;  4GBR A;  3A7K A;  3OE9 A;  3PWH A;  4EIY A;  4JQ6 A;  3REY A;  4X32 A;  1O0A A;  2YDO A;  5B3I A;  4FA7 B;  4GRV A;  4DAJ A;  1M6T A;  5A8E A;  3S3D B;  2QPD B;  4PXF A;  3PBL A;  3HAO A;  3M79 A;  2BRD A;  3ZPR A;  4G7Q B;  2VT4 A;  2XM4 A;  5DYS A;  3UTY A;  5LWE A;  5G2C A;  1UCQ A;  2Y01 A;  2YL1 A;  5AX1 A;  1S8J A;  2YLG A;  2KSA A;  3ODU A;  2QPE B;  1E83 A;  3IQ6 A;  1JFP A;  3UG9 A;  2Y03 A;  5H2K A;  4G72 B;  3MBV A;  3AYM A;  1GUE A;  1IW9 A;  5H2H A;  1S51 A;  2ZZL A;  4IAQ A;  4GP4 B;  3HAQ A;  3HNK A;  5H2J A;  2QLA A;  5G28 A;  5F8U A;  3QBG A;  3AYN A;  2YCW A;  3T45 A;  4ER9 A;  1XME B;  1QKO A;  1F88 A;  4EJ4 A;  3DE9 A;  1GU8 A;  4IAR A;  3X3C A;  3PDS A;  4U9E A;  2I35 A;  1S53 A;  2YLD A;  3S3B B;  3ZTM A;  3QJV B;  1E12 A;  1QKP A;  2JAF A;  1E85 A;  4KNF A;  3VGA A;  3S3C B;  1Q5J A;  5B6X A;  1JV6 A;  3QW0 A;  5JSL A;  4PXK A;  2XLE A;  1GZM A;  2EI4 A;  1NBB A;  1AP9 A;  3QVZ A;  3ZTZ A;  3QVY A;  4HYJ A;  1H68 A;  1MGY A;  3TOM A;  2KSY A;  4HYX A;  2X72 A;  1BRX A;  4BV0 A;  5B2N A;  2I1X A;  3QW1 A;  4GYC A;  1BRD A;  1MQV A;  3S8F B;  4GPO A;  3P0G A;  4XT1 A;  3QAK A;  3FOO A;  1KGB A;  5JLI A;  1UAZ A;  5JJN A;  5B0W A;  3NYA A;  1LN6 A;  3M4C A;  4NC3 A;  3ZQV A;  1IW6 A;  1RCP A;  3WQJ A;  3PQR A;  2JAG A;  2XM0 A;  3C9M A;  4JKV A;  4MD2 A;  2G87 A;  5TGZ A;  1BM1 A;  4FPD A;  2I21 A;  5C1M A;  2KS9 A;  4D4X A;  3QJT B;  4FBZ A;  3UTX A;  2YCY A;  3HNL A;  1KME A;  3OAX A;  4LDL A;  1E84 A;  5B6V A;  3EH5 B;  4QID A;  1C8R A;  5A45 A;  4WAV A;  1LM3 B;  2WJL A;  5ETZ A;  3NY9 A;  3U8P A;  3QBK A;  1PXR A;  4Y9H A;  256B A;  2YKZ A;  4G71 B; 
#chains in the Genus database with same CATH topology
 3LS0 A;  2P6V A;  5L0I A;  1OCZ C;  3ECS A;  3COD A;  5BQG A;  4NTF A;  4L6R A;  4CIP A;  2ZD9 A;  1VGO A;  1EI7 A;  3OE8 A;  4LLC A;  3VF0 A;  3HAS A;  1L7C A;  4DRJ B;  3QJR B;  1S52 A;  5DQZ A;  3KPH A;  3NMK A;  1U19 A;  3L0I A;  1A41 A;  1OW8 A;  4MVZ A;  1K05 A;  3S28 A;  2OJE D;  3SP1 A;  2KC3 A;  2KSF A;  2GAQ A;  2R25 A;  4Z9H A;  1M0L A;  4JEA A;  2GDC A;  3EG9 A;  4CJO A;  1KG9 A;  3S29 A;  2P0N A;  3DD7 A;  1YYJ A;  2YZS A;  1TWC A;  5AHZ A;  3UGO A;  5JS5 A;  2AT9 A;  3O55 A;  3DQB A;  4AMJ A;  2Y00 A;  1B68 A;  4NTA A;  3O6X A;  2DB4 A;  1FNT c;  1U0B B;  3CEX A;  3U9M A;  5JT4 A;  2PX0 A;  2R7S A;  3UTW A;  1OKK D;  5EHH A;  1F50 A;  4YL3 A;  3B29 A;  4J7Y A;  2PBE A;  4YT2 A;  3C8G D;  3RH3 A;  1XJI A;  2J0X A;  1JGJ A;  5AHY A;  2VC9 A;  5KYN A;  1FBB A;  1TN0 A;  5G53 A;  1ZHW A;  3T6J A;  2Q3T A;  1SF8 A;  4O6Y A;  1VMA A;  4F4B A;  2J7P D;  4U5B E;  2L6X A;  1MMG A;  3S0X A;  1V54 C;  4DKL A;  3GM3 A;  2KNH A;  1XZQ A;  5H2M A;  3CAP A;  2O9X A;  4XPX A;  5DVW A;  5D92 A;  2GA0 A;  3S8G B;  3V5Z A;  2XSE A;  4LER A;  4BEZ A;  4CDY A;  1VJM A;  1HE9 A;  4FWV A;  5B6W A;  4QRY A;  1CPQ A;  4JE9 A;  3V5Y A;  1BR4 A;  3TJ5 A;  4DBR A;  3VHZ A;  4WAB A;  4P9T A;  3UMK A;  2OKU A;  3EG9 B;  4BPM A;  4CX9 A;  5COF A;  1QHJ A;  4PJM A;  4D4N A;  4G7R B;  3EH4 B;  3HTK C;  4AE4 B;  3BVD B;  3KYI A;  4KC9 A;  3IEE A;  3QDC A;  2Z15 A;  3N0T A;  1L0M A;  4J4Q A;  2OOC A;  3ZWI A;  5B1A C;  2YL3 A;  3X3B A;  2KSB A;  1BRR A;  2IXO A;  4YWQ A;  3ASO C;  1RMV A;  3NKE A;  4PJN A;  5DHH A;  2VCA A;  3U3B A;  4U5C E;  2BC5 A;  3EHN A;  4BJ6 C;  4LDQ A;  4WJ0 A;  2KK1 A;  5B35 A;  1YJG A;  3QJQ B;  1M2V A;  3QZC A;  3VAY A;  2XL8 A;  2L81 A;  3WAQ A;  4E7S A;  3EZH A;  2VH3 A;  2LCH A;  4MVM A;  5CI8 A;  5D91 A;  3SXY A;  4PR9 A;  5ITE A;  4W8P A;  1FFH A;  1BR1 A;  3OA1 A;  1V55 C;  2HMQ A;  3DDL A;  3HAN A;  3JRT A;  2R7X A;  3DXJ F;  2ASR A;  3QJS B;  2PP4 A;  4KBL A;  4EUK B;  1A7V A;  4U5G A;  3PWH A;  3O10 A;  3GEH A;  4JRZ A;  3SYN A;  4JQ6 A;  2YEV A;  3SXM A;  2UUI A;  1O0A A;  5L0J A;  3TUL A;  1I4Y A;  3CQZ A;  4PXF A;  2R7O A;  1A0B A;  2P7V A;  3M79 A;  3ZPR A;  1H6G A;  1NU7 D;  2HV6 A;  2WZG A;  4OIO F;  2DGJ A;  2YL1 A;  4XEK A;  4G7Z F;  2ETS A;  5FZT A;  4DVY P;  1FMV A;  3FMS A;  2LQG A;  3H2U A;  1M2V B;  3U8V A;  4U5F E;  4ANJ A;  3RIP A;  4G72 B;  4FES A;  4OIR F;  4U5E E;  3DJU B;  3AYM A;  1GUE A;  4YJW A;  2NPU A;  1S51 A;  5A69 A;  3ZC4 A;  3HNK A;  5F8U A;  3QBG A;  3W2W A;  3R2P A;  1ORJ A;  4MTG A;  4I1O B;  2NUP A;  4EJ4 A;  2MWQ A;  3IPM O;  3S9O A;  3EJN A;  2E87 A;  3UGP A;  3ZTM A;  1N1C A;  3BRJ A;  2IM8 A;  1TWH A;  4OIQ F;  5L0G A;  3WOD F;  4PXK A;  1ZHX A;  1I4Z A;  2EI4 A;  1ZHY A;  1NBB A;  3ZTZ A;  3GAN A;  3RQG A;  1HE1 A;  1Q0G A;  2KSY A;  2VAS A;  3AG4 C;  3DZA A;  1VOM A;  1Z23 A;  5E3C A;  4MTF A;  3NYJ A;  5A6B A;  4YL1 A;  1MQV A;  3S8F B;  4GPO A;  4XT1 A;  2AWY A;  5B0W A;  3DM9 B;  3JSE O;  3M4C A;  3DAF A;  4O79 A;  4HFF B;  5BUO A;  3PQR A;  3C9M A;  4JKV A;  2G87 A;  5TGZ A;  2V26 A;  3GWN A;  2J9W A;  1ORS C;  2IXN A;  3UTX A;  4BJ6 A;  4IJJ A;  2YCY A;  5FCL A;  4PFP A;  3TJ6 A;  3EH5 B;  1C8R A;  4E17 A;  3FDQ A;  1OCC C;  4WAV A;  1YA7 O;  1YDI A;  3RW0 A;  3QBK A;  2HJM A;  4Y9H A;  4EBB A;  4G71 B;  4E18 A;  5DS6 A;  2YL0 A;  4CDA A;  2A0B A;  5F5F A;  4Q5S F;  3OEO A;  4CS7 A;  5JUA A;  4PK4 A;  1M0M A;  2G3K A;  1XZP A;  1ZZP A;  4O6N A;  5CI9 A;  4RBN A;  5A44 A;  1TWA A;  3MYI A;  5DHG A;  3UZC A;  4DJH A;  5JJE A;  4U9D A;  1K04 A;  1R4T A;  1R2N A;  2F95 A;  1VK5 A;  4XLN F;  3WHN A;  1GGQ A;  4JC7 A;  3U0C A;  3HAR A;  2Q4F A;  3NMJ A;  2ZIY A;  4BJ5 A;  1HMO A;  2KQ9 A;  2H7O A;  3L34 A;  4X0R A;  2Y3B A;  4JR8 A;  3VVK A;  4G78 A;  3VG9 A;  3ITF A;  3S90 A;  3VYW A;  3SN6 R;  5L0H A;  5ITC A;  2J8W A;  1U89 A;  3X1O A;  3G4Z A;  3DWW A;  2XS1 A;  5AC4 A;  2Z73 A;  1OR3 A;  4EWC A;  2H7V C;  1V4A A;  2XLD A;  5F28 E;  5BR5 A;  3W2V A;  4LDO A;  1H2S A;  1QLE C;  2Y04 A;  2IXP A;  4ONS A;  4M63 A;  5E3A A;  3AG2 C;  1S05 A;  3RQF A;  3DE8 A;  2R7Q A;  3KL4 A;  2XXA A;  5B34 A;  4K5Y A;  2R4S A;  4E7Z A;  5IY5 C;  1YYX A;  2EIK C;  1MNE A;  3PCV A;  2YL7 A;  2LFD A;  3C7J A;  4RDA A;  4MW8 A;  4QDL A;  3JSZ A;  3NS0 A;  4EBK A;  4I3M A;  3TD7 A;  4OD4 A;  5K0I A;  3QBI A;  4OIP F;  4BWB A;  5KYW A;  1C02 A;  3ABL C;  2LK4 A;  1EKY A;  1OXB A;  1Z3I X;  2EPN A;  3VRC A;  2ICW G;  3EH3 B;  3MBG A;  1ST6 A;  1OCO C;  1JPN A;  3SXK A;  4MVU A;  3LES A;  3HNJ A;  4EA3 A;  1SR2 A;  2Y39 A;  2DI3 A;  2M3G A;  2EPK X;  1JOG A;  2R7T A;  5G54 A;  2CNW A;  1WAS A;  2BL2 A;  5H2P A;  2MYS A;  1KTM A;  4XXJ A;  1APC A;  3S84 A;  1WN0 A;  4YL0 A;  5B6Y A;  3UZA A;  2QTV A;  2VB6 A;  3RQE A;  2L6H A;  1M56 C;  1S7Z A;  4G7S B;  4MD1 A;  1O5H A;  2B0J A;  4CSA C;  2EPM X;  4X31 A;  1V74 B;  1A7D A;  1Q5I A;  5AX0 A;  4BG0 A;  1KU2 A;  2XXA B;  4N6C A;  3US6 A;  5AWZ A;  3UMH A;  2Z55 A;  3LUT B;  4XTL A;  2YWA A;  1HW1 A;  4DS7 E;  4AE4 A;  4N4W A;  3RZE A;  1CGO A;  2CCY A;  4KLY A;  4KNW A;  3RF3 A;  5DS4 A;  5KYU B;  5KYW B;  2C04 A;  2R7U A;  4XEV A;  2Y3D A;  2NUT A;  2Q7R A;  3AG3 C;  3V2W A;  2QNL A;  3SZR A;  1D1A A;  2OEX A;  3UNG C;  2JPU A;  4JTC B;  5EK0 A;  2GWW A;  1JR8 A;  2R7V A;  5EGY A;  4MVQ A;  3RYL A;  2QY9 A;  4YN0 B;  4ZLD A;  3COC A;  2A0U A;  1X0I 1;  4BUO A;  3V2Y A;  3FXH A;  4G7H F;  1R84 A;  1K40 A;  1VLS A;  3A7K A;  3TQO A;  4EKW A;  4DBQ A;  4H4K C;  4X32 A;  2YDO A;  3KYJ A;  3LLK A;  5A8E A;  4CS8 C;  3PBL A;  4A2N B;  4JW1 A;  2BRD A;  1ZU4 A;  2XM4 A;  1ZYR F;  1OXK A;  5L0D A;  5DYS A;  1NLX A;  1D1C A;  5E33 A;  1JPJ A;  3AOU A;  1S8J A;  4QI2 A;  2QPE B;  3IQ6 A;  2AP3 A;  3L8I A;  5GPG B;  3GOR A;  3NDB B;  2NUT B;  2B0H A;  5L0F A;  2ZZL A;  4JJF A;  5G28 A;  3BEH A;  1C03 A;  4P6I C;  1F88 A;  3DE9 A;  5A6B D;  1AEP A;  3N2Z B;  3X2Q C;  1O3U A;  2JAF A;  1TKN A;  3QW0 A;  5JSL A;  3Q7G A;  3GEI A;  2LIG A;  1LS1 A;  5CIV A;  3GEE A;  3JTL O;  4HYJ A;  2A68 F;  2X72 A;  2ZXR A;  1LKX A;  1BRX A;  5B2N A;  4JCH A;  2I1X A;  3L8J A;  1R5I D;  2H8A A;  3TK0 A;  3QW1 A;  4I1M A;  4GYC A;  1BRD A;  2C03 A;  4XWJ A;  1JRA A;  4CSA A;  4IWB A;  3ZSU A;  3H65 A;  2EIM C;  3J06 A;  5JJN A;  3PDM P;  3KMI A;  1J8Y F;  3ZQV A;  4PAC A;  3JZ0 A;  4MVS A;  3I5Q A;  4CBE A;  2XM0 A;  4DOZ A;  3B0U X;  5KYY B;  1BM1 A;  4FPD A;  2I21 A;  3RFY A;  3C18 A;  4GYT A;  4BJ5 C;  2OU6 A;  1YAU O;  1D0Y A;  3HNL A;  1MMN A;  1OKK A;  2NSF A;  4LDL A;  5B6V A;  2KGO A;  3IHU A;  4QID A;  2P1A A;  1RKE A;  1T6U A;  5ETZ A;  3U8P A;  4IAO A;  4C3D A;  1PXR A;  256B A;  1PD1 A;  1LI7 A;  2J46 A;  1FBK A;  1EA8 A;  2ZFE A;  3CSK A;  3NYM A;  4ZLC A;  3ZEV A;  4WGZ A;  4EHP A;  4UHR A;  3K1I A;  1G4W R;  3C63 A;  3FAP B;  1HZX A;  2WJK A;  5B3S C;  2PNO A;  2J7P A;  2RSE B;  5L0C A;  3JCU Q;  1LE2 A;  2Y3G A;  2PED A;  1PXS A;  5JP7 A;  2MHR A;  5B6Z A;  2X51 A;  1YZC A;  1RXQ A;  1QPU A;  4E0I A;  3ZDL A;  1C8S A;  4Q7C A;  2H7B A;  3RFM A;  1GS9 A;  5EN0 A;  3U2L A;  4CS8 A;  3QJU B;  5H2L A;  1DZE A;  1E86 A;  2EIN C;  2F93 A;  3ABW A;  3LAY A;  1YA9 A;  3WG7 C;  4G7O F;  4GP8 B;  3VW7 A;  3EML A;  4JCZ A;  2A6H F;  5AGF A;  3FOP A;  2YCZ A;  5KKH A;  3EH1 A;  2HS5 A;  4AL1 A;  3VI0 A;  1WAT A;  2NTW A;  1FMW A;  3F46 A;  3ABK C;  2KYH A;  3MYF A;  4A4M A;  3I4U A;  3E9V A;  4G0H A;  1P8H A;  3Q7L A;  4MQS A;  1RKE B;  1OW6 A;  2RH1 A;  3C8G B;  2I15 A;  1T9K A;  1RKC A;  4LDR A;  3V7O A;  3AM6 A;  1A7E A;  4YT8 A;  5G36 A;  2YLI A;  4AK9 A;  1ZHZ A;  2LSE A;  4XLP F;  1JAF A;  1KG8 A;  1RJ9 A;  2HZ8 A;  1O87 A;  1QZX A;  4MQ9 F;  4MBS A;  3M15 A;  3M1C B;  2I20 A;  1ZVZ A;  2OJQ A;  5A6J A;  5G2A A;  5G2D A;  3EHM A;  5KYX B;  1JMW A;  4UG2 A;  2A1D D;  3FHD A;  4OD5 A;  2XLW A;  4DXW A;  1Z5Z A;  2G62 A;  4WW3 A;  1BR2 A;  2PFD A;  3NSB A;  1PY6 A;  2CGE A;  2V3C C;  3AGU A;  2HSB A;  4XT3 A;  5JVE A;  1NG1 A;  2XLO A;  1BBH A;  4NY3 A;  1X0S A;  2NG1 A;  3C9L A;  1MMA A;  3RVZ A;  4AX2 A;  2Y02 A;  2W9Y A;  2R02 A;  3SEO A;  2P61 A;  4IB4 A;  1Z7Q c;  4KI2 A;  4J7T A;  4ULW A;  1YZA A;  1CWQ A;  4R32 A;  4MVO A;  1P8U A;  1ZW3 A;  4BJ1 A;  3B0V C;  3AJM A;  1LS4 A;  3T4R A;  3T9O A;  3POV A;  1JV7 A;  4GP5 B;  2LNL A;  2Q9A A;  2WVN A;  4BEJ A;  1NU9 C;  4OV0 A;  2IOQ A;  5DS5 A;  3B0P A;  1ZHT A;  2W45 A;  3HNI A;  3L1M A;  1RJ9 B;  4NTB A;  1XIO A;  1PD0 A;  1AVO B;  2R7R A;  1TN5 A;  1E0P A;  1H9G A;  3G50 A;  3TOL A;  3LNM B;  1TR2 A;  3C62 A;  3NKD A;  4FAA B;  2DYS C;  3GWL A;  1WTY A;  4LDK A;  3QBL A;  1T01 A;  1EHK B;  1BDJ B;  2NTU A;  1ZW2 A;  4N4Y B;  4TL3 A;  2XLM A;  1BZ4 A;  3N24 A;  3RKO F;  2YQY A;  5COG A;  3JYH A;  5KYU A;  2XL6 A;  4J30 B;  2ZXP A;  4EIY A;  1OQC A;  2EIL C;  3REY A;  4C3E A;  1LPE A;  2CDQ A;  4GRV A;  4DAJ A;  3ASN C;  3B9Q A;  2QPD B;  2HSQ A;  4DVZ A;  1PCX A;  1LIH A;  2LD6 A;  2VT4 A;  4C3B A;  1SZI A;  5LWE A;  2KW3 C;  2Y01 A;  1Z63 A;  5AX1 A;  1ORY A;  1D0X A;  2XS8 A;  4PFO A;  3E70 C;  2Y03 A;  2HJ3 A;  4YK5 A;  2OG2 A;  2ZXW C;  3U3F A;  3W4Y A;  1VYK A;  3JT1 A;  5H2H A;  4YT4 A;  3NG1 A;  2R03 A;  3HAQ A;  2QLA A;  1VYI A;  2W4M A;  4MW3 A;  3T45 A;  4YT5 A;  3U2M A;  4GEH A;  4N06 A;  1GU8 A;  1FAP B;  1WWP A;  3KKB A;  3LEO A;  4P9F A;  3A9C A;  2I35 A;  2YLD A;  1W2W A;  1E12 A;  4HE8 D;  4NCQ A;  3R7C A;  2PF4 E;  3DI5 A;  2OEV A;  1JV6 A;  2CYD A;  2VCB A;  2YRF A;  1F1M A;  4CS9 A;  1GZM A;  1AP9 A;  3U9J A;  1NFN A;  4K0D A;  4PJJ A;  3V5X A;  2XL4 A;  1E2X A;  1HMD A;  1H68 A;  2PX3 A;  1MGY A;  4HYX A;  3K66 A;  3MX3 A;  4BV0 A;  3DMD A;  3K1I C;  3LJB A;  4EBJ A;  2JX0 A;  1VLT A;  1VB5 A;  2L9J A;  2WZL A;  3EGD A;  3P0G A;  2DYR C;  3QAK A;  1KGB A;  4DRH B;  1Q0D A;  3IQT A;  5TJ5 E;  1YAR O;  4NC3 A;  2Q9B A;  2UUH A;  4DRI B;  2EPO A;  1RCP A;  2WZF A;  3WQJ A;  2FAP B;  3PMR A;  4XTK A;  4MD2 A;  1G5Z A;  5C1M A;  4D4X A;  2OQM A;  2R9R B;  3QJT B;  4FBZ A;  3UR3 C;  2JD3 A;  1KME A;  3K1H A;  1E84 A;  1Z6A A;  5A45 A;  3DKA A;  2EPL X;  4JTD B;  5A6A A;  1LM3 B;  2WJL A;  1YVI A;  3DM5 A;  4MVR A;  3EPV A;  4L35 A;  2CW0 F;  1FFT C;  2LP4 A;  2NSG A;  3HAP A;  2FFH A;  2HKV A;  1U6H A;  3FVY A;  2WVQ A;  5KYY A;  3UON A;  4J32 B;  2EIJ C;  1Q0F A;  4O7G A;  4X1H A;  2XRH A;  4XPW A;  2Q00 A;  4G70 B;  2FGY A;  4KNV A;  1P8I A;  1AT9 A;  1QM8 A;  1UFB A;  5JRA A;  2L7A A;  3K7D A;  1QSP A;  1GM5 A;  2HPY A;  3G4X A;  4O6M A;  5J7A A;  1WGW A;  5H2N A;  1Q0K A;  2YDV A;  4B6I A;  4CDV A;  2A69 F;  4HWL A;  2W4B A;  4HEA J;  3EGD B;  4XQ1 A;  5B1B C;  2Q9C A;  5F5H A;  1X0K 1;  4U5H A;  3NYL A;  2L6F A;  3IQ5 A;  4BJT A;  4XTO A;  4H54 A;  5E2Q A;  4LAC B;  3B71 A;  2AVK A;  1NZE A;  3DAG A;  2GFH A;  3QAP A;  2YCX A;  4K7B A;  2HV7 A;  1GQA A;  3PHF 2;  2M4E A;  4GQH A;  2Y69 C;  4WGY A;  1TFO B;  3EQL F;  3SNH A;  3S27 A;  3OE6 A;  4RD9 A;  4U5D E;  2G3V A;  3MLG A;  1YLM A;  3EFO A;  2J4Y A;  2RD9 A;  5COM A;  1L9H A;  3OWT A;  4IGG A;  1LVK A;  3JRM O;  3AQC A;  1H9T A;  3AG1 C;  4JIO A;  4LDE A;  4QI0 A;  3LNR A;  1M2O A;  4BEM J;  1HY5 A;  3VM6 A;  5H2I A;  2OCC C;  2R7W A;  3KH2 A;  4ULV A;  1L3P A;  1XWJ A;  1M57 C;  1HW2 A;  4I44 A;  1SMY F;  1ZU5 A;  3AGT A;  2A6E F;  2TMV P;  2J9V A;  4N6H A;  3C8G A;  3ZPQ A;  1G4U S;  1CPR A;  3I5P A;  4JUR I;  4QI1 A;  1IW7 F;  4Z9I A;  3T6G B;  3RVY A;  1Q0M A;  1S8L A;  3PXO A;  3SXZ A;  3HJC A;  1QQ3 A;  2XLH A;  2KJG A;  5FJG A;  1OR2 A;  2AU5 A;  4A4A A;  5DQT A;  1D1B A;  2ZPA A;  5KYX A;  3M4B A;  2YVK A;  4K1O A;  1C3W A;  3ABM C;  1TQG A;  4MQT A;  1IXF A;  5BR2 A;  3F47 A;  3NMI A;  5AZD A;  1M0K A;  1OW7 A;  3GOD A;  3EFO B;  1CGM E;  4PJL A;  1H7I A;  2R4R A;  1NSG B;  2M64 A;  3EZI A;  3JYY A;  1F4Z A;  5JJJ A;  3KJ6 A;  3CZ6 A;  3D4S A;  3NY8 A;  4BEY A;  2IYL D;  5T3W A;  3W8I A;  4Z9J A;  5BQI A;  3GM1 A;  4HFK B;  1DOV A;  2J9B A;  4BVN A;  3T6B A;  3QTH A;  1Y4C A;  1MND A;  4XTN A;  4MND A;  4JZA A;  3EGX A;  4CIH A;  3OE0 A;  4JJG A;  2XLV A;  4UDV A;  1T6I A;  4CJG A;  1LE4 A;  2R05 A;  4JEB A;  1WOL A;  1T5O A;  2QUP A;  1TWG A;  1C17 M;  4MTO A;  1CGN A;  2WL8 A;  3H2V A;  2CNW D;  3MFN A;  1UG7 A;  3Q6N A;  1S54 A;  5H2O A;  1VTM P;  3UTV A;  3ZQY A;  4AMI A;  3O39 A;  1EQ1 A;  3C8Z A;  1FTS A;  4GBR A;  3OE9 A;  3K33 A;  3LS1 A;  4XPY A;  1TFK B;  3W8H A;  5B3I A;  4FA7 B;  4FAP B;  3HKK A;  1M6T A;  3S3D B;  3Q6M A;  2X0C A;  4LLE A;  2YHS A;  2J9U A;  3QMK A;  3HAO A;  1NFO A;  2Y3H A;  1IZM A;  4G7Q B;  4CS9 C;  3UTY A;  2J0W A;  2HMZ A;  2NUP B;  1UCQ A;  5G2C A;  1J8M F;  1KNY A;  2YLG A;  2KSA A;  2IBF A;  2HFI A;  3ODU A;  1E83 A;  2J45 A;  2D5R B;  1JFP A;  4C7O A;  4IRU A;  3UG9 A;  3CAX A;  5H2K A;  5HSW A;  3MBV A;  1OCR C;  3EGX B;  1IW9 A;  2LFF A;  2I8B A;  4IAQ A;  4Q4Z F;  3GM2 A;  4GP4 B;  4DJ9 A;  5H2J A;  3UMI A;  2WB7 A;  2ZXO A;  2YCW A;  3AYN A;  2VCC A;  4ER9 A;  1XME B;  1QKO A;  4W8K A;  2D4U A;  4IAR A;  5BQH A;  3LLI A;  3X3C A;  2L6G A;  3ATP A;  3PDS A;  4U9E A;  5AC5 A;  1SYQ A;  1S53 A;  5L3V A;  3S3B B;  4OIN F;  3QJV B;  2AWC A;  1QKP A;  1D0Z A;  1G8X A;  1I5N A;  1E85 A;  1QKR A;  3EH2 A;  4KNF A;  3VGA A;  3S3C B;  1Q5J A;  5B6X A;  1LI5 A;  1QVX A;  2XLE A;  4NQF A;  1T6Q A;  3QVZ A;  4AL0 A;  3QVY A;  2IXM A;  4JVS A;  5A6K A;  3TOM A;  4FX5 A;  1MMD A;  2HUJ A;  3NRH A;  3ZG1 A;  5T1D B;  3K6B A;  5L3Q A;  4JTA B;  3AQB A;  4XEF A;  3FAJ A;  3FOO A;  5JLI A;  1UAZ A;  3ZVR A;  3NYA A;  1LN6 A;  3LEV A;  4E0H A;  1FR0 A;  1Y6D A;  1IW6 A;  2F22 A;  4C7O B;  2JAG A;  2WVO A;  4MS2 A;  5HV9 A;  2KS9 A;  3HLZ A;  1PV3 A;  3A11 A;  1DOW A;  1AUE A;  3ZIB A;  2QE9 A;  3OAX A;  5T3T A;  3U5S A;  5DLJ A;  3IQC A;  3DJN B;  3NY9 A;  2YKZ A;  2BE5 F; 
#chains in the Genus database with same CATH homology
 4L35 A;  1FBK A;  3HAP A;  2ZFE A;  2YL0 A;  4CDA A;  3UON A;  3ZEV A;  4WGZ A;  3COD A;  4UHR A;  4L6R A;  3C63 A;  5JUA A;  1HZX A;  4CIP A;  2WJK A;  1VGO A;  1M0M A;  4X1H A;  3OE8 A;  3HAS A;  3QJR B;  4G70 B;  5A44 A;  1S52 A;  5DHG A;  3UZC A;  4DJH A;  5JJE A;  1P8I A;  1AT9 A;  3NMK A;  1QM8 A;  1U19 A;  4U9D A;  2PED A;  1PXS A;  5JRA A;  5JP7 A;  1R2N A;  5B6Z A;  2HPY A;  5J7A A;  1YZC A;  5H2N A;  1QPU A;  2F95 A;  2YDV A;  4CDV A;  3HAR A;  4HWL A;  1C8S A;  3RFM A;  1M0L A;  3NMJ A;  2ZIY A;  5EN0 A;  4JEA A;  3QJU B;  5H2L A;  1DZE A;  1E86 A;  4CJO A;  1X0K 1;  1KG9 A;  4JR8 A;  1YYJ A;  2F93 A;  3VVK A;  3ABW A;  3IQ5 A;  4XTO A;  3VG9 A;  4GP8 B;  3VW7 A;  5AHZ A;  3SN6 R;  3EML A;  5ITC A;  2J8W A;  3QAP A;  2YCX A;  5AGF A;  5JS5 A;  3FOP A;  2AT9 A;  2YCZ A;  5KKH A;  3DQB A;  3VI0 A;  4AMJ A;  1GQA A;  2Y00 A;  2NTW A;  2Z73 A;  2XLD A;  5BR5 A;  4WGY A;  4LDO A;  4A4M A;  1H2S A;  5JT4 A;  2Y04 A;  3OE6 A;  3UTW A;  1F50 A;  1S05 A;  3DE8 A;  1P8H A;  4MQS A;  5B34 A;  2J4Y A;  4K5Y A;  2R4S A;  2RH1 A;  1XJI A;  1YYX A;  1L9H A;  2YL7 A;  1JGJ A;  5AHY A;  3AM6 A;  1FBB A;  1TN0 A;  5G36 A;  5G53 A;  3NS0 A;  2YLI A;  4LDE A;  1JAF A;  1KG8 A;  2L6X A;  3QBI A;  5H2I A;  4BWB A;  4DKL A;  4MBS A;  5H2M A;  3CAP A;  4ULV A;  3M15 A;  1EKY A;  2I20 A;  3S8G B;  5G2A A;  3VRC A;  5G2D A;  3EH3 B;  4UG2 A;  4BEZ A;  2XLW A;  4N6H A;  4CDY A;  1VJM A;  3ZPQ A;  1CPR A;  5B6W A;  4QRY A;  1CPQ A;  4JE9 A;  4WW3 A;  3NSB A;  1PY6 A;  4QI1 A;  3HNJ A;  4EA3 A;  3VHZ A;  2M3G A;  4XT3 A;  5G54 A;  5JVE A;  1S8L A;  3PXO A;  4CX9 A;  2XLO A;  1QHJ A;  1BBH A;  1X0S A;  5H2P A;  3C9L A;  1QQ3 A;  2Y02 A;  2XLH A;  4XXJ A;  1APC A;  4D4N A;  4G7R B;  3EH4 B;  3BVD B;  5FJG A;  5B6Y A;  3UZA A;  4IB4 A;  3M4B A;  4G7S B;  1C3W A;  3QDC A;  1YZA A;  4MD1 A;  4MQT A;  1IXF A;  1CWQ A;  5BR2 A;  1L0M A;  1P8U A;  3NMI A;  5AZD A;  4X31 A;  4J4Q A;  1M0K A;  1Q5I A;  3ZWI A;  2YL3 A;  5AX0 A;  2KSB A;  3X3B A;  1BRR A;  5AWZ A;  1JV7 A;  5DHH A;  4GP5 B;  2R4R A;  2LNL A;  2Z55 A;  4XTL A;  1F4Z A;  5JJJ A;  3KJ6 A;  3D4S A;  3NY8 A;  4OV0 A;  2BC5 A;  4BEY A;  4DS7 E;  4N4W A;  3RZE A;  1CGO A;  2J9B A;  5B35 A;  3QJQ B;  4BVN A;  2CCY A;  3HNI A;  3L1M A;  4KLY A;  2XL8 A;  4XTN A;  1XIO A;  3OE0 A;  1E0P A;  2XLV A;  1TN5 A;  3TOL A;  4CJG A;  3C62 A;  4FAA B;  3V2W A;  4JEB A;  5ITE A;  3QBL A;  1EHK B;  1CGN A;  2NTU A;  4N4Y B;  3DDL A;  4TL3 A;  2XLM A;  3HAN A;  3COC A;  4BUO A;  1X0I 1;  3V2Y A;  1S54 A;  5H2O A;  3UTV A;  1R84 A;  3ZQY A;  3QJS B;  4AMI A;  2XL6 A;  1A7V A;  4GBR A;  3A7K A;  3OE9 A;  3PWH A;  4EIY A;  4JQ6 A;  3REY A;  4X32 A;  1O0A A;  2YDO A;  5B3I A;  4FA7 B;  4GRV A;  4DAJ A;  1M6T A;  5A8E A;  3S3D B;  2QPD B;  4PXF A;  3PBL A;  3HAO A;  3M79 A;  2BRD A;  3ZPR A;  4G7Q B;  2VT4 A;  2XM4 A;  5DYS A;  3UTY A;  5LWE A;  5G2C A;  1UCQ A;  2Y01 A;  2YL1 A;  5AX1 A;  1S8J A;  2YLG A;  2KSA A;  3ODU A;  2QPE B;  1E83 A;  3IQ6 A;  1JFP A;  3UG9 A;  2Y03 A;  5H2K A;  4G72 B;  3MBV A;  3AYM A;  1GUE A;  1IW9 A;  5H2H A;  1S51 A;  2ZZL A;  4IAQ A;  4GP4 B;  3HAQ A;  3HNK A;  5H2J A;  2QLA A;  5G28 A;  5F8U A;  3QBG A;  3AYN A;  2YCW A;  3T45 A;  4ER9 A;  1XME B;  1QKO A;  1F88 A;  4EJ4 A;  3DE9 A;  1GU8 A;  4IAR A;  3X3C A;  3PDS A;  4U9E A;  2I35 A;  1S53 A;  2YLD A;  3S3B B;  3ZTM A;  3QJV B;  1E12 A;  1QKP A;  2JAF A;  1E85 A;  4KNF A;  3VGA A;  3S3C B;  1Q5J A;  5B6X A;  1JV6 A;  3QW0 A;  5JSL A;  4PXK A;  2XLE A;  1GZM A;  2EI4 A;  1NBB A;  1AP9 A;  3QVZ A;  3ZTZ A;  3QVY A;  4HYJ A;  1H68 A;  1MGY A;  3TOM A;  2KSY A;  4HYX A;  2X72 A;  1BRX A;  4BV0 A;  5B2N A;  2I1X A;  3QW1 A;  4GYC A;  1BRD A;  1MQV A;  3S8F B;  4GPO A;  3P0G A;  4XT1 A;  3QAK A;  3FOO A;  1KGB A;  5JLI A;  1UAZ A;  5JJN A;  5B0W A;  3NYA A;  1LN6 A;  3M4C A;  4NC3 A;  3ZQV A;  1IW6 A;  1RCP A;  3WQJ A;  3PQR A;  2JAG A;  2XM0 A;  3C9M A;  4JKV A;  4MD2 A;  2G87 A;  5TGZ A;  1BM1 A;  4FPD A;  2I21 A;  5C1M A;  2KS9 A;  4D4X A;  3QJT B;  4FBZ A;  3UTX A;  2YCY A;  3HNL A;  1KME A;  3OAX A;  4LDL A;  1E84 A;  5B6V A;  3EH5 B;  4QID A;  1C8R A;  5A45 A;  4WAV A;  1LM3 B;  2WJL A;  5ETZ A;  3NY9 A;  3U8P A;  3QBK A;  1PXR A;  4Y9H A;  256B A;  2YKZ A;  4G71 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...