2AQLA

Crystal structure of the mrg15 mrg domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
158
Chain Sequence
EVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Mortality factor 4-like protein 1
total genus 54
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2aqlA00
2F5JA 2AQLA 2LKMB 2N1DB 2Y0NA
chains in the Genus database with same CATH superfamily
3GTPA 1EZAA 2A68D 2A69D 3U44A 3GTOA 3LRDA 1Y1WA 3CQZA 4QIWA 2N3EA 2LKMB 1TWHA 4V2QA 2Y0NA 2YIIA 2LPJA 2MX9A 4C2MA 5IZ2A 4BAAA 2JA5A 2FIPA 4C5RA 2JA7A 4CEJA 4CEHA 2BE5D 2MQAA 1TWGA 2K3OA 1HQMD 2FIOA 1I3QA 2AQLA 3EZAA 2R92A 1T6PA 2EZCA 1Y1VA 4C6GA 3NZ4A 2LTHA 2VK9A 1SMYD 2K3QA 2X0PA 1ZYMA 3EZBA 3LR6A 1T6JA 2R7ZA 2HWGA 4C5SA 1SFOA 2N1DB 4C5UA 2MX8A 2O5JD 3GTGA 4BABA 2F5JA 3GTLA 2X0QA 2MP0A 1TWCA 1TWAA 3GTMA 1WCMA 4V2RA 1EZBA 1W27A 1K83A 1TWFA 2LPIA 2K3NA 3LR2A 3LR8A 2HROA 2VUMA 3EZEA 2JA6A 2LYIA 3GTJA 1Y2MA 3U4QA 2R93A 2EZBA 2CW0D 1ZYRD 2A6HD 2YU9A 1R9TA 1I50A 4FBSA 2EZAA 3GTQA 2NVXA 2X0OA 3H0GA 1YNJD 3GTKA 1I6VD 2E2IA 4CQ5A 4CEIA 2A6ED 3FKIA 2B63A 1IW7D 2NVYA 2E2HA 1YNND
chains in the Genus database with same CATH topology
3GTPA 2A68D 2A69D 3U44A 3GTOA 3LRDA 1Y1WA 3CQZA 4QIWA 2N3EA 2LKMB 1TWHA 2Y0NA 2LPJA 2JA5A 2MX9A 4C2MA 5IZ2A 2FIPA 2JA7A 4CEJA 4CEHA 2BE5D 2MQAA 1TWGA 2K3OA 1HQMD 2FIOA 1I3QA 2AQLA 2R92A 1Y1VA 2LTHA 2VK9A 1SMYD 2K3QA 2X0PA 3LR6A 2R7ZA 1SFOA 2N1DB 2O5JD 2MX8A 3GTGA 2F5JA 3GTLA 2X0QA 1TWCA 1TWAA 3GTMA 1WCMA 1K83A 1TWFA 2LPIA 2K3NA 3LR2A 3LR8A 2VUMA 2JA6A 2LYIA 3GTJA 3U4QA 2R93A 2CW0D 1ZYRD 2A6HD 2YU9A 1R9TA 1I50A 4FBSA 3GTQA 2NVXA 2X0OA 3H0GA 1YNJD 3GTKA 1I6VD 2E2IA 4CEIA 2A6ED 3FKIA 2B63A 1IW7D 2NVYA 2E2HA 1YNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5J A;  2AQL A;  2LKM B;  2N1D B;  2Y0N A; 
#chains in the Genus database with same CATH topology
 3GTP A;  1EZA A;  2A68 D;  2A69 D;  3U44 A;  3GTO A;  3LRD A;  1Y1W A;  3CQZ A;  4QIW A;  2N3E A;  2LKM B;  1TWH A;  4V2Q A;  2Y0N A;  2YII A;  2LPJ A;  2MX9 A;  4C2M A;  5IZ2 A;  4BAA A;  2JA5 A;  2FIP A;  4C5R A;  2JA7 A;  4CEJ A;  4CEH A;  2BE5 D;  2MQA A;  1TWG A;  2K3O A;  1HQM D;  2FIO A;  1I3Q A;  2AQL A;  3EZA A;  2R92 A;  1T6P A;  2EZC A;  1Y1V A;  4C6G A;  3NZ4 A;  2LTH A;  2VK9 A;  1SMY D;  2K3Q A;  2X0P A;  1ZYM A;  3EZB A;  3LR6 A;  1T6J A;  2R7Z A;  2HWG A;  4C5S A;  1SFO A;  2N1D B;  4C5U A;  2MX8 A;  2O5J D;  3GTG A;  4BAB A;  2F5J A;  3GTL A;  2X0Q A;  2MP0 A;  1TWC A;  1TWA A;  3GTM A;  1WCM A;  4V2R A;  1EZB A;  1W27 A;  1K83 A;  1TWF A;  2LPI A;  2K3N A;  3LR2 A;  3LR8 A;  2HRO A;  2VUM A;  3EZE A;  2JA6 A;  2LYI A;  3GTJ A;  1Y2M A;  3U4Q A;  2R93 A;  2EZB A;  2CW0 D;  1ZYR D;  2A6H D;  2YU9 A;  1R9T A;  1I50 A;  4FBS A;  2EZA A;  3GTQ A;  2NVX A;  2X0O A;  3H0G A;  1YNJ D;  3GTK A;  1I6V D;  2E2I A;  4CQ5 A;  4CEI A;  2A6E D;  3FKI A;  2B63 A;  1IW7 D;  2NVY A;  2E2H A;  1YNN D; 
#chains in the Genus database with same CATH homology
 3GTP A;  2A68 D;  2A69 D;  3U44 A;  3GTO A;  3LRD A;  1Y1W A;  3CQZ A;  4QIW A;  2N3E A;  2LKM B;  1TWH A;  2Y0N A;  2LPJ A;  2JA5 A;  2MX9 A;  4C2M A;  5IZ2 A;  2FIP A;  2JA7 A;  4CEJ A;  4CEH A;  2BE5 D;  2MQA A;  1TWG A;  2K3O A;  1HQM D;  2FIO A;  1I3Q A;  2AQL A;  2R92 A;  1Y1V A;  2LTH A;  2VK9 A;  1SMY D;  2K3Q A;  2X0P A;  3LR6 A;  2R7Z A;  1SFO A;  2N1D B;  2O5J D;  2MX8 A;  3GTG A;  2F5J A;  3GTL A;  2X0Q A;  1TWC A;  1TWA A;  3GTM A;  1WCM A;  1K83 A;  1TWF A;  2LPI A;  2K3N A;  3LR2 A;  3LR8 A;  2VUM A;  2JA6 A;  2LYI A;  3GTJ A;  3U4Q A;  2R93 A;  2CW0 D;  1ZYR D;  2A6H D;  2YU9 A;  1R9T A;  1I50 A;  4FBS A;  3GTQ A;  2NVX A;  2X0O A;  3H0G A;  1YNJ D;  3GTK A;  1I6V D;  2E2I A;  4CEI A;  2A6E D;  3FKI A;  2B63 A;  1IW7 D;  2NVY A;  2E2H A;  1YNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...