2AQLA

Crystal structure of the mrg15 mrg domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
158
Chain Sequence
EVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mortality factor 4-like protein 1
publication title Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 54
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2aqlA00
2LKMB 2F5JA 2N1DB 2Y0NA 2AQLA
chains in the Genus database with same CATH superfamily
2LPIA 1R9TA 2O5JD 2YIIA 2Y0NA 1ZYRD 3NZ4A 2LKMB 2F5JA 3EZBA 2JA7A 2N3EA 1I3QA 1YNJD 1IW7D 4C5SA 2A6ED 4C2MA 2K3OA 1TWHA 4FBSA 1TWAA 2MX9A 3H0GA 1TWCA 2LTHA 1WCMA 2MQAA 3U44A 3LR6A 1I6VD 3EZEA 3GTMA 1W27A 3GTJA 2NVXA 1SFOA 3U4QA 4BAAA 2E2HA 3LR8A 2JA6A 3GTLA 4C6GA 2R7ZA 1ZYMA 2JA5A 2MX8A 1Y1WA 4CEJA 2X0PA 3GTGA 2BE5D 2HWGA 3FKIA 2N1DB 4CEHA 2FIPA 2EZAA 4V2RA 2FIOA 2YU9A 1EZBA 1K83A 2R93A 5IZ2A 3LR2A 3GTQA 3EZAA 3GTOA 2A6HD 2LPJA 3GTKA 1I50A 3LRDA 1T6PA 2X0OA 4C5RA 3GTPA 2X0QA 4CQ5A 2EZCA 2CW0D 2MP0A 4QIWA 4V2QA 2K3QA 2EZBA 1Y2MA 3CQZA 2AQLA 1YNND 2R92A 1SMYD 4BABA 1HQMD 1T6JA 2LYIA 2HROA 2NVYA 1TWGA 1Y1VA 2VK9A 2E2IA 2VUMA 2K3NA 2A69D 4CEIA 2A68D 4C5UA 1EZAA 1TWFA 2B63A
chains in the Genus database with same CATH topology
2LPIA 1R9TA 2O5JD 2Y0NA 1ZYRD 2LKMB 2F5JA 2JA7A 2N3EA 1I3QA 1YNJD 1IW7D 2A6ED 4C2MA 2K3OA 1TWHA 4FBSA 1TWAA 2MX9A 3H0GA 1TWCA 2LTHA 1WCMA 2MQAA 3U44A 3LR6A 1I6VD 3GTMA 3GTJA 2NVXA 1SFOA 3U4QA 2E2HA 3LR8A 2JA6A 3GTLA 2R7ZA 2JA5A 2MX8A 1Y1WA 4CEJA 2X0PA 3GTGA 2BE5D 3FKIA 2N1DB 4CEHA 2FIPA 2FIOA 2YU9A 1K83A 2R93A 5IZ2A 3LR2A 3GTQA 3GTOA 2A6HD 2LPJA 3GTKA 1I50A 3LRDA 2X0OA 3GTPA 2X0QA 2CW0D 4QIWA 2K3QA 3CQZA 2AQLA 1YNND 2R92A 1SMYD 1HQMD 2LYIA 2NVYA 1TWGA 1Y1VA 2VK9A 2E2IA 2VUMA 2K3NA 2A69D 4CEIA 2A68D 1TWFA 2B63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKM B;  2F5J A;  2N1D B;  2Y0N A;  2AQL A; 
#chains in the Genus database with same CATH topology
 2LPI A;  1R9T A;  2O5J D;  2YII A;  2Y0N A;  1ZYR D;  3NZ4 A;  2LKM B;  2F5J A;  3EZB A;  2JA7 A;  2N3E A;  1I3Q A;  1YNJ D;  1IW7 D;  4C5S A;  2A6E D;  4C2M A;  2K3O A;  1TWH A;  4FBS A;  1TWA A;  2MX9 A;  3H0G A;  1TWC A;  2LTH A;  1WCM A;  2MQA A;  3U44 A;  3LR6 A;  1I6V D;  3EZE A;  3GTM A;  1W27 A;  3GTJ A;  2NVX A;  1SFO A;  3U4Q A;  4BAA A;  2E2H A;  3LR8 A;  2JA6 A;  3GTL A;  4C6G A;  2R7Z A;  1ZYM A;  2JA5 A;  2MX8 A;  1Y1W A;  4CEJ A;  2X0P A;  3GTG A;  2BE5 D;  2HWG A;  3FKI A;  2N1D B;  4CEH A;  2FIP A;  2EZA A;  4V2R A;  2FIO A;  2YU9 A;  1EZB A;  1K83 A;  2R93 A;  5IZ2 A;  3LR2 A;  3GTQ A;  3EZA A;  3GTO A;  2A6H D;  2LPJ A;  3GTK A;  1I50 A;  3LRD A;  1T6P A;  2X0O A;  4C5R A;  3GTP A;  2X0Q A;  4CQ5 A;  2EZC A;  2CW0 D;  2MP0 A;  4QIW A;  4V2Q A;  2K3Q A;  2EZB A;  1Y2M A;  3CQZ A;  2AQL A;  1YNN D;  2R92 A;  1SMY D;  4BAB A;  1HQM D;  1T6J A;  2LYI A;  2HRO A;  2NVY A;  1TWG A;  1Y1V A;  2VK9 A;  2E2I A;  2VUM A;  2K3N A;  2A69 D;  4CEI A;  2A68 D;  4C5U A;  1EZA A;  1TWF A;  2B63 A; 
#chains in the Genus database with same CATH homology
 2LPI A;  1R9T A;  2O5J D;  2Y0N A;  1ZYR D;  2LKM B;  2F5J A;  2JA7 A;  2N3E A;  1I3Q A;  1YNJ D;  1IW7 D;  2A6E D;  4C2M A;  2K3O A;  1TWH A;  4FBS A;  1TWA A;  2MX9 A;  3H0G A;  1TWC A;  2LTH A;  1WCM A;  2MQA A;  3U44 A;  3LR6 A;  1I6V D;  3GTM A;  3GTJ A;  2NVX A;  1SFO A;  3U4Q A;  2E2H A;  3LR8 A;  2JA6 A;  3GTL A;  2R7Z A;  2JA5 A;  2MX8 A;  1Y1W A;  4CEJ A;  2X0P A;  3GTG A;  2BE5 D;  3FKI A;  2N1D B;  4CEH A;  2FIP A;  2FIO A;  2YU9 A;  1K83 A;  2R93 A;  5IZ2 A;  3LR2 A;  3GTQ A;  3GTO A;  2A6H D;  2LPJ A;  3GTK A;  1I50 A;  3LRD A;  2X0O A;  3GTP A;  2X0Q A;  2CW0 D;  4QIW A;  2K3Q A;  3CQZ A;  2AQL A;  1YNN D;  2R92 A;  1SMY D;  1HQM D;  2LYI A;  2NVY A;  1TWG A;  1Y1V A;  2VK9 A;  2E2I A;  2VUM A;  2K3N A;  2A69 D;  4CEI A;  2A68 D;  1TWF A;  2B63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...