2AQLA

Crystal structure of the mrg15 mrg domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
158
Chain Sequence
b'EVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mortality factor 4-like protein 1
molecule tags Dna binding protein
source organism Homo sapiens
publication title Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain.
pubmed doi rcsb
total genus 54
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2aqlA00
2AQLA 2LKMB 2F5JA 2Y0NA 2N1DB
chains in the Genus database with same CATH superfamily
1T6JA 2LKMB 1Y1WA 1Y1VA 2AQLA 1IW7D 2EZCA 3EZBA 2Y0NA 2O5JD 1ZYMA 1I3QA 3FKIA 3EZEA 2FIOA 2X0QA 3GTLA 2LYIA 4CQ5A 3LRDA 2K3QA 2VK9A 2A69D 4V2QA 2YU9A 3GTGA 2N1DB 2NVXA 2A6ED 4CEIA 1SMYD 1TWGA 2EZAA 1R9TA 2A6HD 2B63A 4BAAA 2R7ZA 4C5RA 5IZ2A 3U44A 3GTMA 4V2RA 1I6VD 2X0PA 3LR6A 2E2IA 2VUMA 1SFOA 2JA5A 1T6PA 3U4QA 4BABA 2HWGA 2CW0D 2BE5D 4C5UA 4C5SA 2MP0A 4CEJA 3GTKA 2FIPA 1K83A 2YIIA 3CQZA 1W27A 1YNND 2N3EA 1EZBA 2LPJA 4CEHA 2LPIA 2K3OA 2NVYA 2JA6A 4QIWA 1TWHA 2E2HA 1YNJD 2EZBA 1Y2MA 2HROA 3LR2A 1EZAA 2MX9A 2JA7A 1HQMD 4C2MA 3GTOA 2MX8A 4FBSA 3EZAA 3NZ4A 3GTJA 1I50A 3GTPA 2X0OA 2MQAA 1ZYRD 2R92A 4C6GA 1TWCA 2F5JA 3LR8A 1WCMA 1TWFA 3GTQA 1TWAA 2R93A 2A68D 3H0GA 2LTHA 2K3NA
chains in the Genus database with same CATH topology
2LKMB 1Y1WA 1Y1VA 2AQLA 1IW7D 2Y0NA 2O5JD 1I3QA 3FKIA 2FIOA 2X0QA 3GTLA 2LYIA 3LRDA 2K3QA 2VK9A 2A69D 2YU9A 3GTGA 2N1DB 2NVXA 2A6ED 4CEIA 1SMYD 1TWGA 1R9TA 2A6HD 2B63A 2R7ZA 5IZ2A 3U44A 3GTMA 1I6VD 2X0PA 3LR6A 2E2IA 2VUMA 1SFOA 2JA5A 3U4QA 2CW0D 2BE5D 4CEJA 3GTKA 2FIPA 1K83A 3CQZA 1YNND 2N3EA 2LPJA 4CEHA 2LPIA 2K3OA 2NVYA 2JA6A 4QIWA 1TWHA 2E2HA 1YNJD 3LR2A 2MX9A 2JA7A 1HQMD 4C2MA 3GTOA 2MX8A 4FBSA 3GTJA 1I50A 3GTPA 2X0OA 2MQAA 1ZYRD 2R92A 1TWCA 2F5JA 3LR8A 1WCMA 3GTQA 2R93A 1TWFA 1TWAA 2A68D 3H0GA 2LTHA 2K3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQL A;  2LKM B;  2F5J A;  2Y0N A;  2N1D B; 
#chains in the Genus database with same CATH topology
 1T6J A;  2LKM B;  1Y1W A;  1Y1V A;  2AQL A;  1IW7 D;  2EZC A;  3EZB A;  2Y0N A;  2O5J D;  1ZYM A;  1I3Q A;  3FKI A;  3EZE A;  2FIO A;  2X0Q A;  3GTL A;  2LYI A;  4CQ5 A;  3LRD A;  2K3Q A;  2VK9 A;  2A69 D;  4V2Q A;  2YU9 A;  3GTG A;  2N1D B;  2NVX A;  2A6E D;  4CEI A;  1SMY D;  1TWG A;  2EZA A;  1R9T A;  2A6H D;  2B63 A;  4BAA A;  2R7Z A;  4C5R A;  5IZ2 A;  3U44 A;  3GTM A;  4V2R A;  1I6V D;  2X0P A;  3LR6 A;  2E2I A;  2VUM A;  1SFO A;  2JA5 A;  1T6P A;  3U4Q A;  4BAB A;  2HWG A;  2CW0 D;  2BE5 D;  4C5U A;  4C5S A;  2MP0 A;  4CEJ A;  3GTK A;  2FIP A;  1K83 A;  2YII A;  3CQZ A;  1W27 A;  1YNN D;  2N3E A;  1EZB A;  2LPJ A;  4CEH A;  2LPI A;  2K3O A;  2NVY A;  2JA6 A;  4QIW A;  1TWH A;  2E2H A;  1YNJ D;  2EZB A;  1Y2M A;  2HRO A;  3LR2 A;  1EZA A;  2MX9 A;  2JA7 A;  1HQM D;  4C2M A;  3GTO A;  2MX8 A;  4FBS A;  3EZA A;  3NZ4 A;  3GTJ A;  1I50 A;  3GTP A;  2X0O A;  2MQA A;  1ZYR D;  2R92 A;  4C6G A;  1TWC A;  2F5J A;  3LR8 A;  1WCM A;  1TWF A;  3GTQ A;  1TWA A;  2R93 A;  2A68 D;  3H0G A;  2LTH A;  2K3N A; 
#chains in the Genus database with same CATH homology
 2LKM B;  1Y1W A;  1Y1V A;  2AQL A;  1IW7 D;  2Y0N A;  2O5J D;  1I3Q A;  3FKI A;  2FIO A;  2X0Q A;  3GTL A;  2LYI A;  3LRD A;  2K3Q A;  2VK9 A;  2A69 D;  2YU9 A;  3GTG A;  2N1D B;  2NVX A;  2A6E D;  4CEI A;  1SMY D;  1TWG A;  1R9T A;  2A6H D;  2B63 A;  2R7Z A;  5IZ2 A;  3U44 A;  3GTM A;  1I6V D;  2X0P A;  3LR6 A;  2E2I A;  2VUM A;  1SFO A;  2JA5 A;  3U4Q A;  2CW0 D;  2BE5 D;  4CEJ A;  3GTK A;  2FIP A;  1K83 A;  3CQZ A;  1YNN D;  2N3E A;  2LPJ A;  4CEH A;  2LPI A;  2K3O A;  2NVY A;  2JA6 A;  4QIW A;  1TWH A;  2E2H A;  1YNJ D;  3LR2 A;  2MX9 A;  2JA7 A;  1HQM D;  4C2M A;  3GTO A;  2MX8 A;  4FBS A;  3GTJ A;  1I50 A;  3GTP A;  2X0O A;  2MQA A;  1ZYR D;  2R92 A;  1TWC A;  2F5J A;  3LR8 A;  1WCM A;  3GTQ A;  2R93 A;  1TWF A;  1TWA A;  2A68 D;  3H0G A;  2LTH A;  2K3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...