2AQLA

Crystal structure of the mrg15 mrg domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
158
Chain Sequence
EVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mortality factor 4-like protein 1
publication title Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 54
structure length 158
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2aqlA00
2F5JA 2LKMB 2N1DB 2AQLA 2Y0NA
chains in the Genus database with same CATH superfamily
2LTHA 1TWFA 3GTKA 2YU9A 1HQMD 4CEJA 1W27A 4BABA 1Y1WA 3LRDA 2K3QA 2EZCA 2A6ED 3CQZA 2FIPA 1EZAA 2EZAA 5IZ2A 1T6JA 4V2QA 2NVYA 1TWGA 1K83A 2MP0A 2BE5D 3GTMA 3EZEA 1ZYMA 4QIWA 2A6HD 3LR6A 2JA6A 2LYIA 3FKIA 2EZBA 2HROA 2MQAA 3GTOA 2X0PA 3U44A 2VUMA 2R93A 3H0GA 1R9TA 4C5SA 1TWHA 4C2MA 1WCMA 4CEIA 2K3NA 2A69D 2F5JA 2LPJA 3EZBA 2CW0D 1I3QA 4V2RA 1I50A 2R7ZA 2HWGA 1SMYD 1Y2MA 2X0OA 2X0QA 2Y0NA 2FIOA 2NVXA 3GTLA 4FBSA 4CEHA 3NZ4A 3GTGA 2MX9A 2JA5A 1EZBA 1T6PA 3LR8A 3EZAA 2JA7A 3GTJA 3LR2A 1SFOA 4CQ5A 1TWAA 2B63A 1YNJD 2K3OA 2YIIA 1Y1VA 2A68D 1ZYRD 3U4QA 1TWCA 2E2IA 2MX8A 1I6VD 1YNND 3GTQA 2R92A 2AQLA 2LPIA 4C5UA 2VK9A 3GTPA 2O5JD 4C6GA 4BAAA 1IW7D 2N1DB 4C5RA 2E2HA 2N3EA 2LKMB
chains in the Genus database with same CATH topology
2LTHA 1TWFA 3GTKA 2YU9A 1HQMD 4CEJA 1Y1WA 3LRDA 2K3QA 2A6ED 3CQZA 2FIPA 5IZ2A 2NVYA 1TWGA 1K83A 2BE5D 3GTMA 4QIWA 2A6HD 3LR6A 2JA6A 2LYIA 3FKIA 2MQAA 3GTOA 2X0PA 3U44A 2VUMA 2R93A 3H0GA 1R9TA 1TWHA 4C2MA 1WCMA 4CEIA 2K3NA 2A69D 2F5JA 2LPJA 2CW0D 1I3QA 1I50A 2R7ZA 1SMYD 2X0OA 2X0QA 2Y0NA 2FIOA 2NVXA 3GTLA 4FBSA 4CEHA 3GTGA 2MX9A 2JA5A 3LR8A 2JA7A 3GTJA 3LR2A 1SFOA 1TWAA 2B63A 1YNJD 2K3OA 1Y1VA 2A68D 1ZYRD 3U4QA 1TWCA 2E2IA 2MX8A 1I6VD 1YNND 3GTQA 2R92A 2AQLA 2LPIA 2VK9A 3GTPA 2O5JD 1IW7D 2N1DB 2E2HA 2N3EA 2LKMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5J A;  2LKM B;  2N1D B;  2AQL A;  2Y0N A; 
#chains in the Genus database with same CATH topology
 2LTH A;  1TWF A;  3GTK A;  2YU9 A;  1HQM D;  4CEJ A;  1W27 A;  4BAB A;  1Y1W A;  3LRD A;  2K3Q A;  2EZC A;  2A6E D;  3CQZ A;  2FIP A;  1EZA A;  2EZA A;  5IZ2 A;  1T6J A;  4V2Q A;  2NVY A;  1TWG A;  1K83 A;  2MP0 A;  2BE5 D;  3GTM A;  3EZE A;  1ZYM A;  4QIW A;  2A6H D;  3LR6 A;  2JA6 A;  2LYI A;  3FKI A;  2EZB A;  2HRO A;  2MQA A;  3GTO A;  2X0P A;  3U44 A;  2VUM A;  2R93 A;  3H0G A;  1R9T A;  4C5S A;  1TWH A;  4C2M A;  1WCM A;  4CEI A;  2K3N A;  2A69 D;  2F5J A;  2LPJ A;  3EZB A;  2CW0 D;  1I3Q A;  4V2R A;  1I50 A;  2R7Z A;  2HWG A;  1SMY D;  1Y2M A;  2X0O A;  2X0Q A;  2Y0N A;  2FIO A;  2NVX A;  3GTL A;  4FBS A;  4CEH A;  3NZ4 A;  3GTG A;  2MX9 A;  2JA5 A;  1EZB A;  1T6P A;  3LR8 A;  3EZA A;  2JA7 A;  3GTJ A;  3LR2 A;  1SFO A;  4CQ5 A;  1TWA A;  2B63 A;  1YNJ D;  2K3O A;  2YII A;  1Y1V A;  2A68 D;  1ZYR D;  3U4Q A;  1TWC A;  2E2I A;  2MX8 A;  1I6V D;  1YNN D;  3GTQ A;  2R92 A;  2AQL A;  2LPI A;  4C5U A;  2VK9 A;  3GTP A;  2O5J D;  4C6G A;  4BAA A;  1IW7 D;  2N1D B;  4C5R A;  2E2H A;  2N3E A;  2LKM B; 
#chains in the Genus database with same CATH homology
 2LTH A;  1TWF A;  3GTK A;  2YU9 A;  1HQM D;  4CEJ A;  1Y1W A;  3LRD A;  2K3Q A;  2A6E D;  3CQZ A;  2FIP A;  5IZ2 A;  2NVY A;  1TWG A;  1K83 A;  2BE5 D;  3GTM A;  4QIW A;  2A6H D;  3LR6 A;  2JA6 A;  2LYI A;  3FKI A;  2MQA A;  3GTO A;  2X0P A;  3U44 A;  2VUM A;  2R93 A;  3H0G A;  1R9T A;  1TWH A;  4C2M A;  1WCM A;  4CEI A;  2K3N A;  2A69 D;  2F5J A;  2LPJ A;  2CW0 D;  1I3Q A;  1I50 A;  2R7Z A;  1SMY D;  2X0O A;  2X0Q A;  2Y0N A;  2FIO A;  2NVX A;  3GTL A;  4FBS A;  4CEH A;  3GTG A;  2MX9 A;  2JA5 A;  3LR8 A;  2JA7 A;  3GTJ A;  3LR2 A;  1SFO A;  1TWA A;  2B63 A;  1YNJ D;  2K3O A;  1Y1V A;  2A68 D;  1ZYR D;  3U4Q A;  1TWC A;  2E2I A;  2MX8 A;  1I6V D;  1YNN D;  3GTQ A;  2R92 A;  2AQL A;  2LPI A;  2VK9 A;  3GTP A;  2O5J D;  1IW7 D;  2N1D B;  2E2H A;  2N3E A;  2LKM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...