4FBSA

Structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
124
structure length
120
Chain Sequence
TTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEIAASGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 53
structure length 120
sequence length 124
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 4fbsA01
3LR8A 2LPJA 2LPIA 3LRDA 2LTHA 3LR6A 3LR2A 4FBSA 2K3QA 5IZ2A 2MX9A 2MX8A 2N3EA
chains in the Genus database with same CATH superfamily
1W27A 1TWCA 2MQAA 2FIOA 3EZAA 3EZBA 2E2IA 2K3QA 3CQZA 2X0PA 2NVYA 3LR8A 1I50A 2A69D 3LRDA 4C5SA 2HROA 2EZBA 1TWHA 1TWAA 2K3OA 1I6VD 2K3NA 1ZYMA 3LR6A 2A6ED 2MX8A 1EZBA 2LPIA 1YNJD 2JA5A 4CEJA 2NVXA 3H0GA 1WCMA 2EZCA 2LYIA 2MP0A 2VK9A 5IZ2A 2HWGA 2N1DB 2JA7A 3GTQA 2CW0D 4C5UA 2JA6A 1I3QA 4V2QA 2LKMB 1TWFA 2B63A 3FKIA 3GTJA 1YNND 2X0QA 4CEIA 4BABA 1Y2MA 4FBSA 4BAAA 2O5JD 2X0OA 2E2HA 4CQ5A 3GTGA 3GTKA 2YIIA 3U4QA 1EZAA 4CEHA 1HQMD 4QIWA 3EZEA 3GTLA 3GTOA 1Y1VA 2EZAA 4V2RA 2R7ZA 2MX9A 2YU9A 3U44A 2A68D 1ZYRD 1SFOA 2FIPA 1Y1WA 1T6PA 4C5RA 2BE5D 2LPJA 2LTHA 1K83A 2N3EA 3GTMA 2R92A 3NZ4A 2R93A 1TWGA 1SMYD 3LR2A 2A6HD 1R9TA 2VUMA 2AQLA 4C2MA 1IW7D 3GTPA 4C6GA 2F5JA 1T6JA 2Y0NA
chains in the Genus database with same CATH topology
2MQAA 1TWCA 2FIOA 2E2IA 2K3QA 3CQZA 2X0PA 2NVYA 3LR8A 1I50A 2A69D 3LRDA 1TWHA 1TWAA 2K3OA 1I6VD 2K3NA 3LR6A 2A6ED 2MX8A 2LPIA 1YNJD 2JA5A 4CEJA 2NVXA 3H0GA 1WCMA 2LYIA 2VK9A 5IZ2A 2N1DB 2JA7A 3GTQA 2CW0D 2JA6A 1I3QA 2LKMB 1TWFA 2B63A 3FKIA 3GTJA 1YNND 2X0QA 4CEIA 4FBSA 2O5JD 2X0OA 2E2HA 3GTGA 3GTKA 3U4QA 4CEHA 1HQMD 4QIWA 3GTLA 3GTOA 1Y1VA 2R7ZA 2MX9A 2YU9A 3U44A 2A68D 1ZYRD 1SFOA 2FIPA 1Y1WA 2BE5D 2LPJA 2LTHA 1K83A 2N3EA 3GTMA 2R92A 2R93A 1TWGA 1SMYD 3LR2A 2A6HD 1R9TA 2VUMA 2AQLA 4C2MA 1IW7D 3GTPA 2F5JA 2Y0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR8 A;  2LPJ A;  2LPI A;  3LRD A;  2LTH A;  3LR6 A;  3LR2 A;  4FBS A;  2K3Q A;  5IZ2 A;  2MX9 A;  2MX8 A;  2N3E A; 
#chains in the Genus database with same CATH topology
 1W27 A;  1TWC A;  2MQA A;  2FIO A;  3EZA A;  3EZB A;  2E2I A;  2K3Q A;  3CQZ A;  2X0P A;  2NVY A;  3LR8 A;  1I50 A;  2A69 D;  3LRD A;  4C5S A;  2HRO A;  2EZB A;  1TWH A;  1TWA A;  2K3O A;  1I6V D;  2K3N A;  1ZYM A;  3LR6 A;  2A6E D;  2MX8 A;  1EZB A;  2LPI A;  1YNJ D;  2JA5 A;  4CEJ A;  2NVX A;  3H0G A;  1WCM A;  2EZC A;  2LYI A;  2MP0 A;  2VK9 A;  5IZ2 A;  2HWG A;  2N1D B;  2JA7 A;  3GTQ A;  2CW0 D;  4C5U A;  2JA6 A;  1I3Q A;  4V2Q A;  2LKM B;  1TWF A;  2B63 A;  3FKI A;  3GTJ A;  1YNN D;  2X0Q A;  4CEI A;  4BAB A;  1Y2M A;  4FBS A;  4BAA A;  2O5J D;  2X0O A;  2E2H A;  4CQ5 A;  3GTG A;  3GTK A;  2YII A;  3U4Q A;  1EZA A;  4CEH A;  1HQM D;  4QIW A;  3EZE A;  3GTL A;  3GTO A;  1Y1V A;  2EZA A;  4V2R A;  2R7Z A;  2MX9 A;  2YU9 A;  3U44 A;  2A68 D;  1ZYR D;  1SFO A;  2FIP A;  1Y1W A;  1T6P A;  4C5R A;  2BE5 D;  2LPJ A;  2LTH A;  1K83 A;  2N3E A;  3GTM A;  2R92 A;  3NZ4 A;  2R93 A;  1TWG A;  1SMY D;  3LR2 A;  2A6H D;  1R9T A;  2VUM A;  2AQL A;  4C2M A;  1IW7 D;  3GTP A;  4C6G A;  2F5J A;  1T6J A;  2Y0N A; 
#chains in the Genus database with same CATH homology
 2MQA A;  1TWC A;  2FIO A;  2E2I A;  2K3Q A;  3CQZ A;  2X0P A;  2NVY A;  3LR8 A;  1I50 A;  2A69 D;  3LRD A;  1TWH A;  1TWA A;  2K3O A;  1I6V D;  2K3N A;  3LR6 A;  2A6E D;  2MX8 A;  2LPI A;  1YNJ D;  2JA5 A;  4CEJ A;  2NVX A;  3H0G A;  1WCM A;  2LYI A;  2VK9 A;  5IZ2 A;  2N1D B;  2JA7 A;  3GTQ A;  2CW0 D;  2JA6 A;  1I3Q A;  2LKM B;  1TWF A;  2B63 A;  3FKI A;  3GTJ A;  1YNN D;  2X0Q A;  4CEI A;  4FBS A;  2O5J D;  2X0O A;  2E2H A;  3GTG A;  3GTK A;  3U4Q A;  4CEH A;  1HQM D;  4QIW A;  3GTL A;  3GTO A;  1Y1V A;  2R7Z A;  2MX9 A;  2YU9 A;  3U44 A;  2A68 D;  1ZYR D;  1SFO A;  2FIP A;  1Y1W A;  2BE5 D;  2LPJ A;  2LTH A;  1K83 A;  2N3E A;  3GTM A;  2R92 A;  2R93 A;  1TWG A;  1SMY D;  3LR2 A;  2A6H D;  1R9T A;  2VUM A;  2AQL A;  4C2M A;  1IW7 D;  3GTP A;  2F5J A;  2Y0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...