4FBSA

Structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
124
structure length
120
Chain Sequence
TTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEIAASGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain
pubmed doi rcsb
source organism Euprosthenops australis
total genus 53
structure length 120
sequence length 124
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 4fbsA01
2N3EA 2K3QA 2LPIA 2LPJA 3LR8A 3LR6A 2MX8A 3LRDA 3LR2A 4FBSA 5IZ2A 2LTHA 2MX9A
chains in the Genus database with same CATH superfamily
1I50A 3GTMA 2EZCA 2AQLA 2K3QA 4CEIA 4C6GA 2MQAA 1T6JA 2CW0D 3GTGA 2YIIA 2A68D 2FIPA 2MX9A 1ZYRD 2E2IA 2LKMB 2F5JA 2NVYA 4C5SA 1I6VD 3LR8A 1ZYMA 3EZBA 1SMYD 1R9TA 2JA7A 3U44A 2X0QA 2EZBA 2K3OA 2A6ED 1TWAA 2MP0A 2X0PA 1TWGA 2K3NA 2FIOA 2A69D 2LYIA 2R7ZA 4QIWA 2N3EA 1TWCA 2HWGA 3NZ4A 3FKIA 3GTPA 2HROA 2VUMA 2R92A 1T6PA 2NVXA 4C5RA 4C2MA 3EZAA 1K83A 2A6HD 4CEJA 3GTOA 2N1DB 4BAAA 1I3QA 1SFOA 2LPIA 3EZEA 3GTKA 3LRDA 2O5JD 2EZAA 2VK9A 4BABA 3CQZA 1Y2MA 4V2QA 2Y0NA 1TWFA 1YNND 2BE5D 3GTLA 3GTQA 2JA5A 4V2RA 3H0GA 1EZAA 2LPJA 4FBSA 1YNJD 1WCMA 2E2HA 1HQMD 3GTJA 2YU9A 1TWHA 3LR2A 1W27A 1Y1WA 1Y1VA 4C5UA 3U4QA 4CQ5A 1EZBA 2JA6A 2LTHA 3LR6A 2MX8A 4CEHA 2B63A 1IW7D 5IZ2A 2R93A 2X0OA
chains in the Genus database with same CATH topology
1I50A 3GTMA 2AQLA 2K3QA 4CEIA 2MQAA 2CW0D 3GTGA 2A68D 2FIPA 2MX9A 1ZYRD 2E2IA 2LKMB 2F5JA 2NVYA 1I6VD 3LR8A 1SMYD 1R9TA 2JA7A 3U44A 2X0QA 2K3OA 2A6ED 1TWAA 2X0PA 1TWGA 2K3NA 2FIOA 2A69D 2LYIA 2R7ZA 4QIWA 2N3EA 1TWCA 3FKIA 3GTPA 2VUMA 2R92A 2NVXA 4C2MA 3GTOA 1K83A 2A6HD 4CEJA 2N1DB 1I3QA 1SFOA 2LPIA 3GTKA 3LRDA 2O5JD 2VK9A 3CQZA 2Y0NA 1TWFA 1YNND 2BE5D 3GTLA 3GTQA 2JA5A 3H0GA 2LPJA 4FBSA 1YNJD 1WCMA 2E2HA 1HQMD 3GTJA 2YU9A 1TWHA 3LR2A 1Y1WA 1Y1VA 3U4QA 2JA6A 2LTHA 3LR6A 2MX8A 4CEHA 2B63A 1IW7D 5IZ2A 2R93A 2X0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3E A;  2K3Q A;  2LPI A;  2LPJ A;  3LR8 A;  3LR6 A;  2MX8 A;  3LRD A;  3LR2 A;  4FBS A;  5IZ2 A;  2LTH A;  2MX9 A; 
#chains in the Genus database with same CATH topology
 1I50 A;  3GTM A;  2EZC A;  2AQL A;  2K3Q A;  4CEI A;  4C6G A;  2MQA A;  1T6J A;  2CW0 D;  3GTG A;  2YII A;  2A68 D;  2FIP A;  2MX9 A;  1ZYR D;  2E2I A;  2LKM B;  2F5J A;  2NVY A;  4C5S A;  1I6V D;  3LR8 A;  1ZYM A;  3EZB A;  1SMY D;  1R9T A;  2JA7 A;  3U44 A;  2X0Q A;  2EZB A;  2K3O A;  2A6E D;  1TWA A;  2MP0 A;  2X0P A;  1TWG A;  2K3N A;  2FIO A;  2A69 D;  2LYI A;  2R7Z A;  4QIW A;  2N3E A;  1TWC A;  2HWG A;  3NZ4 A;  3FKI A;  3GTP A;  2HRO A;  2VUM A;  2R92 A;  1T6P A;  2NVX A;  4C5R A;  4C2M A;  3EZA A;  1K83 A;  2A6H D;  4CEJ A;  3GTO A;  2N1D B;  4BAA A;  1I3Q A;  1SFO A;  2LPI A;  3EZE A;  3GTK A;  3LRD A;  2O5J D;  2EZA A;  2VK9 A;  4BAB A;  3CQZ A;  1Y2M A;  4V2Q A;  2Y0N A;  1TWF A;  1YNN D;  2BE5 D;  3GTL A;  3GTQ A;  2JA5 A;  4V2R A;  3H0G A;  1EZA A;  2LPJ A;  4FBS A;  1YNJ D;  1WCM A;  2E2H A;  1HQM D;  3GTJ A;  2YU9 A;  1TWH A;  3LR2 A;  1W27 A;  1Y1W A;  1Y1V A;  4C5U A;  3U4Q A;  4CQ5 A;  1EZB A;  2JA6 A;  2LTH A;  3LR6 A;  2MX8 A;  4CEH A;  2B63 A;  1IW7 D;  5IZ2 A;  2R93 A;  2X0O A; 
#chains in the Genus database with same CATH homology
 1I50 A;  3GTM A;  2AQL A;  2K3Q A;  4CEI A;  2MQA A;  2CW0 D;  3GTG A;  2A68 D;  2FIP A;  2MX9 A;  1ZYR D;  2E2I A;  2LKM B;  2F5J A;  2NVY A;  1I6V D;  3LR8 A;  1SMY D;  1R9T A;  2JA7 A;  3U44 A;  2X0Q A;  2K3O A;  2A6E D;  1TWA A;  2X0P A;  1TWG A;  2K3N A;  2FIO A;  2A69 D;  2LYI A;  2R7Z A;  4QIW A;  2N3E A;  1TWC A;  3FKI A;  3GTP A;  2VUM A;  2R92 A;  2NVX A;  4C2M A;  3GTO A;  1K83 A;  2A6H D;  4CEJ A;  2N1D B;  1I3Q A;  1SFO A;  2LPI A;  3GTK A;  3LRD A;  2O5J D;  2VK9 A;  3CQZ A;  2Y0N A;  1TWF A;  1YNN D;  2BE5 D;  3GTL A;  3GTQ A;  2JA5 A;  3H0G A;  2LPJ A;  4FBS A;  1YNJ D;  1WCM A;  2E2H A;  1HQM D;  3GTJ A;  2YU9 A;  1TWH A;  3LR2 A;  1Y1W A;  1Y1V A;  3U4Q A;  2JA6 A;  2LTH A;  3LR6 A;  2MX8 A;  4CEH A;  2B63 A;  1IW7 D;  5IZ2 A;  2R93 A;  2X0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...