4FBSA

Structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
124
structure length
120
Chain Sequence
b'TTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEIAASGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 53
structure length 120
sequence length 124
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 4fbsA01
2K3QA 2LPJA 2LTHA 3LR8A 2N3EA 3LR2A 3LR6A 4FBSA 3LRDA 2MX9A 5IZ2A 2LPIA 2MX8A
chains in the Genus database with same CATH superfamily
2K3QA 2E2HA 4C5SA 4C2MA 1SMYD 2MX8A 4V2QA 3H0GA 2Y0NA 4C5UA 2MP0A 2A68D 2YIIA 2JA6A 1K83A 3GTKA 2N1DB 2JA5A 1HQMD 3CQZA 3EZBA 1EZBA 4V2RA 3FKIA 2E2IA 2K3OA 2EZAA 1I3QA 2X0QA 3LR8A 3GTLA 3GTGA 2MQAA 3GTPA 2F5JA 1EZAA 2BE5D 4C6GA 2X0PA 1SFOA 1IW7D 2VUMA 1ZYMA 1I6VD 2EZCA 2LYIA 2LPJA 1T6JA 2A6HD 2FIPA 1WCMA 4QIWA 1YNND 3LR6A 1R9TA 1TWGA 2VK9A 4C5RA 1T6PA 2NVXA 1W27A 2YU9A 1ZYRD 2HWGA 2A69D 5IZ2A 2LTHA 1Y1VA 3EZEA 3NZ4A 3GTJA 2R7ZA 2EZBA 2MX9A 4BABA 4CEHA 1Y2MA 3EZAA 2R92A 2LKMB 4FBSA 2CW0D 2B63A 4BAAA 2NVYA 2N3EA 1TWAA 3LRDA 1I50A 3GTQA 4CQ5A 1TWCA 1YNJD 2X0OA 2A6ED 3U44A 2AQLA 4CEIA 3GTMA 3LR2A 1TWHA 2FIOA 2R93A 2K3NA 2HROA 2O5JD 3U4QA 1TWFA 2LPIA 4CEJA 2JA7A 3GTOA 1Y1WA
chains in the Genus database with same CATH topology
2K3QA 2E2HA 4C2MA 1SMYD 2MX8A 3H0GA 2Y0NA 2A68D 2JA6A 1K83A 3GTKA 2N1DB 2JA5A 1HQMD 3CQZA 3FKIA 2E2IA 2K3OA 1I3QA 2X0QA 3LR8A 3GTLA 3GTGA 2MQAA 3GTPA 2F5JA 2BE5D 2X0PA 1SFOA 1IW7D 2VUMA 1I6VD 2LYIA 2LPJA 2A6HD 2FIPA 1WCMA 4QIWA 1YNND 3LR6A 1R9TA 1TWGA 2VK9A 2NVXA 2YU9A 1ZYRD 2A69D 5IZ2A 2LTHA 1Y1VA 3GTJA 2R7ZA 2MX9A 4CEHA 2R92A 2LKMB 4FBSA 2CW0D 2B63A 2NVYA 2N3EA 1TWAA 3LRDA 1I50A 3GTQA 1TWCA 1YNJD 2X0OA 2A6ED 3U44A 2AQLA 4CEIA 3GTMA 3LR2A 1TWHA 2FIOA 2R93A 2K3NA 2O5JD 3U4QA 1TWFA 2LPIA 4CEJA 2JA7A 3GTOA 1Y1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Q A;  2LPJ A;  2LTH A;  3LR8 A;  2N3E A;  3LR2 A;  3LR6 A;  4FBS A;  3LRD A;  2MX9 A;  5IZ2 A;  2LPI A;  2MX8 A; 
#chains in the Genus database with same CATH topology
 2K3Q A;  2E2H A;  4C5S A;  4C2M A;  1SMY D;  2MX8 A;  4V2Q A;  3H0G A;  2Y0N A;  4C5U A;  2MP0 A;  2A68 D;  2YII A;  2JA6 A;  1K83 A;  3GTK A;  2N1D B;  2JA5 A;  1HQM D;  3CQZ A;  3EZB A;  1EZB A;  4V2R A;  3FKI A;  2E2I A;  2K3O A;  2EZA A;  1I3Q A;  2X0Q A;  3LR8 A;  3GTL A;  3GTG A;  2MQA A;  3GTP A;  2F5J A;  1EZA A;  2BE5 D;  4C6G A;  2X0P A;  1SFO A;  1IW7 D;  2VUM A;  1ZYM A;  1I6V D;  2EZC A;  2LYI A;  2LPJ A;  1T6J A;  2A6H D;  2FIP A;  1WCM A;  4QIW A;  1YNN D;  3LR6 A;  1R9T A;  1TWG A;  2VK9 A;  4C5R A;  1T6P A;  2NVX A;  1W27 A;  2YU9 A;  1ZYR D;  2HWG A;  2A69 D;  5IZ2 A;  2LTH A;  1Y1V A;  3EZE A;  3NZ4 A;  3GTJ A;  2R7Z A;  2EZB A;  2MX9 A;  4BAB A;  4CEH A;  1Y2M A;  3EZA A;  2R92 A;  2LKM B;  4FBS A;  2CW0 D;  2B63 A;  4BAA A;  2NVY A;  2N3E A;  1TWA A;  3LRD A;  1I50 A;  3GTQ A;  4CQ5 A;  1TWC A;  1YNJ D;  2X0O A;  2A6E D;  3U44 A;  2AQL A;  4CEI A;  3GTM A;  3LR2 A;  1TWH A;  2FIO A;  2R93 A;  2K3N A;  2HRO A;  2O5J D;  3U4Q A;  1TWF A;  2LPI A;  4CEJ A;  2JA7 A;  3GTO A;  1Y1W A; 
#chains in the Genus database with same CATH homology
 2K3Q A;  2E2H A;  4C2M A;  1SMY D;  2MX8 A;  3H0G A;  2Y0N A;  2A68 D;  2JA6 A;  1K83 A;  3GTK A;  2N1D B;  2JA5 A;  1HQM D;  3CQZ A;  3FKI A;  2E2I A;  2K3O A;  1I3Q A;  2X0Q A;  3LR8 A;  3GTL A;  3GTG A;  2MQA A;  3GTP A;  2F5J A;  2BE5 D;  2X0P A;  1SFO A;  1IW7 D;  2VUM A;  1I6V D;  2LYI A;  2LPJ A;  2A6H D;  2FIP A;  1WCM A;  4QIW A;  1YNN D;  3LR6 A;  1R9T A;  1TWG A;  2VK9 A;  2NVX A;  2YU9 A;  1ZYR D;  2A69 D;  5IZ2 A;  2LTH A;  1Y1V A;  3GTJ A;  2R7Z A;  2MX9 A;  4CEH A;  2R92 A;  2LKM B;  4FBS A;  2CW0 D;  2B63 A;  2NVY A;  2N3E A;  1TWA A;  3LRD A;  1I50 A;  3GTQ A;  1TWC A;  1YNJ D;  2X0O A;  2A6E D;  3U44 A;  2AQL A;  4CEI A;  3GTM A;  3LR2 A;  1TWH A;  2FIO A;  2R93 A;  2K3N A;  2O5J D;  3U4Q A;  1TWF A;  2LPI A;  4CEJ A;  2JA7 A;  3GTO A;  1Y1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...