4FBSA

Structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
124
structure length
120
Chain Sequence
TTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEIAASGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
total genus 53
structure length 120
sequence length 124
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 4fbsA01
2LPJA 2K3QA 2N3EA 2LPIA 5IZ2A 2LTHA 3LR2A 3LR6A 3LRDA 4FBSA 2MX9A 2MX8A 3LR8A
chains in the Genus database with same CATH superfamily
2MQAA 1W27A 2EZAA 3LRDA 4FBSA 2E2IA 2X0PA 1YNND 1WCMA 2HWGA 3GTPA 3GTJA 2E2HA 2JA7A 4C5SA 4QIWA 1I6VD 2YIIA 2AQLA 3U4QA 1TWAA 2BE5D 3LR8A 1SFOA 2FIOA 3GTLA 4V2QA 2N1DB 1ZYMA 1TWGA 1T6PA 3EZAA 4BAAA 2LPIA 2LKMB 2LTHA 3LR6A 2MX9A 2MX8A 3GTMA 1Y2MA 1TWFA 1TWCA 1Y1VA 2LYIA 2A69D 4C2MA 1K83A 4CQ5A 3EZBA 1SMYD 1T6JA 2N3EA 3EZEA 2HROA 4C5RA 3U44A 2R93A 4CEIA 4C6GA 2MP0A 2Y0NA 3FKIA 2EZBA 1EZBA 2R92A 2O5JD 2NVXA 2X0QA 4C5UA 1I50A 2JA5A 1EZAA 3GTGA 2NVYA 2LPJA 1YNJD 1TWHA 2EZCA 2X0OA 2JA6A 3GTKA 2A68D 1Y1WA 2CW0D 5IZ2A 2F5JA 4CEJA 2K3OA 3GTQA 1I3QA 3CQZA 2K3QA 1HQMD 3NZ4A 1ZYRD 3LR2A 2FIPA 1R9TA 2R7ZA 4CEHA 4V2RA 1IW7D 2K3NA 2VUMA 2VK9A 2B63A 2A6ED 3GTOA 2A6HD 3H0GA 4BABA 2YU9A
chains in the Genus database with same CATH topology
2MQAA 3LRDA 4FBSA 2E2IA 2X0PA 1YNND 1WCMA 3GTPA 3GTJA 2E2HA 2JA7A 4QIWA 1I6VD 2AQLA 3U4QA 1TWAA 2BE5D 3LR8A 1SFOA 3GTLA 2N1DB 1TWGA 2LPIA 2LKMB 2LTHA 3LR6A 2MX9A 2MX8A 3GTMA 1TWFA 1TWCA 1Y1VA 2LYIA 2A69D 4C2MA 1K83A 1SMYD 2N3EA 3U44A 2R93A 4CEIA 2Y0NA 3FKIA 2R92A 2O5JD 2NVXA 2X0QA 1I50A 2JA5A 3GTGA 2NVYA 2LPJA 1YNJD 1TWHA 2X0OA 2JA6A 3GTKA 2A68D 1Y1WA 2CW0D 5IZ2A 2F5JA 4CEJA 2K3OA 3GTQA 1I3QA 3CQZA 2K3QA 1HQMD 1ZYRD 3LR2A 2FIPA 1R9TA 2R7ZA 4CEHA 1IW7D 2K3NA 2VUMA 2VK9A 2B63A 2A6ED 3GTOA 2A6HD 3H0GA 2FIOA 2YU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPJ A;  2K3Q A;  2N3E A;  2LPI A;  5IZ2 A;  2LTH A;  3LR2 A;  3LR6 A;  3LRD A;  4FBS A;  2MX9 A;  2MX8 A;  3LR8 A; 
#chains in the Genus database with same CATH topology
 2MQA A;  1W27 A;  2EZA A;  3LRD A;  4FBS A;  2E2I A;  2X0P A;  1YNN D;  1WCM A;  2HWG A;  3GTP A;  3GTJ A;  2E2H A;  2JA7 A;  4C5S A;  4QIW A;  1I6V D;  2YII A;  2AQL A;  3U4Q A;  1TWA A;  2BE5 D;  3LR8 A;  1SFO A;  2FIO A;  3GTL A;  4V2Q A;  2N1D B;  1ZYM A;  1TWG A;  1T6P A;  3EZA A;  4BAA A;  2LPI A;  2LKM B;  2LTH A;  3LR6 A;  2MX9 A;  2MX8 A;  3GTM A;  1Y2M A;  1TWF A;  1TWC A;  1Y1V A;  2LYI A;  2A69 D;  4C2M A;  1K83 A;  4CQ5 A;  3EZB A;  1SMY D;  1T6J A;  2N3E A;  3EZE A;  2HRO A;  4C5R A;  3U44 A;  2R93 A;  4CEI A;  4C6G A;  2MP0 A;  2Y0N A;  3FKI A;  2EZB A;  1EZB A;  2R92 A;  2O5J D;  2NVX A;  2X0Q A;  4C5U A;  1I50 A;  2JA5 A;  1EZA A;  3GTG A;  2NVY A;  2LPJ A;  1YNJ D;  1TWH A;  2EZC A;  2X0O A;  2JA6 A;  3GTK A;  2A68 D;  1Y1W A;  2CW0 D;  5IZ2 A;  2F5J A;  4CEJ A;  2K3O A;  3GTQ A;  1I3Q A;  3CQZ A;  2K3Q A;  1HQM D;  3NZ4 A;  1ZYR D;  3LR2 A;  2FIP A;  1R9T A;  2R7Z A;  4CEH A;  4V2R A;  1IW7 D;  2K3N A;  2VUM A;  2VK9 A;  2B63 A;  2A6E D;  3GTO A;  2A6H D;  3H0G A;  4BAB A;  2YU9 A; 
#chains in the Genus database with same CATH homology
 2MQA A;  3LRD A;  4FBS A;  2E2I A;  2X0P A;  1YNN D;  1WCM A;  3GTP A;  3GTJ A;  2E2H A;  2JA7 A;  4QIW A;  1I6V D;  2AQL A;  3U4Q A;  1TWA A;  2BE5 D;  3LR8 A;  1SFO A;  3GTL A;  2N1D B;  1TWG A;  2LPI A;  2LKM B;  2LTH A;  3LR6 A;  2MX9 A;  2MX8 A;  3GTM A;  1TWF A;  1TWC A;  1Y1V A;  2LYI A;  2A69 D;  4C2M A;  1K83 A;  1SMY D;  2N3E A;  3U44 A;  2R93 A;  4CEI A;  2Y0N A;  3FKI A;  2R92 A;  2O5J D;  2NVX A;  2X0Q A;  1I50 A;  2JA5 A;  3GTG A;  2NVY A;  2LPJ A;  1YNJ D;  1TWH A;  2X0O A;  2JA6 A;  3GTK A;  2A68 D;  1Y1W A;  2CW0 D;  5IZ2 A;  2F5J A;  4CEJ A;  2K3O A;  3GTQ A;  1I3Q A;  3CQZ A;  2K3Q A;  1HQM D;  1ZYR D;  3LR2 A;  2FIP A;  1R9T A;  2R7Z A;  4CEH A;  1IW7 D;  2K3N A;  2VUM A;  2VK9 A;  2B63 A;  2A6E D;  3GTO A;  2A6H D;  3H0G A;  2FIO A;  2YU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...