2FIOA

Phage phi29 transcription regulator p4-dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRGFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPRLRERRKSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (41-MER)
publication title The structure of phage phi29 transcription regulator p4-DNA complex reveals an N-hook motif for DNA
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transcription/dna
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.40 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2fioA00
2FIOA 2FIPA
chains in the Genus database with same CATH superfamily
4V2RA 1SMYD 1EZAA 2MQAA 4CEHA 1ZYMA 2A6ED 2FIPA 1IW7D 2B63A 2FIOA 2EZBA 2K3QA 4BABA 2NVXA 1HQMD 2MP0A 1SFOA 1TWHA 1I50A 1YNND 3GTQA 4CEJA 3GTKA 2JA6A 1TWAA 3U44A 2MX8A 2LYIA 2R7ZA 1W27A 4CQ5A 2F5JA 4C2MA 2MX9A 3GTLA 1WCMA 1T6PA 4C5SA 2X0OA 2N3EA 3GTMA 1Y1VA 2JA5A 2LPJA 2NVYA 3LR6A 3CQZA 3H0GA 2A69D 3GTPA 2E2HA 2EZCA 4QIWA 4FBSA 2HWGA 2AQLA 2R93A 3EZEA 4C5UA 2K3NA 3NZ4A 1K83A 4C6GA 3U4QA 3GTOA 2BE5D 1TWCA 1EZBA 1TWGA 2Y0NA 2O5JD 1I6VD 3LR8A 2N1DB 2LPIA 4BAAA 1I3QA 3LR2A 5IZ2A 4V2QA 2K3OA 3EZAA 1R9TA 2EZAA 4C5RA 2LTHA 1Y1WA 1ZYRD 3EZBA 2R92A 3FKIA 3LRDA 1YNJD 1T6JA 2E2IA 1TWFA 2HROA 2X0PA 2CW0D 2LKMB 2X0QA 1Y2MA 2YIIA 3GTJA 4CEIA 2A68D 2YU9A 2VK9A 2JA7A 2VUMA 3GTGA 2A6HD
chains in the Genus database with same CATH topology
1SMYD 2MQAA 4CEHA 2A6ED 2FIPA 1IW7D 2B63A 2FIOA 2K3QA 2NVXA 1HQMD 1SFOA 1TWHA 1I50A 1YNND 3GTQA 4CEJA 3GTKA 2JA6A 1TWAA 3U44A 2MX8A 2LYIA 2R7ZA 2F5JA 4C2MA 2MX9A 3GTLA 1WCMA 2X0OA 2N3EA 3GTMA 1Y1VA 2JA5A 2LPJA 2NVYA 3LR6A 3CQZA 3H0GA 2A69D 3GTPA 2E2HA 4QIWA 4FBSA 2AQLA 2R93A 2K3NA 1K83A 3U4QA 3GTOA 2BE5D 1TWCA 1TWGA 2Y0NA 2O5JD 1I6VD 3LR8A 2N1DB 2LPIA 1I3QA 3LR2A 5IZ2A 2K3OA 1R9TA 2LTHA 1Y1WA 1ZYRD 2R92A 3FKIA 3LRDA 1YNJD 2E2IA 1TWFA 2X0PA 2CW0D 2LKMB 2X0QA 3GTJA 4CEIA 2A68D 2YU9A 2VK9A 2JA7A 2VUMA 3GTGA 2A6HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIO A;  2FIP A; 
#chains in the Genus database with same CATH topology
 4V2R A;  1SMY D;  1EZA A;  2MQA A;  4CEH A;  1ZYM A;  2A6E D;  2FIP A;  1IW7 D;  2B63 A;  2FIO A;  2EZB A;  2K3Q A;  4BAB A;  2NVX A;  1HQM D;  2MP0 A;  1SFO A;  1TWH A;  1I50 A;  1YNN D;  3GTQ A;  4CEJ A;  3GTK A;  2JA6 A;  1TWA A;  3U44 A;  2MX8 A;  2LYI A;  2R7Z A;  1W27 A;  4CQ5 A;  2F5J A;  4C2M A;  2MX9 A;  3GTL A;  1WCM A;  1T6P A;  4C5S A;  2X0O A;  2N3E A;  3GTM A;  1Y1V A;  2JA5 A;  2LPJ A;  2NVY A;  3LR6 A;  3CQZ A;  3H0G A;  2A69 D;  3GTP A;  2E2H A;  2EZC A;  4QIW A;  4FBS A;  2HWG A;  2AQL A;  2R93 A;  3EZE A;  4C5U A;  2K3N A;  3NZ4 A;  1K83 A;  4C6G A;  3U4Q A;  3GTO A;  2BE5 D;  1TWC A;  1EZB A;  1TWG A;  2Y0N A;  2O5J D;  1I6V D;  3LR8 A;  2N1D B;  2LPI A;  4BAA A;  1I3Q A;  3LR2 A;  5IZ2 A;  4V2Q A;  2K3O A;  3EZA A;  1R9T A;  2EZA A;  4C5R A;  2LTH A;  1Y1W A;  1ZYR D;  3EZB A;  2R92 A;  3FKI A;  3LRD A;  1YNJ D;  1T6J A;  2E2I A;  1TWF A;  2HRO A;  2X0P A;  2CW0 D;  2LKM B;  2X0Q A;  1Y2M A;  2YII A;  3GTJ A;  4CEI A;  2A68 D;  2YU9 A;  2VK9 A;  2JA7 A;  2VUM A;  3GTG A;  2A6H D; 
#chains in the Genus database with same CATH homology
 1SMY D;  2MQA A;  4CEH A;  2A6E D;  2FIP A;  1IW7 D;  2B63 A;  2FIO A;  2K3Q A;  2NVX A;  1HQM D;  1SFO A;  1TWH A;  1I50 A;  1YNN D;  3GTQ A;  4CEJ A;  3GTK A;  2JA6 A;  1TWA A;  3U44 A;  2MX8 A;  2LYI A;  2R7Z A;  2F5J A;  4C2M A;  2MX9 A;  3GTL A;  1WCM A;  2X0O A;  2N3E A;  3GTM A;  1Y1V A;  2JA5 A;  2LPJ A;  2NVY A;  3LR6 A;  3CQZ A;  3H0G A;  2A69 D;  3GTP A;  2E2H A;  4QIW A;  4FBS A;  2AQL A;  2R93 A;  2K3N A;  1K83 A;  3U4Q A;  3GTO A;  2BE5 D;  1TWC A;  1TWG A;  2Y0N A;  2O5J D;  1I6V D;  3LR8 A;  2N1D B;  2LPI A;  1I3Q A;  3LR2 A;  5IZ2 A;  2K3O A;  1R9T A;  2LTH A;  1Y1W A;  1ZYR D;  2R92 A;  3FKI A;  3LRD A;  1YNJ D;  2E2I A;  1TWF A;  2X0P A;  2CW0 D;  2LKM B;  2X0Q A;  3GTJ A;  4CEI A;  2A68 D;  2YU9 A;  2VK9 A;  2JA7 A;  2VUM A;  3GTG A;  2A6H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...