2FIOA

Phage phi29 transcription regulator p4-dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
b'PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRGFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPRLRERRKSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (41-MER)
publication title The structure of phage phi29 transcription regulator p4-DNA complex reveals an N-hook motif for DNA
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transcription/dna
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.40 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2fioA00
2FIOA 2FIPA
chains in the Genus database with same CATH superfamily
4C5UA 1TWHA 3GTGA 1EZBA 4C6GA 2R93A 2N1DB 3CQZA 2VK9A 4CEHA 2LPIA 3GTMA 1R9TA 1TWGA 3GTJA 2FIPA 2AQLA 1EZAA 3GTPA 5IZ2A 2JA6A 1I3QA 3H0GA 1Y1VA 2MP0A 1K83A 1TWFA 3LR2A 1YNJD 2EZAA 3GTQA 2FIOA 1Y1WA 4BAAA 3EZAA 2E2IA 2BE5D 2HROA 2VUMA 2MX8A 2HWGA 3LR8A 1ZYRD 1TWAA 1W27A 3EZEA 2F5JA 2N3EA 2MX9A 2K3OA 3LRDA 2EZCA 2E2HA 1ZYMA 2X0PA 2B63A 1TWCA 2NVYA 2LKMB 2LYIA 2NVXA 3LR6A 3U4QA 2EZBA 3U44A 3GTLA 1YNND 1WCMA 2R7ZA 2O5JD 3GTOA 2A69D 4C2MA 2YU9A 2A6ED 4QIWA 2YIIA 4BABA 1I6VD 4V2RA 3EZBA 2X0OA 2R92A 1IW7D 4C5RA 2JA5A 1I50A 2MQAA 2JA7A 1SFOA 4C5SA 4CQ5A 2A68D 4FBSA 1Y2MA 2A6HD 2CW0D 3FKIA 4V2QA 2K3NA 4CEJA 1HQMD 3GTKA 2LPJA 2K3QA 2X0QA 1T6PA 1SMYD 4CEIA 1T6JA 2Y0NA 2LTHA 3NZ4A
chains in the Genus database with same CATH topology
1TWHA 3GTGA 2R93A 2N1DB 3CQZA 2VK9A 4CEHA 2LPIA 3GTMA 1R9TA 1TWGA 3GTJA 2FIPA 2AQLA 3GTPA 5IZ2A 2JA6A 1I3QA 3H0GA 1Y1VA 1K83A 1TWFA 3LR2A 1YNJD 3GTQA 2FIOA 1Y1WA 2E2IA 2BE5D 2VUMA 2MX8A 3LR8A 1ZYRD 1TWAA 2F5JA 2N3EA 2MX9A 2K3OA 3LRDA 2E2HA 2X0PA 2B63A 1TWCA 2NVYA 2LKMB 2LYIA 2NVXA 3LR6A 3U4QA 3U44A 3GTLA 1YNND 1WCMA 2R7ZA 2O5JD 3GTOA 2A69D 4C2MA 2YU9A 2A6ED 4QIWA 1I6VD 2X0OA 2R92A 1IW7D 2JA5A 1I50A 2MQAA 2JA7A 1SFOA 2A68D 4FBSA 2A6HD 2CW0D 3FKIA 2K3NA 4CEJA 1HQMD 3GTKA 2LPJA 2K3QA 2X0QA 1SMYD 4CEIA 2Y0NA 2LTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIO A;  2FIP A; 
#chains in the Genus database with same CATH topology
 4C5U A;  1TWH A;  3GTG A;  1EZB A;  4C6G A;  2R93 A;  2N1D B;  3CQZ A;  2VK9 A;  4CEH A;  2LPI A;  3GTM A;  1R9T A;  1TWG A;  3GTJ A;  2FIP A;  2AQL A;  1EZA A;  3GTP A;  5IZ2 A;  2JA6 A;  1I3Q A;  3H0G A;  1Y1V A;  2MP0 A;  1K83 A;  1TWF A;  3LR2 A;  1YNJ D;  2EZA A;  3GTQ A;  2FIO A;  1Y1W A;  4BAA A;  3EZA A;  2E2I A;  2BE5 D;  2HRO A;  2VUM A;  2MX8 A;  2HWG A;  3LR8 A;  1ZYR D;  1TWA A;  1W27 A;  3EZE A;  2F5J A;  2N3E A;  2MX9 A;  2K3O A;  3LRD A;  2EZC A;  2E2H A;  1ZYM A;  2X0P A;  2B63 A;  1TWC A;  2NVY A;  2LKM B;  2LYI A;  2NVX A;  3LR6 A;  3U4Q A;  2EZB A;  3U44 A;  3GTL A;  1YNN D;  1WCM A;  2R7Z A;  2O5J D;  3GTO A;  2A69 D;  4C2M A;  2YU9 A;  2A6E D;  4QIW A;  2YII A;  4BAB A;  1I6V D;  4V2R A;  3EZB A;  2X0O A;  2R92 A;  1IW7 D;  4C5R A;  2JA5 A;  1I50 A;  2MQA A;  2JA7 A;  1SFO A;  4C5S A;  4CQ5 A;  2A68 D;  4FBS A;  1Y2M A;  2A6H D;  2CW0 D;  3FKI A;  4V2Q A;  2K3N A;  4CEJ A;  1HQM D;  3GTK A;  2LPJ A;  2K3Q A;  2X0Q A;  1T6P A;  1SMY D;  4CEI A;  1T6J A;  2Y0N A;  2LTH A;  3NZ4 A; 
#chains in the Genus database with same CATH homology
 1TWH A;  3GTG A;  2R93 A;  2N1D B;  3CQZ A;  2VK9 A;  4CEH A;  2LPI A;  3GTM A;  1R9T A;  1TWG A;  3GTJ A;  2FIP A;  2AQL A;  3GTP A;  5IZ2 A;  2JA6 A;  1I3Q A;  3H0G A;  1Y1V A;  1K83 A;  1TWF A;  3LR2 A;  1YNJ D;  3GTQ A;  2FIO A;  1Y1W A;  2E2I A;  2BE5 D;  2VUM A;  2MX8 A;  3LR8 A;  1ZYR D;  1TWA A;  2F5J A;  2N3E A;  2MX9 A;  2K3O A;  3LRD A;  2E2H A;  2X0P A;  2B63 A;  1TWC A;  2NVY A;  2LKM B;  2LYI A;  2NVX A;  3LR6 A;  3U4Q A;  3U44 A;  3GTL A;  1YNN D;  1WCM A;  2R7Z A;  2O5J D;  3GTO A;  2A69 D;  4C2M A;  2YU9 A;  2A6E D;  4QIW A;  1I6V D;  2X0O A;  2R92 A;  1IW7 D;  2JA5 A;  1I50 A;  2MQA A;  2JA7 A;  1SFO A;  2A68 D;  4FBS A;  2A6H D;  2CW0 D;  3FKI A;  2K3N A;  4CEJ A;  1HQM D;  3GTK A;  2LPJ A;  2K3Q A;  2X0Q A;  1SMY D;  4CEI A;  2Y0N A;  2LTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...