2FIOA

Phage phi29 transcription regulator p4-dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
b'PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRGFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPRLRERRKSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (41-MER)
publication title The structure of phage phi29 transcription regulator p4-DNA complex reveals an N-hook motif for DNA
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transcription/dna
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.40 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2fioA00
2FIOA 2FIPA
chains in the Genus database with same CATH superfamily
1Y1WA 2R7ZA 4QIWA 1R9TA 4CEJA 2AQLA 1ZYRD 2CW0D 3GTOA 2B63A 2LPIA 1EZBA 3LR6A 4C5SA 2VK9A 3GTGA 1I6VD 4C5UA 2X0OA 1I3QA 2NVXA 2A6HD 4C2MA 2LKMB 1HQMD 2JA6A 2BE5D 1SFOA 3U4QA 2A6ED 2R92A 2FIPA 1YNND 3CQZA 1Y1VA 4BAAA 2E2HA 4BABA 3GTKA 2MX8A 1WCMA 2O5JD 3GTMA 2Y0NA 1Y2MA 2X0PA 4C5RA 2K3OA 3FKIA 4CEHA 3EZEA 2K3QA 3LRDA 1IW7D 2N1DB 3U44A 2YU9A 1TWAA 3GTLA 3NZ4A 5IZ2A 1YNJD 3H0GA 2EZCA 1TWGA 4C6GA 3EZBA 2MX9A 2FIOA 3GTJA 2HROA 2VUMA 2X0QA 4CEIA 1T6PA 1TWCA 3LR8A 4CQ5A 4V2RA 2JA7A 2MQAA 3GTPA 1ZYMA 4FBSA 3LR2A 1T6JA 2EZAA 2F5JA 2LPJA 2R93A 2MP0A 2EZBA 2A68D 1K83A 1W27A 3GTQA 4V2QA 1TWFA 2HWGA 2NVYA 2E2IA 2JA5A 2YIIA 2LTHA 2A69D 2LYIA 2N3EA 1SMYD 3EZAA 2K3NA 1I50A 1EZAA 1TWHA
chains in the Genus database with same CATH topology
1Y1WA 2R7ZA 4QIWA 1R9TA 4CEJA 2AQLA 1ZYRD 2CW0D 3GTOA 2B63A 2LPIA 3LR6A 2VK9A 3GTGA 1I6VD 2X0OA 1I3QA 2NVXA 2A6HD 4C2MA 2LKMB 1HQMD 2JA6A 2BE5D 1SFOA 3U4QA 2A6ED 2R92A 2FIPA 1YNND 3CQZA 1Y1VA 2E2HA 3GTKA 2MX8A 1WCMA 2O5JD 3GTMA 2Y0NA 2X0PA 2K3OA 3FKIA 4CEHA 2K3QA 3LRDA 1IW7D 2N1DB 3U44A 2YU9A 1TWAA 3GTLA 5IZ2A 1YNJD 3H0GA 1TWGA 2FIOA 2MX9A 3GTJA 2VUMA 2X0QA 4CEIA 1TWCA 3LR8A 2JA7A 2MQAA 3GTPA 4FBSA 3LR2A 2F5JA 2LPJA 2R93A 2A68D 1K83A 3GTQA 1TWFA 2NVYA 2E2IA 2JA5A 2LTHA 2A69D 2LYIA 2N3EA 1SMYD 2K3NA 1I50A 1TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIO A;  2FIP A; 
#chains in the Genus database with same CATH topology
 1Y1W A;  2R7Z A;  4QIW A;  1R9T A;  4CEJ A;  2AQL A;  1ZYR D;  2CW0 D;  3GTO A;  2B63 A;  2LPI A;  1EZB A;  3LR6 A;  4C5S A;  2VK9 A;  3GTG A;  1I6V D;  4C5U A;  2X0O A;  1I3Q A;  2NVX A;  2A6H D;  4C2M A;  2LKM B;  1HQM D;  2JA6 A;  2BE5 D;  1SFO A;  3U4Q A;  2A6E D;  2R92 A;  2FIP A;  1YNN D;  3CQZ A;  1Y1V A;  4BAA A;  2E2H A;  4BAB A;  3GTK A;  2MX8 A;  1WCM A;  2O5J D;  3GTM A;  2Y0N A;  1Y2M A;  2X0P A;  4C5R A;  2K3O A;  3FKI A;  4CEH A;  3EZE A;  2K3Q A;  3LRD A;  1IW7 D;  2N1D B;  3U44 A;  2YU9 A;  1TWA A;  3GTL A;  3NZ4 A;  5IZ2 A;  1YNJ D;  3H0G A;  2EZC A;  1TWG A;  4C6G A;  3EZB A;  2MX9 A;  2FIO A;  3GTJ A;  2HRO A;  2VUM A;  2X0Q A;  4CEI A;  1T6P A;  1TWC A;  3LR8 A;  4CQ5 A;  4V2R A;  2JA7 A;  2MQA A;  3GTP A;  1ZYM A;  4FBS A;  3LR2 A;  1T6J A;  2EZA A;  2F5J A;  2LPJ A;  2R93 A;  2MP0 A;  2EZB A;  2A68 D;  1K83 A;  1W27 A;  3GTQ A;  4V2Q A;  1TWF A;  2HWG A;  2NVY A;  2E2I A;  2JA5 A;  2YII A;  2LTH A;  2A69 D;  2LYI A;  2N3E A;  1SMY D;  3EZA A;  2K3N A;  1I50 A;  1EZA A;  1TWH A; 
#chains in the Genus database with same CATH homology
 1Y1W A;  2R7Z A;  4QIW A;  1R9T A;  4CEJ A;  2AQL A;  1ZYR D;  2CW0 D;  3GTO A;  2B63 A;  2LPI A;  3LR6 A;  2VK9 A;  3GTG A;  1I6V D;  2X0O A;  1I3Q A;  2NVX A;  2A6H D;  4C2M A;  2LKM B;  1HQM D;  2JA6 A;  2BE5 D;  1SFO A;  3U4Q A;  2A6E D;  2R92 A;  2FIP A;  1YNN D;  3CQZ A;  1Y1V A;  2E2H A;  3GTK A;  2MX8 A;  1WCM A;  2O5J D;  3GTM A;  2Y0N A;  2X0P A;  2K3O A;  3FKI A;  4CEH A;  2K3Q A;  3LRD A;  1IW7 D;  2N1D B;  3U44 A;  2YU9 A;  1TWA A;  3GTL A;  5IZ2 A;  1YNJ D;  3H0G A;  1TWG A;  2FIO A;  2MX9 A;  3GTJ A;  2VUM A;  2X0Q A;  4CEI A;  1TWC A;  3LR8 A;  2JA7 A;  2MQA A;  3GTP A;  4FBS A;  3LR2 A;  2F5J A;  2LPJ A;  2R93 A;  2A68 D;  1K83 A;  3GTQ A;  1TWF A;  2NVY A;  2E2I A;  2JA5 A;  2LTH A;  2A69 D;  2LYI A;  2N3E A;  1SMY D;  2K3N A;  1I50 A;  1TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...