2FIOA

Phage phi29 transcription regulator p4-dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRGFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPRLRERRKSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of phage phi29 transcription regulator p4-DNA complex reveals an N-hook motif for DNA
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transcription/dna
molecule keywords DNA (41-MER)
total genus 43
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.40 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2fioA00
2FIPA 2FIOA
chains in the Genus database with same CATH superfamily
1T6PA 1I3QA 2N1DB 1SFOA 2Y0NA 2NVYA 1Y2MA 3LR2A 2LKMB 4CEIA 2EZCA 1TWCA 2YIIA 3GTKA 2YU9A 2LYIA 3LR8A 4C5UA 2NVXA 4V2RA 1EZBA 2X0PA 4QIWA 2FIPA 4CEHA 2R7ZA 2X0QA 2R92A 2K3QA 3GTOA 4C5SA 1TWGA 1HQMD 2CW0D 3GTGA 3LRDA 4C5RA 1TWFA 1T6JA 4CEJA 1IW7D 1Y1WA 4C2MA 4CQ5A 3CQZA 2BE5D 2EZAA 1SMYD 2X0OA 2LPJA 4V2QA 1K83A 2R93A 2HROA 2K3OA 1I6VD 2A69D 2VK9A 1TWAA 2A68D 2MP0A 3U44A 2JA7A 3GTMA 2B63A 1I50A 2MX8A 3EZEA 2FIOA 2F5JA 2E2IA 3GTLA 3NZ4A 3GTJA 2VUMA 2HWGA 2A6ED 1R9TA 1YNJD 4BAAA 2EZBA 2JA5A 3H0GA 3EZBA 2AQLA 3EZAA 2K3NA 1W27A 3GTQA 3LR6A 3FKIA 1ZYMA 2MQAA 1ZYRD 4FBSA 2LPIA 1YNND 2MX9A 3U4QA 2E2HA 1WCMA 1TWHA 2LTHA 4C6GA 2N3EA 2JA6A 2A6HD 3GTPA 1EZAA 1Y1VA 4BABA 2O5JD 5IZ2A
chains in the Genus database with same CATH topology
1I3QA 2N1DB 1SFOA 2Y0NA 2NVYA 3LR2A 2LKMB 4CEIA 1TWCA 3GTKA 2YU9A 2LYIA 3LR8A 2NVXA 2X0PA 4QIWA 2FIPA 4CEHA 2R7ZA 2X0QA 2R92A 2K3QA 3GTOA 1TWGA 1HQMD 2CW0D 3GTGA 3LRDA 1TWFA 4CEJA 1IW7D 1Y1WA 4C2MA 3CQZA 2BE5D 1SMYD 2X0OA 2LPJA 1K83A 2R93A 2K3OA 1I6VD 2A69D 2VK9A 1TWAA 2A68D 3U44A 2JA7A 3GTMA 2B63A 1I50A 2MX8A 2FIOA 2F5JA 2E2IA 3GTLA 3GTJA 2VUMA 2A6ED 1R9TA 1YNJD 2JA5A 3H0GA 2AQLA 2K3NA 3GTQA 3LR6A 3FKIA 2MQAA 1ZYRD 4FBSA 2LPIA 1YNND 2MX9A 3U4QA 2E2HA 1WCMA 1TWHA 2LTHA 2N3EA 2JA6A 2A6HD 3GTPA 1Y1VA 2O5JD 5IZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIP A;  2FIO A; 
#chains in the Genus database with same CATH topology
 1T6P A;  1I3Q A;  2N1D B;  1SFO A;  2Y0N A;  2NVY A;  1Y2M A;  3LR2 A;  2LKM B;  4CEI A;  2EZC A;  1TWC A;  2YII A;  3GTK A;  2YU9 A;  2LYI A;  3LR8 A;  4C5U A;  2NVX A;  4V2R A;  1EZB A;  2X0P A;  4QIW A;  2FIP A;  4CEH A;  2R7Z A;  2X0Q A;  2R92 A;  2K3Q A;  3GTO A;  4C5S A;  1TWG A;  1HQM D;  2CW0 D;  3GTG A;  3LRD A;  4C5R A;  1TWF A;  1T6J A;  4CEJ A;  1IW7 D;  1Y1W A;  4C2M A;  4CQ5 A;  3CQZ A;  2BE5 D;  2EZA A;  1SMY D;  2X0O A;  2LPJ A;  4V2Q A;  1K83 A;  2R93 A;  2HRO A;  2K3O A;  1I6V D;  2A69 D;  2VK9 A;  1TWA A;  2A68 D;  2MP0 A;  3U44 A;  2JA7 A;  3GTM A;  2B63 A;  1I50 A;  2MX8 A;  3EZE A;  2FIO A;  2F5J A;  2E2I A;  3GTL A;  3NZ4 A;  3GTJ A;  2VUM A;  2HWG A;  2A6E D;  1R9T A;  1YNJ D;  4BAA A;  2EZB A;  2JA5 A;  3H0G A;  3EZB A;  2AQL A;  3EZA A;  2K3N A;  1W27 A;  3GTQ A;  3LR6 A;  3FKI A;  1ZYM A;  2MQA A;  1ZYR D;  4FBS A;  2LPI A;  1YNN D;  2MX9 A;  3U4Q A;  2E2H A;  1WCM A;  1TWH A;  2LTH A;  4C6G A;  2N3E A;  2JA6 A;  2A6H D;  3GTP A;  1EZA A;  1Y1V A;  4BAB A;  2O5J D;  5IZ2 A; 
#chains in the Genus database with same CATH homology
 1I3Q A;  2N1D B;  1SFO A;  2Y0N A;  2NVY A;  3LR2 A;  2LKM B;  4CEI A;  1TWC A;  3GTK A;  2YU9 A;  2LYI A;  3LR8 A;  2NVX A;  2X0P A;  4QIW A;  2FIP A;  4CEH A;  2R7Z A;  2X0Q A;  2R92 A;  2K3Q A;  3GTO A;  1TWG A;  1HQM D;  2CW0 D;  3GTG A;  3LRD A;  1TWF A;  4CEJ A;  1IW7 D;  1Y1W A;  4C2M A;  3CQZ A;  2BE5 D;  1SMY D;  2X0O A;  2LPJ A;  1K83 A;  2R93 A;  2K3O A;  1I6V D;  2A69 D;  2VK9 A;  1TWA A;  2A68 D;  3U44 A;  2JA7 A;  3GTM A;  2B63 A;  1I50 A;  2MX8 A;  2FIO A;  2F5J A;  2E2I A;  3GTL A;  3GTJ A;  2VUM A;  2A6E D;  1R9T A;  1YNJ D;  2JA5 A;  3H0G A;  2AQL A;  2K3N A;  3GTQ A;  3LR6 A;  3FKI A;  2MQA A;  1ZYR D;  4FBS A;  2LPI A;  1YNN D;  2MX9 A;  3U4Q A;  2E2H A;  1WCM A;  1TWH A;  2LTH A;  2N3E A;  2JA6 A;  2A6H D;  3GTP A;  1Y1V A;  2O5J D;  5IZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...