2MX8A

Nmr structure of n-terminal domain from a. ventricosus minor ampullate spidroin (misp) at ph 7.2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRESMMQATGSVDNAFTNEVMQLVKMLSADSANEVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor ampullate spidroin
publication title Diversified Structural Basis of a Conserved Molecular Mechanism for pH-Dependent Dimerization in Spider Silk N-Terminal Domains.
pubmed doi rcsb
source organism Araneus ventricosus
molecule tags Structural protein
total genus 43
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mx8A01
2LPIA 2MX8A 2LTHA 3LR8A 3LR6A 4FBSA 3LR2A 2LPJA 2MX9A 5IZ2A 2N3EA 3LRDA 2K3QA
chains in the Genus database with same CATH superfamily
3GTOA 3NZ4A 1Y1VA 2A6HD 1TWHA 2LPJA 1YNJD 3LR8A 3EZBA 4QIWA 2B63A 1TWGA 4CEJA 2BE5D 4FBSA 2R93A 3LR2A 1EZAA 2HWGA 3EZAA 2JA5A 1ZYMA 2E2HA 1Y1WA 1WCMA 4V2RA 2MQAA 4C5RA 4CEHA 4BAAA 3U44A 1T6PA 3U4QA 2LKMB 4C5SA 2A69D 2YIIA 1HQMD 2R7ZA 2LYIA 2R92A 1SFOA 1TWFA 2N3EA 1I6VD 2VK9A 2LPIA 4V2QA 1I50A 2E2IA 2EZAA 2Y0NA 3FKIA 1K83A 4CQ5A 3LR6A 2N1DB 2EZBA 2JA7A 1Y2MA 1TWCA 1IW7D 3GTPA 4CEIA 3GTLA 2K3NA 2MP0A 2AQLA 3GTKA 2K3OA 2X0OA 1YNND 3LRDA 3EZEA 1EZBA 2FIPA 2CW0D 2NVYA 2X0QA 2YU9A 1ZYRD 4C6GA 2O5JD 4BABA 1T6JA 2JA6A 2X0PA 2F5JA 1TWAA 1W27A 3GTJA 2MX8A 3GTGA 2LTHA 2VUMA 2MX9A 3GTMA 3GTQA 3CQZA 2NVXA 3H0GA 2A6ED 4C5UA 1SMYD 1I3QA 2A68D 2HROA 5IZ2A 2K3QA 4C2MA 1R9TA 2FIOA 2EZCA
chains in the Genus database with same CATH topology
3GTOA 1Y1VA 2A6HD 1TWHA 2LPJA 1YNJD 3LR8A 4QIWA 2B63A 1TWGA 4CEJA 2BE5D 4FBSA 2R93A 3LR2A 2JA5A 2E2HA 1Y1WA 1WCMA 2MQAA 4CEHA 3U44A 3U4QA 2LKMB 2A69D 1HQMD 2R7ZA 2LYIA 2R92A 1SFOA 1TWFA 2N3EA 1I6VD 2VK9A 2LPIA 2E2IA 1I50A 2Y0NA 3FKIA 1K83A 3LR6A 2N1DB 2JA7A 1TWCA 1IW7D 3GTPA 4CEIA 3GTLA 2K3NA 2AQLA 3GTKA 2K3OA 2X0OA 1YNND 3LRDA 2FIPA 2CW0D 2NVYA 2X0QA 2YU9A 1ZYRD 2O5JD 2JA6A 2X0PA 2F5JA 1TWAA 3GTGA 3GTJA 2MX8A 2LTHA 2VUMA 2MX9A 3GTMA 3GTQA 3CQZA 2NVXA 3H0GA 2A6ED 1SMYD 1I3QA 2A68D 5IZ2A 2K3QA 4C2MA 1R9TA 2FIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPI A;  2MX8 A;  2LTH A;  3LR8 A;  3LR6 A;  4FBS A;  3LR2 A;  2LPJ A;  2MX9 A;  5IZ2 A;  2N3E A;  3LRD A;  2K3Q A; 
#chains in the Genus database with same CATH topology
 3GTO A;  3NZ4 A;  1Y1V A;  2A6H D;  1TWH A;  2LPJ A;  1YNJ D;  3LR8 A;  3EZB A;  4QIW A;  2B63 A;  1TWG A;  4CEJ A;  2BE5 D;  4FBS A;  2R93 A;  3LR2 A;  1EZA A;  2HWG A;  3EZA A;  2JA5 A;  1ZYM A;  2E2H A;  1Y1W A;  1WCM A;  4V2R A;  2MQA A;  4C5R A;  4CEH A;  4BAA A;  3U44 A;  1T6P A;  3U4Q A;  2LKM B;  4C5S A;  2A69 D;  2YII A;  1HQM D;  2R7Z A;  2LYI A;  2R92 A;  1SFO A;  1TWF A;  2N3E A;  1I6V D;  2VK9 A;  2LPI A;  4V2Q A;  1I50 A;  2E2I A;  2EZA A;  2Y0N A;  3FKI A;  1K83 A;  4CQ5 A;  3LR6 A;  2N1D B;  2EZB A;  2JA7 A;  1Y2M A;  1TWC A;  1IW7 D;  3GTP A;  4CEI A;  3GTL A;  2K3N A;  2MP0 A;  2AQL A;  3GTK A;  2K3O A;  2X0O A;  1YNN D;  3LRD A;  3EZE A;  1EZB A;  2FIP A;  2CW0 D;  2NVY A;  2X0Q A;  2YU9 A;  1ZYR D;  4C6G A;  2O5J D;  4BAB A;  1T6J A;  2JA6 A;  2X0P A;  2F5J A;  1TWA A;  1W27 A;  3GTJ A;  2MX8 A;  3GTG A;  2LTH A;  2VUM A;  2MX9 A;  3GTM A;  3GTQ A;  3CQZ A;  2NVX A;  3H0G A;  2A6E D;  4C5U A;  1SMY D;  1I3Q A;  2A68 D;  2HRO A;  5IZ2 A;  2K3Q A;  4C2M A;  1R9T A;  2FIO A;  2EZC A; 
#chains in the Genus database with same CATH homology
 3GTO A;  1Y1V A;  2A6H D;  1TWH A;  2LPJ A;  1YNJ D;  3LR8 A;  4QIW A;  2B63 A;  1TWG A;  4CEJ A;  2BE5 D;  4FBS A;  2R93 A;  3LR2 A;  2JA5 A;  2E2H A;  1Y1W A;  1WCM A;  2MQA A;  4CEH A;  3U44 A;  3U4Q A;  2LKM B;  2A69 D;  1HQM D;  2R7Z A;  2LYI A;  2R92 A;  1SFO A;  1TWF A;  2N3E A;  1I6V D;  2VK9 A;  2LPI A;  2E2I A;  1I50 A;  2Y0N A;  3FKI A;  1K83 A;  3LR6 A;  2N1D B;  2JA7 A;  1TWC A;  1IW7 D;  3GTP A;  4CEI A;  3GTL A;  2K3N A;  2AQL A;  3GTK A;  2K3O A;  2X0O A;  1YNN D;  3LRD A;  2FIP A;  2CW0 D;  2NVY A;  2X0Q A;  2YU9 A;  1ZYR D;  2O5J D;  2JA6 A;  2X0P A;  2F5J A;  1TWA A;  3GTG A;  3GTJ A;  2MX8 A;  2LTH A;  2VUM A;  2MX9 A;  3GTM A;  3GTQ A;  3CQZ A;  2NVX A;  3H0G A;  2A6E D;  1SMY D;  1I3Q A;  2A68 D;  5IZ2 A;  2K3Q A;  4C2M A;  1R9T A;  2FIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...