2MX8A

Nmr structure of n-terminal domain from a. ventricosus minor ampullate spidroin (misp) at ph 7.2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
b'GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRESMMQATGSVDNAFTNEVMQLVKMLSADSANEVST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor ampullate spidroin
publication title Diversified Structural Basis of a Conserved Molecular Mechanism for pH-Dependent Dimerization in Spider Silk N-Terminal Domains.
pubmed doi rcsb
source organism Araneus ventricosus
molecule tags Structural protein
total genus 43
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mx8A01
2N3EA 2K3QA 4FBSA 2MX8A 2LPIA 2LTHA 3LR2A 5IZ2A 3LRDA 3LR6A 3LR8A 2LPJA 2MX9A
chains in the Genus database with same CATH superfamily
1EZAA 4CEHA 2F5JA 4CEJA 1T6PA 2A6HD 2VK9A 1Y1VA 4C6GA 2R7ZA 3LR8A 2JA6A 2MX9A 1Y1WA 2LTHA 3GTMA 4V2QA 3GTQA 4BAAA 1TWHA 2K3QA 4C5SA 4BABA 3LRDA 1EZBA 2HROA 1SFOA 1HQMD 2CW0D 1R9TA 2X0QA 1T6JA 2EZCA 2NVYA 3EZBA 1TWAA 2BE5D 2LPIA 2K3NA 2JA5A 4C5RA 2MX8A 3U44A 1WCMA 4QIWA 3LR6A 1Y2MA 2FIPA 2LYIA 1ZYMA 5IZ2A 2A6ED 2X0PA 1I6VD 4C5UA 3GTPA 1TWGA 2LPJA 2LKMB 2AQLA 1SMYD 1W27A 2JA7A 3EZAA 2R92A 2FIOA 1YNND 2B63A 4CEIA 3CQZA 4CQ5A 2O5JD 2YIIA 2YU9A 3GTGA 1YNJD 2E2IA 2HWGA 2K3OA 2N3EA 3EZEA 2MQAA 2NVXA 3NZ4A 2X0OA 3GTJA 2R93A 4C2MA 1I3QA 1ZYRD 4FBSA 1I50A 3U4QA 1K83A 2Y0NA 1IW7D 2EZBA 3FKIA 2A69D 2MP0A 3LR2A 2EZAA 1TWCA 3GTLA 2VUMA 3GTKA 3H0GA 2E2HA 2N1DB 3GTOA 2A68D 1TWFA 4V2RA
chains in the Genus database with same CATH topology
4CEHA 2F5JA 4CEJA 2A6HD 2VK9A 1Y1VA 2R7ZA 3LR8A 2JA6A 2MX9A 1Y1WA 2LTHA 3GTMA 3GTQA 1TWHA 2K3QA 3LRDA 1SFOA 1HQMD 2CW0D 1R9TA 2X0QA 2NVYA 1TWAA 2BE5D 2LPIA 2K3NA 2JA5A 2MX8A 3U44A 1WCMA 4QIWA 3LR6A 2FIPA 2LYIA 5IZ2A 2A6ED 2X0PA 1I6VD 3GTPA 1TWGA 2LPJA 2LKMB 2AQLA 1SMYD 2JA7A 2R92A 2FIOA 1YNND 2B63A 4CEIA 3CQZA 2O5JD 2YU9A 3GTGA 1YNJD 2E2IA 2K3OA 2N3EA 2MQAA 2NVXA 2X0OA 3GTJA 2R93A 4C2MA 1I3QA 1ZYRD 4FBSA 1I50A 3U4QA 1K83A 2Y0NA 1IW7D 3FKIA 2A69D 3LR2A 1TWCA 3GTLA 2VUMA 3GTKA 3H0GA 2E2HA 2N1DB 3GTOA 2A68D 1TWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3E A;  2K3Q A;  4FBS A;  2MX8 A;  2LPI A;  2LTH A;  3LR2 A;  5IZ2 A;  3LRD A;  3LR6 A;  3LR8 A;  2LPJ A;  2MX9 A; 
#chains in the Genus database with same CATH topology
 1EZA A;  4CEH A;  2F5J A;  4CEJ A;  1T6P A;  2A6H D;  2VK9 A;  1Y1V A;  4C6G A;  2R7Z A;  3LR8 A;  2JA6 A;  2MX9 A;  1Y1W A;  2LTH A;  3GTM A;  4V2Q A;  3GTQ A;  4BAA A;  1TWH A;  2K3Q A;  4C5S A;  4BAB A;  3LRD A;  1EZB A;  2HRO A;  1SFO A;  1HQM D;  2CW0 D;  1R9T A;  2X0Q A;  1T6J A;  2EZC A;  2NVY A;  3EZB A;  1TWA A;  2BE5 D;  2LPI A;  2K3N A;  2JA5 A;  4C5R A;  2MX8 A;  3U44 A;  1WCM A;  4QIW A;  3LR6 A;  1Y2M A;  2FIP A;  2LYI A;  1ZYM A;  5IZ2 A;  2A6E D;  2X0P A;  1I6V D;  4C5U A;  3GTP A;  1TWG A;  2LPJ A;  2LKM B;  2AQL A;  1SMY D;  1W27 A;  2JA7 A;  3EZA A;  2R92 A;  2FIO A;  1YNN D;  2B63 A;  4CEI A;  3CQZ A;  4CQ5 A;  2O5J D;  2YII A;  2YU9 A;  3GTG A;  1YNJ D;  2E2I A;  2HWG A;  2K3O A;  2N3E A;  3EZE A;  2MQA A;  2NVX A;  3NZ4 A;  2X0O A;  3GTJ A;  2R93 A;  4C2M A;  1I3Q A;  1ZYR D;  4FBS A;  1I50 A;  3U4Q A;  1K83 A;  2Y0N A;  1IW7 D;  2EZB A;  3FKI A;  2A69 D;  2MP0 A;  3LR2 A;  2EZA A;  1TWC A;  3GTL A;  2VUM A;  3GTK A;  3H0G A;  2E2H A;  2N1D B;  3GTO A;  2A68 D;  1TWF A;  4V2R A; 
#chains in the Genus database with same CATH homology
 4CEH A;  2F5J A;  4CEJ A;  2A6H D;  2VK9 A;  1Y1V A;  2R7Z A;  3LR8 A;  2JA6 A;  2MX9 A;  1Y1W A;  2LTH A;  3GTM A;  3GTQ A;  1TWH A;  2K3Q A;  3LRD A;  1SFO A;  1HQM D;  2CW0 D;  1R9T A;  2X0Q A;  2NVY A;  1TWA A;  2BE5 D;  2LPI A;  2K3N A;  2JA5 A;  2MX8 A;  3U44 A;  1WCM A;  4QIW A;  3LR6 A;  2FIP A;  2LYI A;  5IZ2 A;  2A6E D;  2X0P A;  1I6V D;  3GTP A;  1TWG A;  2LPJ A;  2LKM B;  2AQL A;  1SMY D;  2JA7 A;  2R92 A;  2FIO A;  1YNN D;  2B63 A;  4CEI A;  3CQZ A;  2O5J D;  2YU9 A;  3GTG A;  1YNJ D;  2E2I A;  2K3O A;  2N3E A;  2MQA A;  2NVX A;  2X0O A;  3GTJ A;  2R93 A;  4C2M A;  1I3Q A;  1ZYR D;  4FBS A;  1I50 A;  3U4Q A;  1K83 A;  2Y0N A;  1IW7 D;  3FKI A;  2A69 D;  3LR2 A;  1TWC A;  3GTL A;  2VUM A;  3GTK A;  3H0G A;  2E2H A;  2N1D B;  3GTO A;  2A68 D;  1TWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...