2MX8A

Nmr structure of n-terminal domain from a. ventricosus minor ampullate spidroin (misp) at ph 7.2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
GSGNSQPIWTNPNAAMTMTNNLVQCASRSGVLTADQMDDMGMMADSVNSQMQKMGPNPPQHRLRAMNTAMAAEVAEVVATSPPQSYSAVLNTIGACLRESMMQATGSVDNAFTNEVMQLVKMLSADSANEVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversified Structural Basis of a Conserved Molecular Mechanism for pH-Dependent Dimerization in Spider Silk N-Terminal Domains.
pubmed doi rcsb
source organism Araneus ventricosus
molecule tags Structural protein
molecule keywords Minor ampullate spidroin
total genus 43
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2mx8A01
3LR8A 2K3QA 4FBSA 2MX8A 3LR2A 2LTHA 2MX9A 3LR6A 2N3EA 2LPJA 2LPIA 3LRDA 5IZ2A
chains in the Genus database with same CATH superfamily
2NVXA 3U44A 1T6JA 3GTKA 3EZEA 1I6VD 2YIIA 1TWHA 1YNJD 1R9TA 4QIWA 1TWGA 4V2RA 5IZ2A 2BE5D 1Y2MA 2O5JD 1EZBA 3GTGA 4C5RA 4C6GA 2E2IA 3LRDA 4C5UA 2HROA 1SFOA 2N3EA 2FIPA 1W27A 2A68D 1K83A 2LPJA 2X0PA 2Y0NA 3LR8A 2VK9A 1WCMA 1Y1VA 2MQAA 4C2MA 2X0OA 2K3OA 1T6PA 3EZAA 1HQMD 3U4QA 2F5JA 2JA6A 1EZAA 2CW0D 2NVYA 3GTJA 2EZBA 3NZ4A 2VUMA 2MX9A 2FIOA 2K3NA 2MP0A 1SMYD 3CQZA 1ZYMA 2E2HA 2R7ZA 2JA7A 2K3QA 2N1DB 3GTMA 2B63A 1TWCA 2JA5A 4C5SA 3H0GA 2LYIA 4CEJA 2R92A 3LR6A 3GTOA 1YNND 4CEIA 3GTPA 3GTQA 2A6ED 2LTHA 1ZYRD 1IW7D 1I50A 4BABA 2R93A 2AQLA 2A6HD 1Y1WA 4FBSA 1TWAA 2LPIA 4BAAA 2A69D 2YU9A 1I3QA 3GTLA 4CQ5A 2MX8A 2EZAA 2X0QA 3EZBA 3LR2A 3FKIA 2HWGA 4CEHA 2LKMB 1TWFA 4V2QA 2EZCA
chains in the Genus database with same CATH topology
2NVXA 3U44A 3GTKA 1I6VD 1TWHA 1YNJD 1R9TA 4QIWA 1TWGA 5IZ2A 2BE5D 2O5JD 3GTGA 2E2IA 3LRDA 1SFOA 2N3EA 2FIPA 2A68D 1K83A 2LPJA 2X0PA 2Y0NA 3LR8A 2VK9A 1WCMA 1Y1VA 2MQAA 4C2MA 2X0OA 2K3OA 1HQMD 3U4QA 2F5JA 2JA6A 2CW0D 2NVYA 3GTJA 2VUMA 2MX9A 2FIOA 2K3NA 2E2HA 1SMYD 3CQZA 2R7ZA 2JA7A 2K3QA 2N1DB 3GTMA 2B63A 1TWCA 2JA5A 3H0GA 2LYIA 4CEJA 2R92A 3LR6A 3GTOA 1YNND 4CEIA 3GTPA 3GTQA 2A6ED 2LTHA 1ZYRD 1IW7D 1I50A 2R93A 2AQLA 2A6HD 1Y1WA 4FBSA 1TWAA 2LPIA 2A69D 2YU9A 1I3QA 3GTLA 2MX8A 2X0QA 3LR2A 3FKIA 4CEHA 2LKMB 1TWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR8 A;  2K3Q A;  4FBS A;  2MX8 A;  3LR2 A;  2LTH A;  2MX9 A;  3LR6 A;  2N3E A;  2LPJ A;  2LPI A;  3LRD A;  5IZ2 A; 
#chains in the Genus database with same CATH topology
 2NVX A;  3U44 A;  1T6J A;  3GTK A;  3EZE A;  1I6V D;  2YII A;  1TWH A;  1YNJ D;  1R9T A;  4QIW A;  1TWG A;  4V2R A;  5IZ2 A;  2BE5 D;  1Y2M A;  2O5J D;  1EZB A;  3GTG A;  4C5R A;  4C6G A;  2E2I A;  3LRD A;  4C5U A;  2HRO A;  1SFO A;  2N3E A;  2FIP A;  1W27 A;  2A68 D;  1K83 A;  2LPJ A;  2X0P A;  2Y0N A;  3LR8 A;  2VK9 A;  1WCM A;  1Y1V A;  2MQA A;  4C2M A;  2X0O A;  2K3O A;  1T6P A;  3EZA A;  1HQM D;  3U4Q A;  2F5J A;  2JA6 A;  1EZA A;  2CW0 D;  2NVY A;  3GTJ A;  2EZB A;  3NZ4 A;  2VUM A;  2MX9 A;  2FIO A;  2K3N A;  2MP0 A;  1SMY D;  3CQZ A;  1ZYM A;  2E2H A;  2R7Z A;  2JA7 A;  2K3Q A;  2N1D B;  3GTM A;  2B63 A;  1TWC A;  2JA5 A;  4C5S A;  3H0G A;  2LYI A;  4CEJ A;  2R92 A;  3LR6 A;  3GTO A;  1YNN D;  4CEI A;  3GTP A;  3GTQ A;  2A6E D;  2LTH A;  1ZYR D;  1IW7 D;  1I50 A;  4BAB A;  2R93 A;  2AQL A;  2A6H D;  1Y1W A;  4FBS A;  1TWA A;  2LPI A;  4BAA A;  2A69 D;  2YU9 A;  1I3Q A;  3GTL A;  4CQ5 A;  2MX8 A;  2EZA A;  2X0Q A;  3EZB A;  3LR2 A;  3FKI A;  2HWG A;  4CEH A;  2LKM B;  1TWF A;  4V2Q A;  2EZC A; 
#chains in the Genus database with same CATH homology
 2NVX A;  3U44 A;  3GTK A;  1I6V D;  1TWH A;  1YNJ D;  1R9T A;  4QIW A;  1TWG A;  5IZ2 A;  2BE5 D;  2O5J D;  3GTG A;  2E2I A;  3LRD A;  1SFO A;  2N3E A;  2FIP A;  2A68 D;  1K83 A;  2LPJ A;  2X0P A;  2Y0N A;  3LR8 A;  2VK9 A;  1WCM A;  1Y1V A;  2MQA A;  4C2M A;  2X0O A;  2K3O A;  1HQM D;  3U4Q A;  2F5J A;  2JA6 A;  2CW0 D;  2NVY A;  3GTJ A;  2VUM A;  2MX9 A;  2FIO A;  2K3N A;  2E2H A;  1SMY D;  3CQZ A;  2R7Z A;  2JA7 A;  2K3Q A;  2N1D B;  3GTM A;  2B63 A;  1TWC A;  2JA5 A;  3H0G A;  2LYI A;  4CEJ A;  2R92 A;  3LR6 A;  3GTO A;  1YNN D;  4CEI A;  3GTP A;  3GTQ A;  2A6E D;  2LTH A;  1ZYR D;  1IW7 D;  1I50 A;  2R93 A;  2AQL A;  2A6H D;  1Y1W A;  4FBS A;  1TWA A;  2LPI A;  2A69 D;  2YU9 A;  1I3Q A;  3GTL A;  2MX8 A;  2X0Q A;  3LR2 A;  3FKI A;  4CEH A;  2LKM B;  1TWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...