3LR6A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
125
structure length
125
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 53
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr6A01
2LPIA 3LR2A 2LPJA 3LR6A 3LRDA 2MX9A 3LR8A 2N3EA 5IZ2A 2LTHA 4FBSA 2K3QA 2MX8A
chains in the Genus database with same CATH superfamily
2YU9A 2MX9A 2VK9A 2N3EA 2VUMA 2K3QA 2F5JA 2X0PA 1K83A 4V2RA 4BAAA 2MP0A 2R93A 3GTGA 3NZ4A 2YIIA 1W27A 2EZAA 3GTPA 3GTOA 1T6JA 2R7ZA 4C5RA 4C6GA 1SFOA 1YNND 3FKIA 2E2HA 1TWAA 3LR8A 2EZCA 2BE5D 2JA5A 2MX8A 1I6VD 1Y1VA 1I50A 4CEIA 1Y1WA 1EZBA 3LR2A 1EZAA 3GTLA 2EZBA 3EZAA 2E2IA 2LYIA 1YNJD 4C2MA 3U44A 1TWHA 3LR6A 2A6HD 1IW7D 3EZBA 4CEHA 3GTQA 4QIWA 2AQLA 2LPIA 1HQMD 2R92A 2NVYA 2HWGA 1R9TA 2B63A 2K3OA 2A68D 2MQAA 3CQZA 2X0OA 2O5JD 2LPJA 3GTJA 4C5UA 2A6ED 3GTKA 2JA6A 2K3NA 1Y2MA 4CEJA 1TWGA 4V2QA 1T6PA 2LKMB 5IZ2A 4FBSA 2CW0D 2NVXA 2HROA 2FIOA 1ZYMA 2A69D 2FIPA 4C5SA 2X0QA 3LRDA 3U4QA 3EZEA 1WCMA 3H0GA 4CQ5A 2N1DB 3GTMA 1ZYRD 4BABA 2JA7A 1TWCA 1TWFA 1I3QA 2Y0NA 2LTHA 1SMYD
chains in the Genus database with same CATH topology
2YU9A 2MX9A 2VK9A 2N3EA 2VUMA 2K3QA 2F5JA 2X0PA 1K83A 2R93A 3GTGA 3GTPA 3GTOA 2R7ZA 1SFOA 1YNND 3FKIA 2E2HA 1TWAA 3LR8A 2BE5D 2JA5A 2MX8A 1I6VD 1Y1VA 1I50A 4CEIA 1Y1WA 3LR2A 3GTLA 2E2IA 2LYIA 1YNJD 4C2MA 3U44A 1TWHA 3LR6A 2A6HD 1IW7D 4CEHA 3GTQA 4QIWA 2AQLA 2LPIA 1HQMD 2R92A 2NVYA 1R9TA 2B63A 2K3OA 2A68D 2MQAA 3CQZA 2X0OA 2O5JD 2LPJA 3GTJA 2A6ED 3GTKA 2JA6A 2K3NA 4CEJA 1TWGA 2LKMB 5IZ2A 4FBSA 2CW0D 2NVXA 2FIOA 2A69D 2FIPA 2X0QA 3LRDA 3U4QA 1WCMA 3H0GA 3GTMA 2N1DB 1ZYRD 2JA7A 1TWCA 1TWFA 1I3QA 2Y0NA 2LTHA 1SMYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPI A;  3LR2 A;  2LPJ A;  3LR6 A;  3LRD A;  2MX9 A;  3LR8 A;  2N3E A;  5IZ2 A;  2LTH A;  4FBS A;  2K3Q A;  2MX8 A; 
#chains in the Genus database with same CATH topology
 2YU9 A;  2MX9 A;  2VK9 A;  2N3E A;  2VUM A;  2K3Q A;  2F5J A;  2X0P A;  1K83 A;  4V2R A;  4BAA A;  2MP0 A;  2R93 A;  3GTG A;  3NZ4 A;  2YII A;  1W27 A;  2EZA A;  3GTP A;  3GTO A;  1T6J A;  2R7Z A;  4C5R A;  4C6G A;  1SFO A;  1YNN D;  3FKI A;  2E2H A;  1TWA A;  3LR8 A;  2EZC A;  2BE5 D;  2JA5 A;  2MX8 A;  1I6V D;  1Y1V A;  1I50 A;  4CEI A;  1Y1W A;  1EZB A;  3LR2 A;  1EZA A;  3GTL A;  2EZB A;  3EZA A;  2E2I A;  2LYI A;  1YNJ D;  4C2M A;  3U44 A;  1TWH A;  3LR6 A;  2A6H D;  1IW7 D;  3EZB A;  4CEH A;  3GTQ A;  4QIW A;  2AQL A;  2LPI A;  1HQM D;  2R92 A;  2NVY A;  2HWG A;  1R9T A;  2B63 A;  2K3O A;  2A68 D;  2MQA A;  3CQZ A;  2X0O A;  2O5J D;  2LPJ A;  3GTJ A;  4C5U A;  2A6E D;  3GTK A;  2JA6 A;  2K3N A;  1Y2M A;  4CEJ A;  1TWG A;  4V2Q A;  1T6P A;  2LKM B;  5IZ2 A;  4FBS A;  2CW0 D;  2NVX A;  2HRO A;  2FIO A;  1ZYM A;  2A69 D;  2FIP A;  4C5S A;  2X0Q A;  3LRD A;  3U4Q A;  3EZE A;  1WCM A;  3H0G A;  4CQ5 A;  2N1D B;  3GTM A;  1ZYR D;  4BAB A;  2JA7 A;  1TWC A;  1TWF A;  1I3Q A;  2Y0N A;  2LTH A;  1SMY D; 
#chains in the Genus database with same CATH homology
 2YU9 A;  2MX9 A;  2VK9 A;  2N3E A;  2VUM A;  2K3Q A;  2F5J A;  2X0P A;  1K83 A;  2R93 A;  3GTG A;  3GTP A;  3GTO A;  2R7Z A;  1SFO A;  1YNN D;  3FKI A;  2E2H A;  1TWA A;  3LR8 A;  2BE5 D;  2JA5 A;  2MX8 A;  1I6V D;  1Y1V A;  1I50 A;  4CEI A;  1Y1W A;  3LR2 A;  3GTL A;  2E2I A;  2LYI A;  1YNJ D;  4C2M A;  3U44 A;  1TWH A;  3LR6 A;  2A6H D;  1IW7 D;  4CEH A;  3GTQ A;  4QIW A;  2AQL A;  2LPI A;  1HQM D;  2R92 A;  2NVY A;  1R9T A;  2B63 A;  2K3O A;  2A68 D;  2MQA A;  3CQZ A;  2X0O A;  2O5J D;  2LPJ A;  3GTJ A;  2A6E D;  3GTK A;  2JA6 A;  2K3N A;  4CEJ A;  1TWG A;  2LKM B;  5IZ2 A;  4FBS A;  2CW0 D;  2NVX A;  2FIO A;  2A69 D;  2FIP A;  2X0Q A;  3LRD A;  3U4Q A;  1WCM A;  3H0G A;  3GTM A;  2N1D B;  1ZYR D;  2JA7 A;  1TWC A;  1TWF A;  1I3Q A;  2Y0N A;  2LTH A;  1SMY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...