3LR6A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
125
structure length
125
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
molecule keywords Major ampullate spidroin 1
source organism Euprosthenops australis
molecule tags Structural protein
total genus 53
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr6A01
2LPJA 2LTHA 3LR2A 5IZ2A 3LR6A 2MX9A 2N3EA 3LRDA 2K3QA 3LR8A 2MX8A 2LPIA 4FBSA
chains in the Genus database with same CATH superfamily
4C5UA 4CEJA 2LPJA 1TWHA 2FIPA 4QIWA 2MX8A 2CW0D 4CEHA 2A6ED 2N1DB 3U44A 3GTOA 1HQMD 2A6HD 1I50A 2B63A 2LYIA 2R92A 1IW7D 4BABA 2HROA 1T6JA 2EZCA 5IZ2A 3H0GA 3LR2A 2FIOA 3LRDA 2N3EA 2JA7A 4V2QA 3GTQA 4FBSA 2JA6A 4C5RA 1TWAA 3NZ4A 2LTHA 1Y1WA 1SFOA 3GTMA 2YIIA 1TWFA 4C2MA 2MP0A 2K3NA 2LPIA 1I6VD 3FKIA 1Y1VA 3LR8A 3U4QA 1EZBA 4CEIA 2EZAA 2HWGA 1K83A 1ZYRD 2X0PA 3GTPA 2VUMA 4BAAA 2MX9A 4C6GA 4C5SA 2R7ZA 4V2RA 2NVXA 2AQLA 1ZYMA 1I3QA 3LR6A 2A68D 2A69D 1W27A 2F5JA 2O5JD 2X0OA 2NVYA 3CQZA 3GTKA 2BE5D 3EZEA 3GTLA 2K3QA 2E2IA 1YNND 1SMYD 2VK9A 1TWGA 3GTGA 1YNJD 1R9TA 3GTJA 2JA5A 2E2HA 2EZBA 2YU9A 2R93A 3EZBA 2X0QA 4CQ5A 2MQAA 1WCMA 2K3OA 1EZAA 2Y0NA 3EZAA 1T6PA 1TWCA 2LKMB 1Y2MA
chains in the Genus database with same CATH topology
4CEJA 2LPJA 1TWHA 2FIPA 4QIWA 2MX8A 2CW0D 4CEHA 2A6ED 2N1DB 3U44A 3GTOA 1HQMD 2A6HD 1I50A 2B63A 2LYIA 2R92A 1IW7D 5IZ2A 3H0GA 3LR2A 2FIOA 3LRDA 2N3EA 2JA7A 3GTQA 4FBSA 2JA6A 1TWAA 2LTHA 1Y1WA 1SFOA 3GTMA 1TWFA 4C2MA 2K3NA 2LPIA 1I6VD 3FKIA 1Y1VA 3LR8A 3U4QA 4CEIA 1K83A 1ZYRD 2X0PA 3GTPA 2VUMA 2MX9A 2R7ZA 2NVXA 2AQLA 1I3QA 3LR6A 2A68D 2A69D 2F5JA 2O5JD 2X0OA 2NVYA 3CQZA 3GTKA 2BE5D 3GTLA 2K3QA 2E2IA 1YNND 1SMYD 2VK9A 1TWGA 3GTGA 1YNJD 1R9TA 3GTJA 2JA5A 2E2HA 2YU9A 2R93A 2X0QA 2MQAA 1WCMA 2K3OA 2Y0NA 1TWCA 2LKMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPJ A;  2LTH A;  3LR2 A;  5IZ2 A;  3LR6 A;  2MX9 A;  2N3E A;  3LRD A;  2K3Q A;  3LR8 A;  2MX8 A;  2LPI A;  4FBS A; 
#chains in the Genus database with same CATH topology
 4C5U A;  4CEJ A;  2LPJ A;  1TWH A;  2FIP A;  4QIW A;  2MX8 A;  2CW0 D;  4CEH A;  2A6E D;  2N1D B;  3U44 A;  3GTO A;  1HQM D;  2A6H D;  1I50 A;  2B63 A;  2LYI A;  2R92 A;  1IW7 D;  4BAB A;  2HRO A;  1T6J A;  2EZC A;  5IZ2 A;  3H0G A;  3LR2 A;  2FIO A;  3LRD A;  2N3E A;  2JA7 A;  4V2Q A;  3GTQ A;  4FBS A;  2JA6 A;  4C5R A;  1TWA A;  3NZ4 A;  2LTH A;  1Y1W A;  1SFO A;  3GTM A;  2YII A;  1TWF A;  4C2M A;  2MP0 A;  2K3N A;  2LPI A;  1I6V D;  3FKI A;  1Y1V A;  3LR8 A;  3U4Q A;  1EZB A;  4CEI A;  2EZA A;  2HWG A;  1K83 A;  1ZYR D;  2X0P A;  3GTP A;  2VUM A;  4BAA A;  2MX9 A;  4C6G A;  4C5S A;  2R7Z A;  4V2R A;  2NVX A;  2AQL A;  1ZYM A;  1I3Q A;  3LR6 A;  2A68 D;  2A69 D;  1W27 A;  2F5J A;  2O5J D;  2X0O A;  2NVY A;  3CQZ A;  3GTK A;  2BE5 D;  3EZE A;  3GTL A;  2K3Q A;  2E2I A;  1YNN D;  1SMY D;  2VK9 A;  1TWG A;  3GTG A;  1YNJ D;  1R9T A;  3GTJ A;  2JA5 A;  2E2H A;  2EZB A;  2YU9 A;  2R93 A;  3EZB A;  2X0Q A;  4CQ5 A;  2MQA A;  1WCM A;  2K3O A;  1EZA A;  2Y0N A;  3EZA A;  1T6P A;  1TWC A;  2LKM B;  1Y2M A; 
#chains in the Genus database with same CATH homology
 4CEJ A;  2LPJ A;  1TWH A;  2FIP A;  4QIW A;  2MX8 A;  2CW0 D;  4CEH A;  2A6E D;  2N1D B;  3U44 A;  3GTO A;  1HQM D;  2A6H D;  1I50 A;  2B63 A;  2LYI A;  2R92 A;  1IW7 D;  5IZ2 A;  3H0G A;  3LR2 A;  2FIO A;  3LRD A;  2N3E A;  2JA7 A;  3GTQ A;  4FBS A;  2JA6 A;  1TWA A;  2LTH A;  1Y1W A;  1SFO A;  3GTM A;  1TWF A;  4C2M A;  2K3N A;  2LPI A;  1I6V D;  3FKI A;  1Y1V A;  3LR8 A;  3U4Q A;  4CEI A;  1K83 A;  1ZYR D;  2X0P A;  3GTP A;  2VUM A;  2MX9 A;  2R7Z A;  2NVX A;  2AQL A;  1I3Q A;  3LR6 A;  2A68 D;  2A69 D;  2F5J A;  2O5J D;  2X0O A;  2NVY A;  3CQZ A;  3GTK A;  2BE5 D;  3GTL A;  2K3Q A;  2E2I A;  1YNN D;  1SMY D;  2VK9 A;  1TWG A;  3GTG A;  1YNJ D;  1R9T A;  3GTJ A;  2JA5 A;  2E2H A;  2YU9 A;  2R93 A;  2X0Q A;  2MQA A;  1WCM A;  2K3O A;  2Y0N A;  1TWC A;  2LKM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...