3LR6A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
125
structure length
125
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
total genus 53
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr6A01
2LPIA 2N3EA 3LR6A 3LRDA 3LR2A 4FBSA 2LPJA 2K3QA 2MX9A 2LTHA 2MX8A 5IZ2A 3LR8A
chains in the Genus database with same CATH superfamily
1T6JA 1TWHA 2K3OA 1Y1VA 2MP0A 4CEHA 3EZAA 2LYIA 5IZ2A 2N1DB 4CEIA 1K83A 2R7ZA 2N3EA 3U44A 2K3QA 2X0PA 2MX8A 2HROA 1WCMA 1TWGA 1TWCA 1YNND 2EZAA 1EZBA 1Y2MA 2HWGA 3U4QA 3LR6A 4FBSA 2YU9A 1Y1WA 2VUMA 1ZYMA 2FIPA 1YNJD 2NVXA 2B63A 4BAAA 2MX9A 2LTHA 2E2IA 2JA7A 2K3NA 3FKIA 3EZBA 2LPJA 2A6ED 2JA6A 4BABA 1W27A 1HQMD 4C6GA 1SMYD 3CQZA 3GTKA 3GTQA 3GTLA 1I6VD 1I50A 2LKMB 2EZCA 3LRDA 3GTMA 1IW7D 4CEJA 1TWAA 2JA5A 4C5SA 2NVYA 2Y0NA 2VK9A 2A69D 4CQ5A 3GTOA 4QIWA 1TWFA 3NZ4A 3GTJA 2YIIA 2A6HD 2AQLA 2LPIA 2MQAA 2X0QA 2BE5D 3GTGA 2X0OA 4C5UA 2E2HA 2R93A 2EZBA 4C2MA 3H0GA 3LR2A 1T6PA 1I3QA 4V2RA 2R92A 1EZAA 2FIOA 3LR8A 1R9TA 2A68D 2O5JD 1SFOA 4V2QA 3EZEA 2CW0D 3GTPA 2F5JA 1ZYRD 4C5RA
chains in the Genus database with same CATH topology
1TWHA 2K3OA 1Y1VA 4CEHA 2LYIA 5IZ2A 2N1DB 4CEIA 1K83A 2R7ZA 2N3EA 3U44A 2K3QA 2X0PA 2MX8A 1WCMA 1TWGA 1TWCA 1YNND 3U4QA 3LR6A 4FBSA 2YU9A 1Y1WA 2VUMA 2FIPA 1YNJD 2NVXA 2B63A 2MX9A 2LTHA 2E2IA 2JA7A 2K3NA 3FKIA 2LPJA 2A6ED 2JA6A 1HQMD 1SMYD 3CQZA 3GTKA 3GTQA 3GTLA 1I6VD 1I50A 2LKMB 3LRDA 3GTMA 1IW7D 4CEJA 1TWAA 2JA5A 2NVYA 2Y0NA 2VK9A 3GTOA 4QIWA 1TWFA 3GTJA 2A6HD 2AQLA 2LPIA 2MQAA 2X0QA 2BE5D 3GTGA 2X0OA 2E2HA 2R93A 4C2MA 3H0GA 3LR2A 1I3QA 2R92A 2FIOA 3LR8A 1R9TA 2A68D 2O5JD 1SFOA 3GTPA 2CW0D 2F5JA 1ZYRD 2A69D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPI A;  2N3E A;  3LR6 A;  3LRD A;  3LR2 A;  4FBS A;  2LPJ A;  2K3Q A;  2MX9 A;  2LTH A;  2MX8 A;  5IZ2 A;  3LR8 A; 
#chains in the Genus database with same CATH topology
 1T6J A;  1TWH A;  2K3O A;  1Y1V A;  2MP0 A;  4CEH A;  3EZA A;  2LYI A;  5IZ2 A;  2N1D B;  4CEI A;  1K83 A;  2R7Z A;  2N3E A;  3U44 A;  2K3Q A;  2X0P A;  2MX8 A;  2HRO A;  1WCM A;  1TWG A;  1TWC A;  1YNN D;  2EZA A;  1EZB A;  1Y2M A;  2HWG A;  3U4Q A;  3LR6 A;  4FBS A;  2YU9 A;  1Y1W A;  2VUM A;  1ZYM A;  2FIP A;  1YNJ D;  2NVX A;  2B63 A;  4BAA A;  2MX9 A;  2LTH A;  2E2I A;  2JA7 A;  2K3N A;  3FKI A;  3EZB A;  2LPJ A;  2A6E D;  2JA6 A;  4BAB A;  1W27 A;  1HQM D;  4C6G A;  1SMY D;  3CQZ A;  3GTK A;  3GTQ A;  3GTL A;  1I6V D;  1I50 A;  2LKM B;  2EZC A;  3LRD A;  3GTM A;  1IW7 D;  4CEJ A;  1TWA A;  2JA5 A;  4C5S A;  2NVY A;  2Y0N A;  2VK9 A;  2A69 D;  4CQ5 A;  3GTO A;  4QIW A;  1TWF A;  3NZ4 A;  3GTJ A;  2YII A;  2A6H D;  2AQL A;  2LPI A;  2MQA A;  2X0Q A;  2BE5 D;  3GTG A;  2X0O A;  4C5U A;  2E2H A;  2R93 A;  2EZB A;  4C2M A;  3H0G A;  3LR2 A;  1T6P A;  1I3Q A;  4V2R A;  2R92 A;  1EZA A;  2FIO A;  3LR8 A;  1R9T A;  2A68 D;  2O5J D;  1SFO A;  4V2Q A;  3EZE A;  2CW0 D;  3GTP A;  2F5J A;  1ZYR D;  4C5R A; 
#chains in the Genus database with same CATH homology
 1TWH A;  2K3O A;  1Y1V A;  4CEH A;  2LYI A;  5IZ2 A;  2N1D B;  4CEI A;  1K83 A;  2R7Z A;  2N3E A;  3U44 A;  2K3Q A;  2X0P A;  2MX8 A;  1WCM A;  1TWG A;  1TWC A;  1YNN D;  3U4Q A;  3LR6 A;  4FBS A;  2YU9 A;  1Y1W A;  2VUM A;  2FIP A;  1YNJ D;  2NVX A;  2B63 A;  2MX9 A;  2LTH A;  2E2I A;  2JA7 A;  2K3N A;  3FKI A;  2LPJ A;  2A6E D;  2JA6 A;  1HQM D;  1SMY D;  3CQZ A;  3GTK A;  3GTQ A;  3GTL A;  1I6V D;  1I50 A;  2LKM B;  3LRD A;  3GTM A;  1IW7 D;  4CEJ A;  1TWA A;  2JA5 A;  2NVY A;  2Y0N A;  2VK9 A;  3GTO A;  4QIW A;  1TWF A;  3GTJ A;  2A6H D;  2AQL A;  2LPI A;  2MQA A;  2X0Q A;  2BE5 D;  3GTG A;  2X0O A;  2E2H A;  2R93 A;  4C2M A;  3H0G A;  3LR2 A;  1I3Q A;  2R92 A;  2FIO A;  3LR8 A;  1R9T A;  2A68 D;  2O5J D;  1SFO A;  3GTP A;  2CW0 D;  2F5J A;  1ZYR D;  2A69 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...