3LR6A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
125
structure length
125
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 53
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr6A01
2LPIA 3LR8A 2LPJA 2K3QA 5IZ2A 2LTHA 3LR2A 2MX9A 4FBSA 3LR6A 3LRDA 2N3EA 2MX8A
chains in the Genus database with same CATH superfamily
2AQLA 3GTLA 1YNJD 1Y1VA 2LYIA 2VK9A 3NZ4A 3LR2A 2MX9A 1TWHA 2LKMB 3GTPA 1TWGA 4CQ5A 3FKIA 3LRDA 1EZBA 4V2QA 2A6HD 1R9TA 3U44A 4BAAA 2X0PA 1T6JA 1Y2MA 4BABA 2A68D 4C2MA 2EZBA 2K3OA 2YU9A 2A6ED 3GTOA 3GTQA 1SFOA 2R92A 1Y1WA 3GTGA 1W27A 3EZEA 1HQMD 2A69D 2B63A 1K83A 4C5RA 2BE5D 1T6PA 2X0QA 1ZYMA 2O5JD 3GTKA 4FBSA 2HROA 2N3EA 2NVYA 2LPIA 2VUMA 2EZCA 3H0GA 2K3NA 2EZAA 4QIWA 2HWGA 2LPJA 1I6VD 1TWFA 2K3QA 2MX8A 2N1DB 1IW7D 2Y0NA 2LTHA 2JA6A 1TWCA 2X0OA 4V2RA 4CEHA 2R7ZA 4C6GA 1WCMA 3GTMA 2F5JA 3EZBA 2JA7A 2E2IA 1YNND 3EZAA 2MQAA 2FIOA 3GTJA 2NVXA 4C5UA 1EZAA 3CQZA 2FIPA 2YIIA 1ZYRD 1I50A 1TWAA 2MP0A 3LR6A 2CW0D 3LR8A 4CEJA 1I3QA 4CEIA 4C5SA 1SMYD 2E2HA 3U4QA 5IZ2A 2R93A 2JA5A
chains in the Genus database with same CATH topology
2AQLA 3GTLA 1YNJD 1Y1VA 2LYIA 2VK9A 3LR2A 2MX9A 1TWHA 2LKMB 3GTPA 1TWGA 3FKIA 3LRDA 2A6HD 1R9TA 3U44A 2X0PA 2A68D 4C2MA 3GTOA 2K3OA 2YU9A 2A6ED 3GTQA 1SFOA 2R92A 1Y1WA 3GTGA 1HQMD 2A69D 2B63A 1K83A 2BE5D 2X0QA 2O5JD 3GTKA 4FBSA 2N3EA 2NVYA 2LPIA 2VUMA 3H0GA 2K3NA 4QIWA 2LPJA 1I6VD 1TWFA 2K3QA 2MX8A 2N1DB 1IW7D 2Y0NA 2LTHA 2JA6A 1TWCA 2X0OA 4CEHA 2R7ZA 1WCMA 3GTMA 2F5JA 2JA7A 2E2IA 1YNND 2MQAA 2FIOA 3GTJA 2NVXA 3CQZA 2FIPA 1ZYRD 1I50A 1TWAA 3LR6A 2CW0D 3LR8A 4CEJA 1I3QA 4CEIA 1SMYD 2E2HA 3U4QA 5IZ2A 2R93A 2JA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPI A;  3LR8 A;  2LPJ A;  2K3Q A;  5IZ2 A;  2LTH A;  3LR2 A;  2MX9 A;  4FBS A;  3LR6 A;  3LRD A;  2N3E A;  2MX8 A; 
#chains in the Genus database with same CATH topology
 2AQL A;  3GTL A;  1YNJ D;  1Y1V A;  2LYI A;  2VK9 A;  3NZ4 A;  3LR2 A;  2MX9 A;  1TWH A;  2LKM B;  3GTP A;  1TWG A;  4CQ5 A;  3FKI A;  3LRD A;  1EZB A;  4V2Q A;  2A6H D;  1R9T A;  3U44 A;  4BAA A;  2X0P A;  1T6J A;  1Y2M A;  4BAB A;  2A68 D;  4C2M A;  2EZB A;  2K3O A;  2YU9 A;  2A6E D;  3GTO A;  3GTQ A;  1SFO A;  2R92 A;  1Y1W A;  3GTG A;  1W27 A;  3EZE A;  1HQM D;  2A69 D;  2B63 A;  1K83 A;  4C5R A;  2BE5 D;  1T6P A;  2X0Q A;  1ZYM A;  2O5J D;  3GTK A;  4FBS A;  2HRO A;  2N3E A;  2NVY A;  2LPI A;  2VUM A;  2EZC A;  3H0G A;  2K3N A;  2EZA A;  4QIW A;  2HWG A;  2LPJ A;  1I6V D;  1TWF A;  2K3Q A;  2MX8 A;  2N1D B;  1IW7 D;  2Y0N A;  2LTH A;  2JA6 A;  1TWC A;  2X0O A;  4V2R A;  4CEH A;  2R7Z A;  4C6G A;  1WCM A;  3GTM A;  2F5J A;  3EZB A;  2JA7 A;  2E2I A;  1YNN D;  3EZA A;  2MQA A;  2FIO A;  3GTJ A;  2NVX A;  4C5U A;  1EZA A;  3CQZ A;  2FIP A;  2YII A;  1ZYR D;  1I50 A;  1TWA A;  2MP0 A;  3LR6 A;  2CW0 D;  3LR8 A;  4CEJ A;  1I3Q A;  4CEI A;  4C5S A;  1SMY D;  2E2H A;  3U4Q A;  5IZ2 A;  2R93 A;  2JA5 A; 
#chains in the Genus database with same CATH homology
 2AQL A;  3GTL A;  1YNJ D;  1Y1V A;  2LYI A;  2VK9 A;  3LR2 A;  2MX9 A;  1TWH A;  2LKM B;  3GTP A;  1TWG A;  3FKI A;  3LRD A;  2A6H D;  1R9T A;  3U44 A;  2X0P A;  2A68 D;  4C2M A;  3GTO A;  2K3O A;  2YU9 A;  2A6E D;  3GTQ A;  1SFO A;  2R92 A;  1Y1W A;  3GTG A;  1HQM D;  2A69 D;  2B63 A;  1K83 A;  2BE5 D;  2X0Q A;  2O5J D;  3GTK A;  4FBS A;  2N3E A;  2NVY A;  2LPI A;  2VUM A;  3H0G A;  2K3N A;  4QIW A;  2LPJ A;  1I6V D;  1TWF A;  2K3Q A;  2MX8 A;  2N1D B;  1IW7 D;  2Y0N A;  2LTH A;  2JA6 A;  1TWC A;  2X0O A;  4CEH A;  2R7Z A;  1WCM A;  3GTM A;  2F5J A;  2JA7 A;  2E2I A;  1YNN D;  2MQA A;  2FIO A;  3GTJ A;  2NVX A;  3CQZ A;  2FIP A;  1ZYR D;  1I50 A;  1TWA A;  3LR6 A;  2CW0 D;  3LR8 A;  4CEJ A;  1I3Q A;  4CEI A;  1SMY D;  2E2H A;  3U4Q A;  5IZ2 A;  2R93 A;  2JA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...