3LRDA

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASQEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 54
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lrdA01
2LPJA 2N3EA 2LTHA 4FBSA 3LRDA 3LR6A 3LR8A 5IZ2A 2MX8A 2LPIA 2MX9A 2K3QA 3LR2A
chains in the Genus database with same CATH superfamily
2NVXA 3GTGA 3EZEA 2Y0NA 1K83A 1EZAA 1TWAA 2E2HA 2X0OA 1TWGA 4C6GA 2HROA 3EZBA 4CEHA 2MP0A 3EZAA 2B63A 3CQZA 1Y2MA 4BABA 2LPJA 2LKMB 2N1DB 1ZYRD 3LR6A 5IZ2A 1SFOA 1WCMA 3GTQA 1IW7D 4QIWA 2A69D 1I3QA 3GTLA 1Y1VA 3NZ4A 4CEIA 2X0QA 1I50A 1ZYMA 2A68D 2X0PA 1I6VD 2F5JA 1YNJD 3U4QA 3LRDA 2R92A 1R9TA 2MQAA 2AQLA 3LR2A 2K3OA 4BAAA 3H0GA 4FBSA 1TWFA 2HWGA 2MX8A 4CQ5A 2MX9A 1YNND 2A6HD 2CW0D 4CEJA 2VK9A 3FKIA 2EZAA 2LTHA 3GTMA 1EZBA 4C5SA 2LYIA 2FIOA 1W27A 2JA5A 1TWCA 3GTOA 2R93A 2K3QA 2FIPA 2LPIA 2N3EA 2EZBA 2R7ZA 3U44A 4C5UA 3GTJA 4V2QA 2VUMA 1T6JA 2YU9A 1T6PA 3GTPA 2BE5D 2NVYA 2YIIA 1Y1WA 1HQMD 1SMYD 3GTKA 2JA6A 2O5JD 4C2MA 2JA7A 2A6ED 2E2IA 2EZCA 4V2RA 3LR8A 1TWHA 2K3NA 4C5RA
chains in the Genus database with same CATH topology
2NVXA 3GTGA 2Y0NA 1K83A 1TWAA 2E2HA 2X0OA 1TWGA 4CEHA 2B63A 3CQZA 2LPJA 2LKMB 2N1DB 1SFOA 1ZYRD 3LR6A 5IZ2A 1WCMA 3GTQA 1IW7D 4QIWA 2A69D 1I3QA 3GTLA 1Y1VA 4CEIA 2X0QA 1I50A 2A68D 2X0PA 1I6VD 2F5JA 1YNJD 3U4QA 3LRDA 2R92A 1R9TA 2MQAA 2AQLA 3LR2A 2K3OA 3H0GA 4FBSA 1TWFA 2MX8A 2MX9A 1YNND 2A6HD 2CW0D 4CEJA 2VK9A 3FKIA 2LTHA 3GTMA 2LYIA 2FIOA 2JA5A 1TWCA 3GTOA 2R93A 2K3QA 2FIPA 2LPIA 2N3EA 2R7ZA 3U44A 3GTJA 2VUMA 2YU9A 3GTPA 2BE5D 2NVYA 1Y1WA 1HQMD 1SMYD 3GTKA 2JA6A 2O5JD 4C2MA 2JA7A 2A6ED 2E2IA 3LR8A 1TWHA 2K3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPJ A;  2N3E A;  2LTH A;  4FBS A;  3LRD A;  3LR6 A;  3LR8 A;  5IZ2 A;  2MX8 A;  2LPI A;  2MX9 A;  2K3Q A;  3LR2 A; 
#chains in the Genus database with same CATH topology
 2NVX A;  3GTG A;  3EZE A;  2Y0N A;  1K83 A;  1EZA A;  1TWA A;  2E2H A;  2X0O A;  1TWG A;  4C6G A;  2HRO A;  3EZB A;  4CEH A;  2MP0 A;  3EZA A;  2B63 A;  3CQZ A;  1Y2M A;  4BAB A;  2LPJ A;  2LKM B;  2N1D B;  1ZYR D;  3LR6 A;  5IZ2 A;  1SFO A;  1WCM A;  3GTQ A;  1IW7 D;  4QIW A;  2A69 D;  1I3Q A;  3GTL A;  1Y1V A;  3NZ4 A;  4CEI A;  2X0Q A;  1I50 A;  1ZYM A;  2A68 D;  2X0P A;  1I6V D;  2F5J A;  1YNJ D;  3U4Q A;  3LRD A;  2R92 A;  1R9T A;  2MQA A;  2AQL A;  3LR2 A;  2K3O A;  4BAA A;  3H0G A;  4FBS A;  1TWF A;  2HWG A;  2MX8 A;  4CQ5 A;  2MX9 A;  1YNN D;  2A6H D;  2CW0 D;  4CEJ A;  2VK9 A;  3FKI A;  2EZA A;  2LTH A;  3GTM A;  1EZB A;  4C5S A;  2LYI A;  2FIO A;  1W27 A;  2JA5 A;  1TWC A;  3GTO A;  2R93 A;  2K3Q A;  2FIP A;  2LPI A;  2N3E A;  2EZB A;  2R7Z A;  3U44 A;  4C5U A;  3GTJ A;  4V2Q A;  2VUM A;  1T6J A;  2YU9 A;  1T6P A;  3GTP A;  2BE5 D;  2NVY A;  2YII A;  1Y1W A;  1HQM D;  1SMY D;  3GTK A;  2JA6 A;  2O5J D;  4C2M A;  2JA7 A;  2A6E D;  2E2I A;  2EZC A;  4V2R A;  3LR8 A;  1TWH A;  2K3N A;  4C5R A; 
#chains in the Genus database with same CATH homology
 2NVX A;  3GTG A;  2Y0N A;  1K83 A;  1TWA A;  2E2H A;  2X0O A;  1TWG A;  4CEH A;  2B63 A;  3CQZ A;  2LPJ A;  2LKM B;  2N1D B;  1SFO A;  1ZYR D;  3LR6 A;  5IZ2 A;  1WCM A;  3GTQ A;  1IW7 D;  4QIW A;  2A69 D;  1I3Q A;  3GTL A;  1Y1V A;  4CEI A;  2X0Q A;  1I50 A;  2A68 D;  2X0P A;  1I6V D;  2F5J A;  1YNJ D;  3U4Q A;  3LRD A;  2R92 A;  1R9T A;  2MQA A;  2AQL A;  3LR2 A;  2K3O A;  3H0G A;  4FBS A;  1TWF A;  2MX8 A;  2MX9 A;  1YNN D;  2A6H D;  2CW0 D;  4CEJ A;  2VK9 A;  3FKI A;  2LTH A;  3GTM A;  2LYI A;  2FIO A;  2JA5 A;  1TWC A;  3GTO A;  2R93 A;  2K3Q A;  2FIP A;  2LPI A;  2N3E A;  2R7Z A;  3U44 A;  3GTJ A;  2VUM A;  2YU9 A;  3GTP A;  2BE5 D;  2NVY A;  1Y1W A;  1HQM D;  1SMY D;  3GTK A;  2JA6 A;  2O5J D;  4C2M A;  2JA7 A;  2A6E D;  2E2I A;  3LR8 A;  1TWH A;  2K3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...