3LRDA

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASQEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 54
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lrdA01
2K3QA 2MX8A 4FBSA 5IZ2A 2N3EA 2LPIA 3LR8A 2LPJA 3LRDA 3LR6A 3LR2A 2MX9A 2LTHA
chains in the Genus database with same CATH superfamily
1TWAA 1ZYRD 3NZ4A 1Y1VA 3U4QA 2X0QA 1K83A 3U44A 3GTGA 4CEIA 2E2HA 1I6VD 1EZBA 1TWHA 2K3QA 4C5UA 2B63A 3GTQA 3LR2A 2LKMB 4C5RA 1HQMD 4CEJA 2LYIA 2NVYA 2LPIA 4C6GA 2VUMA 3H0GA 2N1DB 1ZYMA 1T6JA 1EZAA 1W27A 3LR6A 4C2MA 3GTOA 3GTMA 2R93A 4V2RA 4BAAA 2YU9A 1T6PA 2FIOA 2EZCA 2E2IA 1TWFA 2N3EA 3GTKA 2HWGA 3LRDA 1IW7D 1YNND 2LTHA 2MX8A 2FIPA 2K3NA 4V2QA 2X0OA 1Y2MA 2MQAA 4QIWA 2MP0A 1WCMA 2LPJA 1SFOA 2MX9A 3GTPA 2JA5A 2A69D 1YNJD 3GTLA 3GTJA 2BE5D 4CQ5A 2A6HD 2K3OA 3EZAA 2YIIA 4C5SA 5IZ2A 1TWCA 2AQLA 1SMYD 2CW0D 1Y1WA 1I50A 2F5JA 2NVXA 4FBSA 2A6ED 3CQZA 3LR8A 2X0PA 4BABA 2R7ZA 2JA7A 2O5JD 3EZBA 3FKIA 3EZEA 2Y0NA 1R9TA 1TWGA 4CEHA 2R92A 1I3QA 2JA6A 2A68D 2EZAA 2HROA 2VK9A 2EZBA
chains in the Genus database with same CATH topology
1TWAA 1ZYRD 1Y1VA 3U4QA 2X0QA 1K83A 3U44A 3GTGA 4CEIA 2E2HA 1I6VD 1TWHA 2K3QA 2B63A 3GTQA 3LR2A 2LKMB 1HQMD 4CEJA 2LYIA 2NVYA 2LPIA 2VUMA 3H0GA 2N1DB 3LR6A 4C2MA 3GTOA 3GTMA 2R93A 2YU9A 2FIOA 2E2IA 1TWFA 2N3EA 3GTKA 3LRDA 1IW7D 1YNND 2LTHA 2MX8A 2FIPA 2K3NA 2X0OA 2MQAA 4QIWA 1WCMA 2LPJA 1SFOA 2MX9A 3GTPA 2JA5A 2A69D 1YNJD 3GTLA 3GTJA 2BE5D 2A6HD 2K3OA 5IZ2A 1TWCA 2AQLA 1SMYD 2CW0D 1Y1WA 1I50A 2F5JA 2NVXA 4FBSA 2A6ED 3CQZA 3LR8A 2X0PA 2R7ZA 2JA7A 2O5JD 3FKIA 2Y0NA 1R9TA 1TWGA 4CEHA 2R92A 1I3QA 2JA6A 2A68D 2VK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Q A;  2MX8 A;  4FBS A;  5IZ2 A;  2N3E A;  2LPI A;  3LR8 A;  2LPJ A;  3LRD A;  3LR6 A;  3LR2 A;  2MX9 A;  2LTH A; 
#chains in the Genus database with same CATH topology
 1TWA A;  1ZYR D;  3NZ4 A;  1Y1V A;  3U4Q A;  2X0Q A;  1K83 A;  3U44 A;  3GTG A;  4CEI A;  2E2H A;  1I6V D;  1EZB A;  1TWH A;  2K3Q A;  4C5U A;  2B63 A;  3GTQ A;  3LR2 A;  2LKM B;  4C5R A;  1HQM D;  4CEJ A;  2LYI A;  2NVY A;  2LPI A;  4C6G A;  2VUM A;  3H0G A;  2N1D B;  1ZYM A;  1T6J A;  1EZA A;  1W27 A;  3LR6 A;  4C2M A;  3GTO A;  3GTM A;  2R93 A;  4V2R A;  4BAA A;  2YU9 A;  1T6P A;  2FIO A;  2EZC A;  2E2I A;  1TWF A;  2N3E A;  3GTK A;  2HWG A;  3LRD A;  1IW7 D;  1YNN D;  2LTH A;  2MX8 A;  2FIP A;  2K3N A;  4V2Q A;  2X0O A;  1Y2M A;  2MQA A;  4QIW A;  2MP0 A;  1WCM A;  2LPJ A;  1SFO A;  2MX9 A;  3GTP A;  2JA5 A;  2A69 D;  1YNJ D;  3GTL A;  3GTJ A;  2BE5 D;  4CQ5 A;  2A6H D;  2K3O A;  3EZA A;  2YII A;  4C5S A;  5IZ2 A;  1TWC A;  2AQL A;  1SMY D;  2CW0 D;  1Y1W A;  1I50 A;  2F5J A;  2NVX A;  4FBS A;  2A6E D;  3CQZ A;  3LR8 A;  2X0P A;  4BAB A;  2R7Z A;  2JA7 A;  2O5J D;  3EZB A;  3FKI A;  3EZE A;  2Y0N A;  1R9T A;  1TWG A;  4CEH A;  2R92 A;  1I3Q A;  2JA6 A;  2A68 D;  2EZA A;  2HRO A;  2VK9 A;  2EZB A; 
#chains in the Genus database with same CATH homology
 1TWA A;  1ZYR D;  1Y1V A;  3U4Q A;  2X0Q A;  1K83 A;  3U44 A;  3GTG A;  4CEI A;  2E2H A;  1I6V D;  1TWH A;  2K3Q A;  2B63 A;  3GTQ A;  3LR2 A;  2LKM B;  1HQM D;  4CEJ A;  2LYI A;  2NVY A;  2LPI A;  2VUM A;  3H0G A;  2N1D B;  3LR6 A;  4C2M A;  3GTO A;  3GTM A;  2R93 A;  2YU9 A;  2FIO A;  2E2I A;  1TWF A;  2N3E A;  3GTK A;  3LRD A;  1IW7 D;  1YNN D;  2LTH A;  2MX8 A;  2FIP A;  2K3N A;  2X0O A;  2MQA A;  4QIW A;  1WCM A;  2LPJ A;  1SFO A;  2MX9 A;  3GTP A;  2JA5 A;  2A69 D;  1YNJ D;  3GTL A;  3GTJ A;  2BE5 D;  2A6H D;  2K3O A;  5IZ2 A;  1TWC A;  2AQL A;  1SMY D;  2CW0 D;  1Y1W A;  1I50 A;  2F5J A;  2NVX A;  4FBS A;  2A6E D;  3CQZ A;  3LR8 A;  2X0P A;  2R7Z A;  2JA7 A;  2O5J D;  3FKI A;  2Y0N A;  1R9T A;  1TWG A;  4CEH A;  2R92 A;  1I3Q A;  2JA6 A;  2A68 D;  2VK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...