3LRDA

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASQEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
total genus 54
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lrdA01
3LR8A 2K3QA 3LR2A 4FBSA 2MX9A 2LTHA 2LPIA 3LRDA 3LR6A 5IZ2A 2N3EA 2MX8A 2LPJA
chains in the Genus database with same CATH superfamily
1K83A 2VUMA 2F5JA 1EZAA 1ZYMA 1TWCA 2AQLA 3GTLA 1Y1WA 2N1DB 1TWHA 4CQ5A 2MX8A 3H0GA 2K3NA 1WCMA 1I50A 2A69D 3LR2A 2R92A 1ZYRD 1YNJD 3FKIA 1YNND 3GTMA 1SFOA 1W27A 1T6JA 4BABA 1T6PA 3U4QA 1EZBA 4C2MA 2LKMB 1Y2MA 2X0OA 2E2IA 2LTHA 2YU9A 2N3EA 3CQZA 3U44A 1HQMD 2MX9A 2JA7A 1TWFA 3GTPA 1I6VD 2X0PA 2BE5D 2VK9A 4V2RA 3GTOA 1Y1VA 3GTGA 2K3QA 2CW0D 2X0QA 2NVYA 2HWGA 2E2HA 4BAAA 2FIOA 5IZ2A 2Y0NA 2YIIA 3LR8A 1R9TA 1TWAA 2NVXA 3LRDA 3GTQA 2O5JD 4C6GA 3EZAA 4FBSA 3LR6A 2EZAA 2EZCA 1I3QA 2R7ZA 3NZ4A 2B63A 2LPJA 3EZEA 2FIPA 2EZBA 2LPIA 3GTKA 2JA5A 2LYIA 2MP0A 4CEHA 2K3OA 3GTJA 1SMYD 4C5RA 4QIWA 4CEJA 2R93A 4C5SA 2A6ED 2A6HD 2JA6A 4V2QA 4CEIA 2A68D 1IW7D 2HROA 1TWGA 2MQAA 4C5UA 3EZBA
chains in the Genus database with same CATH topology
1K83A 2VUMA 2F5JA 1TWCA 2AQLA 3GTLA 1Y1WA 2N1DB 1TWHA 2MX8A 3H0GA 2K3NA 1WCMA 1I50A 2A69D 3LR2A 2R92A 1ZYRD 1YNJD 3FKIA 1YNND 3GTMA 1SFOA 3U4QA 4C2MA 2LKMB 2X0OA 2E2IA 2LTHA 2YU9A 2N3EA 3CQZA 3U44A 1HQMD 2MX9A 2JA7A 1TWFA 3GTPA 1I6VD 2X0PA 2BE5D 2VK9A 3GTOA 1Y1VA 3GTGA 2K3QA 2CW0D 2X0QA 2NVYA 2E2HA 2FIOA 5IZ2A 2Y0NA 3LR8A 1R9TA 1TWAA 2NVXA 3LRDA 2O5JD 4FBSA 3LR6A 1I3QA 2R7ZA 2B63A 2LPJA 2FIPA 2LPIA 3GTKA 2JA5A 2LYIA 4CEHA 2K3OA 3GTJA 1SMYD 4QIWA 4CEJA 2R93A 2A6ED 2A6HD 2JA6A 4CEIA 2A68D 1IW7D 1TWGA 2MQAA 3GTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR8 A;  2K3Q A;  3LR2 A;  4FBS A;  2MX9 A;  2LTH A;  2LPI A;  3LRD A;  3LR6 A;  5IZ2 A;  2N3E A;  2MX8 A;  2LPJ A; 
#chains in the Genus database with same CATH topology
 1K83 A;  2VUM A;  2F5J A;  1EZA A;  1ZYM A;  1TWC A;  2AQL A;  3GTL A;  1Y1W A;  2N1D B;  1TWH A;  4CQ5 A;  2MX8 A;  3H0G A;  2K3N A;  1WCM A;  1I50 A;  2A69 D;  3LR2 A;  2R92 A;  1ZYR D;  1YNJ D;  3FKI A;  1YNN D;  3GTM A;  1SFO A;  1W27 A;  1T6J A;  4BAB A;  1T6P A;  3U4Q A;  1EZB A;  4C2M A;  2LKM B;  1Y2M A;  2X0O A;  2E2I A;  2LTH A;  2YU9 A;  2N3E A;  3CQZ A;  3U44 A;  1HQM D;  2MX9 A;  2JA7 A;  1TWF A;  3GTP A;  1I6V D;  2X0P A;  2BE5 D;  2VK9 A;  4V2R A;  3GTO A;  1Y1V A;  3GTG A;  2K3Q A;  2CW0 D;  2X0Q A;  2NVY A;  2HWG A;  2E2H A;  4BAA A;  2FIO A;  5IZ2 A;  2Y0N A;  2YII A;  3LR8 A;  1R9T A;  1TWA A;  2NVX A;  3LRD A;  3GTQ A;  2O5J D;  4C6G A;  3EZA A;  4FBS A;  3LR6 A;  2EZA A;  2EZC A;  1I3Q A;  2R7Z A;  3NZ4 A;  2B63 A;  2LPJ A;  3EZE A;  2FIP A;  2EZB A;  2LPI A;  3GTK A;  2JA5 A;  2LYI A;  2MP0 A;  4CEH A;  2K3O A;  3GTJ A;  1SMY D;  4C5R A;  4QIW A;  4CEJ A;  2R93 A;  4C5S A;  2A6E D;  2A6H D;  2JA6 A;  4V2Q A;  4CEI A;  2A68 D;  1IW7 D;  2HRO A;  1TWG A;  2MQA A;  4C5U A;  3EZB A; 
#chains in the Genus database with same CATH homology
 1K83 A;  2VUM A;  2F5J A;  1TWC A;  2AQL A;  3GTL A;  1Y1W A;  2N1D B;  1TWH A;  2MX8 A;  3H0G A;  2K3N A;  1WCM A;  1I50 A;  2A69 D;  3LR2 A;  2R92 A;  1ZYR D;  1YNJ D;  3FKI A;  1YNN D;  3GTM A;  1SFO A;  3U4Q A;  4C2M A;  2LKM B;  2X0O A;  2E2I A;  2LTH A;  2YU9 A;  2N3E A;  3CQZ A;  3U44 A;  1HQM D;  2MX9 A;  2JA7 A;  1TWF A;  3GTP A;  1I6V D;  2X0P A;  2BE5 D;  2VK9 A;  3GTO A;  1Y1V A;  3GTG A;  2K3Q A;  2CW0 D;  2X0Q A;  2NVY A;  2E2H A;  2FIO A;  5IZ2 A;  2Y0N A;  3LR8 A;  1R9T A;  1TWA A;  2NVX A;  3LRD A;  2O5J D;  4FBS A;  3LR6 A;  1I3Q A;  2R7Z A;  2B63 A;  2LPJ A;  2FIP A;  2LPI A;  3GTK A;  2JA5 A;  2LYI A;  4CEH A;  2K3O A;  3GTJ A;  1SMY D;  4QIW A;  4CEJ A;  2R93 A;  2A6E D;  2A6H D;  2JA6 A;  4CEI A;  2A68 D;  1IW7 D;  1TWG A;  2MQA A;  3GTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...