3LRDA

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASQEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
total genus 54
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lrdA01
3LRDA 2LPIA 5IZ2A 3LR2A 3LR6A 4FBSA 2LPJA 2K3QA 2MX9A 3LR8A 2N3EA 2MX8A 2LTHA
chains in the Genus database with same CATH superfamily
3LRDA 3CQZA 2E2HA 2N1DB 2A68D 3U44A 3EZEA 2HWGA 1K83A 2FIPA 2YU9A 2CW0D 1I3QA 1I50A 3GTOA 1T6PA 1TWHA 2AQLA 4C5UA 2R7ZA 1TWAA 3U4QA 2F5JA 2LTHA 4C5RA 3GTLA 1EZBA 1EZAA 4C2MA 3LR6A 4BAAA 2MX9A 3H0GA 1TWFA 3EZBA 2O5JD 4V2RA 5IZ2A 2K3QA 2X0PA 2HROA 3GTPA 2LPJA 2MX8A 1IW7D 2EZBA 2BE5D 2X0QA 4BABA 2JA7A 4QIWA 2JA5A 1R9TA 3LR8A 1Y1VA 2NVYA 2Y0NA 3EZAA 2A69D 1SFOA 2YIIA 1HQMD 2A6HD 2N3EA 2E2IA 4V2QA 2EZCA 3NZ4A 3LR2A 2K3NA 3FKIA 1SMYD 2X0OA 1YNND 4CQ5A 3GTJA 2R92A 2JA6A 4C5SA 1WCMA 2LKMB 2MQAA 4CEJA 2EZAA 3GTGA 4CEHA 3GTQA 2VK9A 4CEIA 2NVXA 1ZYRD 4FBSA 2MP0A 2K3OA 2LYIA 1I6VD 2VUMA 4C6GA 2A6ED 1Y1WA 1ZYMA 2B63A 2R93A 3GTKA 1Y2MA 1TWCA 1TWGA 2LPIA 1W27A 1T6JA 2FIOA 3GTMA 1YNJD
chains in the Genus database with same CATH topology
3LRDA 3CQZA 2E2HA 2N1DB 2A68D 3U44A 1K83A 2FIPA 2YU9A 2CW0D 1I3QA 1I50A 3GTOA 1TWHA 2AQLA 2R7ZA 1TWAA 3U4QA 2F5JA 2LTHA 3GTLA 4C2MA 3LR6A 2MX9A 3H0GA 1TWFA 2O5JD 5IZ2A 2K3QA 2X0PA 3GTPA 2LPJA 2MX8A 1IW7D 2BE5D 2X0QA 2JA7A 4QIWA 2JA5A 1R9TA 3LR8A 1Y1VA 2NVYA 2Y0NA 2A69D 1SFOA 1HQMD 2A6HD 2N3EA 2E2IA 3LR2A 2K3NA 3FKIA 1SMYD 2X0OA 1YNND 3GTJA 2R92A 2JA6A 1WCMA 2LKMB 2MQAA 4CEJA 3GTGA 4CEHA 3GTQA 2VK9A 4CEIA 2NVXA 1ZYRD 4FBSA 2K3OA 2LYIA 1I6VD 2VUMA 2A6ED 1Y1WA 2B63A 2R93A 3GTKA 1TWCA 1TWGA 2LPIA 2FIOA 3GTMA 1YNJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LRD A;  2LPI A;  5IZ2 A;  3LR2 A;  3LR6 A;  4FBS A;  2LPJ A;  2K3Q A;  2MX9 A;  3LR8 A;  2N3E A;  2MX8 A;  2LTH A; 
#chains in the Genus database with same CATH topology
 3LRD A;  3CQZ A;  2E2H A;  2N1D B;  2A68 D;  3U44 A;  3EZE A;  2HWG A;  1K83 A;  2FIP A;  2YU9 A;  2CW0 D;  1I3Q A;  1I50 A;  3GTO A;  1T6P A;  1TWH A;  2AQL A;  4C5U A;  2R7Z A;  1TWA A;  3U4Q A;  2F5J A;  2LTH A;  4C5R A;  3GTL A;  1EZB A;  1EZA A;  4C2M A;  3LR6 A;  4BAA A;  2MX9 A;  3H0G A;  1TWF A;  3EZB A;  2O5J D;  4V2R A;  5IZ2 A;  2K3Q A;  2X0P A;  2HRO A;  3GTP A;  2LPJ A;  2MX8 A;  1IW7 D;  2EZB A;  2BE5 D;  2X0Q A;  4BAB A;  2JA7 A;  4QIW A;  2JA5 A;  1R9T A;  3LR8 A;  1Y1V A;  2NVY A;  2Y0N A;  3EZA A;  2A69 D;  1SFO A;  2YII A;  1HQM D;  2A6H D;  2N3E A;  2E2I A;  4V2Q A;  2EZC A;  3NZ4 A;  3LR2 A;  2K3N A;  3FKI A;  1SMY D;  2X0O A;  1YNN D;  4CQ5 A;  3GTJ A;  2R92 A;  2JA6 A;  4C5S A;  1WCM A;  2LKM B;  2MQA A;  4CEJ A;  2EZA A;  3GTG A;  4CEH A;  3GTQ A;  2VK9 A;  4CEI A;  2NVX A;  1ZYR D;  4FBS A;  2MP0 A;  2K3O A;  2LYI A;  1I6V D;  2VUM A;  4C6G A;  2A6E D;  1Y1W A;  1ZYM A;  2B63 A;  2R93 A;  3GTK A;  1Y2M A;  1TWC A;  1TWG A;  2LPI A;  1W27 A;  1T6J A;  2FIO A;  3GTM A;  1YNJ D; 
#chains in the Genus database with same CATH homology
 3LRD A;  3CQZ A;  2E2H A;  2N1D B;  2A68 D;  3U44 A;  1K83 A;  2FIP A;  2YU9 A;  2CW0 D;  1I3Q A;  1I50 A;  3GTO A;  1TWH A;  2AQL A;  2R7Z A;  1TWA A;  3U4Q A;  2F5J A;  2LTH A;  3GTL A;  4C2M A;  3LR6 A;  2MX9 A;  3H0G A;  1TWF A;  2O5J D;  5IZ2 A;  2K3Q A;  2X0P A;  3GTP A;  2LPJ A;  2MX8 A;  1IW7 D;  2BE5 D;  2X0Q A;  2JA7 A;  4QIW A;  2JA5 A;  1R9T A;  3LR8 A;  1Y1V A;  2NVY A;  2Y0N A;  2A69 D;  1SFO A;  1HQM D;  2A6H D;  2N3E A;  2E2I A;  3LR2 A;  2K3N A;  3FKI A;  1SMY D;  2X0O A;  1YNN D;  3GTJ A;  2R92 A;  2JA6 A;  1WCM A;  2LKM B;  2MQA A;  4CEJ A;  3GTG A;  4CEH A;  3GTQ A;  2VK9 A;  4CEI A;  2NVX A;  1ZYR D;  4FBS A;  2K3O A;  2LYI A;  1I6V D;  2VUM A;  2A6E D;  1Y1W A;  2B63 A;  2R93 A;  3GTK A;  1TWC A;  1TWG A;  2LPI A;  2FIO A;  3GTM A;  1YNJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...