3LRDA

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
b'HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDNMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASQEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 54
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lrdA01
5IZ2A 4FBSA 2LPJA 3LR6A 2LPIA 2LTHA 3LRDA 2K3QA 2MX8A 2N3EA 2MX9A 3LR8A 3LR2A
chains in the Genus database with same CATH superfamily
2N1DB 2NVYA 2LPJA 2CW0D 3GTKA 2X0OA 2EZAA 4CEHA 2MX8A 4CEJA 1W27A 4C2MA 1Y2MA 2HWGA 3GTQA 1TWGA 2HROA 1TWCA 3LR8A 2A6HD 2VUMA 2K3OA 4CEIA 3LRDA 1EZBA 2Y0NA 3U44A 4V2QA 2YU9A 2MP0A 2A69D 2BE5D 2MX9A 2X0PA 5IZ2A 1YNND 1SMYD 2A6ED 2LKMB 2AQLA 3GTOA 1ZYMA 2FIOA 3LR6A 2X0QA 2LPIA 2VK9A 2R7ZA 1WCMA 1TWFA 2R92A 3GTPA 2R93A 3EZAA 1ZYRD 1SFOA 3GTLA 2JA5A 2F5JA 1HQMD 2YIIA 2N3EA 1I50A 3CQZA 4C5RA 1IW7D 3H0GA 4C5SA 1I3QA 3GTMA 4FBSA 2A68D 3LR2A 1Y1WA 3NZ4A 2K3QA 4BABA 4C5UA 2E2HA 4CQ5A 1T6PA 4BAAA 2JA6A 3FKIA 3EZBA 2LYIA 2B63A 3GTGA 2JA7A 2FIPA 1EZAA 4QIWA 1K83A 2MQAA 2E2IA 1I6VD 3GTJA 1TWAA 2K3NA 2LTHA 1Y1VA 3U4QA 2EZCA 4V2RA 4C6GA 2O5JD 1T6JA 2NVXA 2EZBA 3EZEA 1R9TA 1TWHA 1YNJD
chains in the Genus database with same CATH topology
2N1DB 2NVYA 2LPJA 2CW0D 3GTKA 2X0OA 4CEHA 2MX8A 4CEJA 4C2MA 3GTQA 1TWGA 1TWCA 3LR8A 2A6HD 2VUMA 2K3OA 4CEIA 3LRDA 2Y0NA 3U44A 2YU9A 2A69D 2BE5D 2MX9A 2X0PA 5IZ2A 1YNND 1SMYD 2A6ED 2LKMB 2AQLA 3GTOA 2FIOA 3LR6A 2X0QA 2LPIA 2VK9A 2R7ZA 1WCMA 1TWFA 2R92A 3GTPA 2R93A 1ZYRD 1SFOA 3GTLA 2JA5A 2F5JA 1HQMD 2N3EA 1I50A 3CQZA 1IW7D 3H0GA 1I3QA 3GTMA 4FBSA 2A68D 3LR2A 1Y1WA 2K3QA 2E2HA 2JA6A 3FKIA 2LYIA 2B63A 3GTGA 2JA7A 2FIPA 4QIWA 1K83A 2MQAA 2E2IA 1I6VD 3GTJA 1TWAA 2K3NA 2LTHA 1Y1VA 3U4QA 2O5JD 2NVXA 1R9TA 1TWHA 1YNJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZ2 A;  4FBS A;  2LPJ A;  3LR6 A;  2LPI A;  2LTH A;  3LRD A;  2K3Q A;  2MX8 A;  2N3E A;  2MX9 A;  3LR8 A;  3LR2 A; 
#chains in the Genus database with same CATH topology
 2N1D B;  2NVY A;  2LPJ A;  2CW0 D;  3GTK A;  2X0O A;  2EZA A;  4CEH A;  2MX8 A;  4CEJ A;  1W27 A;  4C2M A;  1Y2M A;  2HWG A;  3GTQ A;  1TWG A;  2HRO A;  1TWC A;  3LR8 A;  2A6H D;  2VUM A;  2K3O A;  4CEI A;  3LRD A;  1EZB A;  2Y0N A;  3U44 A;  4V2Q A;  2YU9 A;  2MP0 A;  2A69 D;  2BE5 D;  2MX9 A;  2X0P A;  5IZ2 A;  1YNN D;  1SMY D;  2A6E D;  2LKM B;  2AQL A;  3GTO A;  1ZYM A;  2FIO A;  3LR6 A;  2X0Q A;  2LPI A;  2VK9 A;  2R7Z A;  1WCM A;  1TWF A;  2R92 A;  3GTP A;  2R93 A;  3EZA A;  1ZYR D;  1SFO A;  3GTL A;  2JA5 A;  2F5J A;  1HQM D;  2YII A;  2N3E A;  1I50 A;  3CQZ A;  4C5R A;  1IW7 D;  3H0G A;  4C5S A;  1I3Q A;  3GTM A;  4FBS A;  2A68 D;  3LR2 A;  1Y1W A;  3NZ4 A;  2K3Q A;  4BAB A;  4C5U A;  2E2H A;  4CQ5 A;  1T6P A;  4BAA A;  2JA6 A;  3FKI A;  3EZB A;  2LYI A;  2B63 A;  3GTG A;  2JA7 A;  2FIP A;  1EZA A;  4QIW A;  1K83 A;  2MQA A;  2E2I A;  1I6V D;  3GTJ A;  1TWA A;  2K3N A;  2LTH A;  1Y1V A;  3U4Q A;  2EZC A;  4V2R A;  4C6G A;  2O5J D;  1T6J A;  2NVX A;  2EZB A;  3EZE A;  1R9T A;  1TWH A;  1YNJ D; 
#chains in the Genus database with same CATH homology
 2N1D B;  2NVY A;  2LPJ A;  2CW0 D;  3GTK A;  2X0O A;  4CEH A;  2MX8 A;  4CEJ A;  4C2M A;  3GTQ A;  1TWG A;  1TWC A;  3LR8 A;  2A6H D;  2VUM A;  2K3O A;  4CEI A;  3LRD A;  2Y0N A;  3U44 A;  2YU9 A;  2A69 D;  2BE5 D;  2MX9 A;  2X0P A;  5IZ2 A;  1YNN D;  1SMY D;  2A6E D;  2LKM B;  2AQL A;  3GTO A;  2FIO A;  3LR6 A;  2X0Q A;  2LPI A;  2VK9 A;  2R7Z A;  1WCM A;  1TWF A;  2R92 A;  3GTP A;  2R93 A;  1ZYR D;  1SFO A;  3GTL A;  2JA5 A;  2F5J A;  1HQM D;  2N3E A;  1I50 A;  3CQZ A;  1IW7 D;  3H0G A;  1I3Q A;  3GTM A;  4FBS A;  2A68 D;  3LR2 A;  1Y1W A;  2K3Q A;  2E2H A;  2JA6 A;  3FKI A;  2LYI A;  2B63 A;  3GTG A;  2JA7 A;  2FIP A;  4QIW A;  1K83 A;  2MQA A;  2E2I A;  1I6V D;  3GTJ A;  1TWA A;  2K3N A;  2LTH A;  1Y1V A;  3U4Q A;  2O5J D;  2NVX A;  1R9T A;  1TWH A;  1YNJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...