3LR2A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
125
structure length
125
Chain Sequence
b'HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 54
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr2A01
2LTHA 3LRDA 4FBSA 3LR8A 2N3EA 2LPJA 3LR6A 5IZ2A 3LR2A 2MX8A 2MX9A 2K3QA 2LPIA
chains in the Genus database with same CATH superfamily
3FKIA 3LRDA 4FBSA 2EZBA 2HWGA 2N3EA 3LR8A 4CEJA 4C6GA 4C5RA 1TWAA 2LYIA 3EZEA 2NVYA 3GTJA 2E2IA 1T6PA 2MQAA 1ZYMA 4CEHA 2JA7A 1Y1VA 2FIOA 2K3QA 2X0OA 2O5JD 3GTKA 1I50A 2R93A 2EZAA 2R92A 2VK9A 2JA6A 1WCMA 2VUMA 2A68D 3GTQA 3GTGA 2E2HA 2NVXA 4CQ5A 2FIPA 2X0PA 4C5SA 1SMYD 2YU9A 2X0QA 4BABA 1YNND 4C5UA 2LPIA 2F5JA 2LTHA 3EZAA 2LKMB 3U4QA 3NZ4A 2A6HD 3GTMA 2HROA 4V2QA 1EZAA 4C2MA 1R9TA 3GTLA 1Y2MA 2AQLA 1EZBA 3LR2A 1YNJD 3LR6A 1SFOA 2MX9A 4QIWA 1T6JA 1TWHA 2LPJA 4V2RA 4BAAA 2R7ZA 2EZCA 2BE5D 3EZBA 2CW0D 2MP0A 2A69D 1TWCA 4CEIA 3U44A 2YIIA 3GTOA 1I3QA 2MX8A 1W27A 2K3OA 1K83A 1HQMD 2N1DB 2JA5A 5IZ2A 1ZYRD 3H0GA 1TWGA 1TWFA 2Y0NA 1Y1WA 2A6ED 2B63A 3CQZA 1I6VD 1IW7D 3GTPA 2K3NA
chains in the Genus database with same CATH topology
3FKIA 3LRDA 4FBSA 3LR8A 2N3EA 4CEJA 1TWAA 2LYIA 2NVYA 3GTJA 2E2IA 2MQAA 4CEHA 2JA7A 1Y1VA 2FIOA 2K3QA 2X0OA 2O5JD 3GTKA 1I50A 2R93A 2R92A 2VK9A 2JA6A 1WCMA 2VUMA 2A68D 3GTQA 3GTGA 2E2HA 2NVXA 2FIPA 2X0PA 1SMYD 2YU9A 2X0QA 1YNND 2LPIA 2F5JA 2LTHA 2LKMB 3U4QA 2A6HD 3GTMA 4C2MA 1R9TA 3GTLA 2AQLA 3LR2A 1YNJD 3LR6A 1SFOA 2MX9A 4QIWA 1TWHA 2LPJA 2R7ZA 2BE5D 2CW0D 2A69D 1TWCA 4CEIA 3U44A 3GTOA 1I3QA 2MX8A 2K3OA 1K83A 1HQMD 2N1DB 2JA5A 5IZ2A 1ZYRD 3H0GA 1TWGA 1TWFA 2Y0NA 1Y1WA 2A6ED 2B63A 3CQZA 1I6VD 1IW7D 3GTPA 2K3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTH A;  3LRD A;  4FBS A;  3LR8 A;  2N3E A;  2LPJ A;  3LR6 A;  5IZ2 A;  3LR2 A;  2MX8 A;  2MX9 A;  2K3Q A;  2LPI A; 
#chains in the Genus database with same CATH topology
 3FKI A;  3LRD A;  4FBS A;  2EZB A;  2HWG A;  2N3E A;  3LR8 A;  4CEJ A;  4C6G A;  4C5R A;  1TWA A;  2LYI A;  3EZE A;  2NVY A;  3GTJ A;  2E2I A;  1T6P A;  2MQA A;  1ZYM A;  4CEH A;  2JA7 A;  1Y1V A;  2FIO A;  2K3Q A;  2X0O A;  2O5J D;  3GTK A;  1I50 A;  2R93 A;  2EZA A;  2R92 A;  2VK9 A;  2JA6 A;  1WCM A;  2VUM A;  2A68 D;  3GTQ A;  3GTG A;  2E2H A;  2NVX A;  4CQ5 A;  2FIP A;  2X0P A;  4C5S A;  1SMY D;  2YU9 A;  2X0Q A;  4BAB A;  1YNN D;  4C5U A;  2LPI A;  2F5J A;  2LTH A;  3EZA A;  2LKM B;  3U4Q A;  3NZ4 A;  2A6H D;  3GTM A;  2HRO A;  4V2Q A;  1EZA A;  4C2M A;  1R9T A;  3GTL A;  1Y2M A;  2AQL A;  1EZB A;  3LR2 A;  1YNJ D;  3LR6 A;  1SFO A;  2MX9 A;  4QIW A;  1T6J A;  1TWH A;  2LPJ A;  4V2R A;  4BAA A;  2R7Z A;  2EZC A;  2BE5 D;  3EZB A;  2CW0 D;  2MP0 A;  2A69 D;  1TWC A;  4CEI A;  3U44 A;  2YII A;  3GTO A;  1I3Q A;  2MX8 A;  1W27 A;  2K3O A;  1K83 A;  1HQM D;  2N1D B;  2JA5 A;  5IZ2 A;  1ZYR D;  3H0G A;  1TWG A;  1TWF A;  2Y0N A;  1Y1W A;  2A6E D;  2B63 A;  3CQZ A;  1I6V D;  1IW7 D;  3GTP A;  2K3N A; 
#chains in the Genus database with same CATH homology
 3FKI A;  3LRD A;  4FBS A;  3LR8 A;  2N3E A;  4CEJ A;  1TWA A;  2LYI A;  2NVY A;  3GTJ A;  2E2I A;  2MQA A;  4CEH A;  2JA7 A;  1Y1V A;  2FIO A;  2K3Q A;  2X0O A;  2O5J D;  3GTK A;  1I50 A;  2R93 A;  2R92 A;  2VK9 A;  2JA6 A;  1WCM A;  2VUM A;  2A68 D;  3GTQ A;  3GTG A;  2E2H A;  2NVX A;  2FIP A;  2X0P A;  1SMY D;  2YU9 A;  2X0Q A;  1YNN D;  2LPI A;  2F5J A;  2LTH A;  2LKM B;  3U4Q A;  2A6H D;  3GTM A;  4C2M A;  1R9T A;  3GTL A;  2AQL A;  3LR2 A;  1YNJ D;  3LR6 A;  1SFO A;  2MX9 A;  4QIW A;  1TWH A;  2LPJ A;  2R7Z A;  2BE5 D;  2CW0 D;  2A69 D;  1TWC A;  4CEI A;  3U44 A;  3GTO A;  1I3Q A;  2MX8 A;  2K3O A;  1K83 A;  1HQM D;  2N1D B;  2JA5 A;  5IZ2 A;  1ZYR D;  3H0G A;  1TWG A;  1TWF A;  2Y0N A;  1Y1W A;  2A6E D;  2B63 A;  3CQZ A;  1I6V D;  1IW7 D;  3GTP A;  2K3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...