3LR2A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
125
structure length
125
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
total genus 54
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr2A01
2LPJA 2LTHA 4FBSA 3LR8A 2N3EA 3LRDA 3LR2A 2MX8A 3LR6A 2K3QA 2MX9A 5IZ2A 2LPIA
chains in the Genus database with same CATH superfamily
4V2QA 2LTHA 2LYIA 3U44A 1Y1WA 2JA7A 2N3EA 1W27A 2R7ZA 3EZBA 1Y2MA 3LR6A 4C5UA 3GTJA 2HWGA 1IW7D 2LPIA 2CW0D 2MP0A 2R93A 1SFOA 4C5SA 3GTOA 2EZAA 4FBSA 1TWFA 2EZBA 3CQZA 3GTQA 2K3NA 2VK9A 2EZCA 2E2HA 2BE5D 2MX9A 2Y0NA 4CEJA 2B63A 1TWAA 3LRDA 2F5JA 1K83A 3GTLA 2JA6A 2LPJA 2AQLA 2R92A 2HROA 4CEIA 4CQ5A 2E2IA 2JA5A 3H0GA 1R9TA 2NVYA 1WCMA 1TWHA 2FIPA 3U4QA 2O5JD 4BAAA 2X0PA 2NVXA 2YU9A 3FKIA 1EZBA 3EZEA 1T6PA 3LR8A 2VUMA 1Y1VA 1I3QA 1T6JA 1HQMD 2X0QA 1YNJD 2A6ED 2X0OA 3GTKA 4C5RA 4C2MA 2K3OA 2MQAA 3GTMA 1I6VD 1TWGA 2A6HD 2N1DB 4V2RA 2A69D 2K3QA 1SMYD 5IZ2A 2FIOA 1ZYMA 3NZ4A 3LR2A 1TWCA 4BABA 2A68D 3GTPA 1I50A 4C6GA 4QIWA 3EZAA 3GTGA 4CEHA 1ZYRD 2YIIA 2LKMB 1YNND 2MX8A 1EZAA
chains in the Genus database with same CATH topology
2LTHA 2LYIA 3U44A 1Y1WA 2JA7A 2N3EA 2R7ZA 3LR6A 3GTJA 1IW7D 2LPIA 2CW0D 2R93A 1SFOA 3GTOA 4FBSA 1TWFA 3CQZA 3GTQA 2K3NA 2VK9A 2E2HA 2BE5D 2MX9A 2Y0NA 4CEJA 2B63A 1TWAA 3LRDA 2F5JA 1K83A 3GTLA 2JA6A 2LPJA 2AQLA 2R92A 4CEIA 2E2IA 2JA5A 3H0GA 1R9TA 2NVYA 1WCMA 1TWHA 2FIPA 3U4QA 2O5JD 2X0PA 2NVXA 2YU9A 3FKIA 3LR8A 2VUMA 1Y1VA 1I3QA 1HQMD 2X0QA 1YNJD 2A6ED 2X0OA 3GTKA 4C2MA 2K3OA 2MQAA 3GTMA 1I6VD 1TWGA 2A6HD 2N1DB 2A69D 2K3QA 1SMYD 5IZ2A 2FIOA 3LR2A 1TWCA 2A68D 3GTPA 1I50A 4QIWA 3GTGA 4CEHA 1ZYRD 2LKMB 1YNND 2MX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPJ A;  2LTH A;  4FBS A;  3LR8 A;  2N3E A;  3LRD A;  3LR2 A;  2MX8 A;  3LR6 A;  2K3Q A;  2MX9 A;  5IZ2 A;  2LPI A; 
#chains in the Genus database with same CATH topology
 4V2Q A;  2LTH A;  2LYI A;  3U44 A;  1Y1W A;  2JA7 A;  2N3E A;  1W27 A;  2R7Z A;  3EZB A;  1Y2M A;  3LR6 A;  4C5U A;  3GTJ A;  2HWG A;  1IW7 D;  2LPI A;  2CW0 D;  2MP0 A;  2R93 A;  1SFO A;  4C5S A;  3GTO A;  2EZA A;  4FBS A;  1TWF A;  2EZB A;  3CQZ A;  3GTQ A;  2K3N A;  2VK9 A;  2EZC A;  2E2H A;  2BE5 D;  2MX9 A;  2Y0N A;  4CEJ A;  2B63 A;  1TWA A;  3LRD A;  2F5J A;  1K83 A;  3GTL A;  2JA6 A;  2LPJ A;  2AQL A;  2R92 A;  2HRO A;  4CEI A;  4CQ5 A;  2E2I A;  2JA5 A;  3H0G A;  1R9T A;  2NVY A;  1WCM A;  1TWH A;  2FIP A;  3U4Q A;  2O5J D;  4BAA A;  2X0P A;  2NVX A;  2YU9 A;  3FKI A;  1EZB A;  3EZE A;  1T6P A;  3LR8 A;  2VUM A;  1Y1V A;  1I3Q A;  1T6J A;  1HQM D;  2X0Q A;  1YNJ D;  2A6E D;  2X0O A;  3GTK A;  4C5R A;  4C2M A;  2K3O A;  2MQA A;  3GTM A;  1I6V D;  1TWG A;  2A6H D;  2N1D B;  4V2R A;  2A69 D;  2K3Q A;  1SMY D;  5IZ2 A;  2FIO A;  1ZYM A;  3NZ4 A;  3LR2 A;  1TWC A;  4BAB A;  2A68 D;  3GTP A;  1I50 A;  4C6G A;  4QIW A;  3EZA A;  3GTG A;  4CEH A;  1ZYR D;  2YII A;  2LKM B;  1YNN D;  2MX8 A;  1EZA A; 
#chains in the Genus database with same CATH homology
 2LTH A;  2LYI A;  3U44 A;  1Y1W A;  2JA7 A;  2N3E A;  2R7Z A;  3LR6 A;  3GTJ A;  1IW7 D;  2LPI A;  2CW0 D;  2R93 A;  1SFO A;  3GTO A;  4FBS A;  1TWF A;  3CQZ A;  3GTQ A;  2K3N A;  2VK9 A;  2E2H A;  2BE5 D;  2MX9 A;  2Y0N A;  4CEJ A;  2B63 A;  1TWA A;  3LRD A;  2F5J A;  1K83 A;  3GTL A;  2JA6 A;  2LPJ A;  2AQL A;  2R92 A;  4CEI A;  2E2I A;  2JA5 A;  3H0G A;  1R9T A;  2NVY A;  1WCM A;  1TWH A;  2FIP A;  3U4Q A;  2O5J D;  2X0P A;  2NVX A;  2YU9 A;  3FKI A;  3LR8 A;  2VUM A;  1Y1V A;  1I3Q A;  1HQM D;  2X0Q A;  1YNJ D;  2A6E D;  2X0O A;  3GTK A;  4C2M A;  2K3O A;  2MQA A;  3GTM A;  1I6V D;  1TWG A;  2A6H D;  2N1D B;  2A69 D;  2K3Q A;  1SMY D;  5IZ2 A;  2FIO A;  3LR2 A;  1TWC A;  2A68 D;  3GTP A;  1I50 A;  4QIW A;  3GTG A;  4CEH A;  1ZYR D;  2LKM B;  1YNN D;  2MX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...