3LR2A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
125
structure length
125
Chain Sequence
HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 54
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr2A01
2LPIA 3LR8A 2K3QA 2MX8A 2MX9A 3LR6A 3LR2A 3LRDA 4FBSA 2LTHA 5IZ2A 2LPJA 2N3EA
chains in the Genus database with same CATH superfamily
3EZBA 2K3QA 2R92A 2VK9A 1Y1VA 1K83A 1TWAA 4QIWA 1IW7D 2K3OA 2JA5A 1TWCA 2A6HD 1I3QA 2LYIA 2FIOA 2HWGA 4V2RA 1I50A 2X0OA 3GTLA 1EZBA 4C5RA 2BE5D 2YIIA 2N3EA 2JA7A 2X0QA 4CEJA 4CEHA 3FKIA 3LR6A 1SMYD 3NZ4A 1ZYMA 2A6ED 3CQZA 1TWGA 2YU9A 3GTPA 3U44A 2E2HA 2EZCA 2MP0A 1TWHA 1WCMA 1YNJD 3GTMA 5IZ2A 2R7ZA 2FIPA 3LR2A 2A69D 2LKMB 2MX9A 2F5JA 1TWFA 2NVYA 3EZEA 4CQ5A 3LRDA 2A68D 3GTQA 3GTGA 3GTKA 2X0PA 4C5SA 2AQLA 2NVXA 2LTHA 3U4QA 1W27A 4BAAA 1R9TA 2EZBA 1HQMD 1I6VD 4FBSA 3GTOA 1T6PA 2O5JD 2VUMA 2B63A 2MX8A 2JA6A 2EZAA 1EZAA 2MQAA 1Y1WA 2LPJA 2K3NA 2N1DB 1SFOA 4CEIA 1ZYRD 3LR8A 4C2MA 2LPIA 2Y0NA 1T6JA 2R93A 2HROA 4C6GA 2E2IA 3GTJA 4V2QA 3EZAA 4BABA 1Y2MA 1YNND 4C5UA 2CW0D 3H0GA
chains in the Genus database with same CATH topology
2K3QA 2R92A 2VK9A 1Y1VA 1K83A 1TWAA 4QIWA 1IW7D 2K3OA 2JA5A 1TWCA 2A6HD 1I3QA 2LYIA 2FIOA 1I50A 2X0OA 3GTLA 2BE5D 2N3EA 2JA7A 2X0QA 4CEJA 4CEHA 3FKIA 3LR6A 1SMYD 2A6ED 3CQZA 1TWGA 2YU9A 3GTPA 3U44A 2E2HA 1TWHA 1WCMA 1YNJD 3GTMA 5IZ2A 2R7ZA 2FIPA 3LR2A 2A69D 2LKMB 2MX9A 2F5JA 1TWFA 2NVYA 3LRDA 2A68D 3GTQA 3GTGA 3GTKA 2X0PA 2AQLA 2NVXA 2LTHA 3U4QA 1R9TA 1HQMD 1I6VD 4FBSA 3GTOA 2VUMA 2O5JD 2B63A 2MX8A 2JA6A 2MQAA 1Y1WA 2LPJA 2K3NA 2N1DB 1SFOA 4CEIA 1ZYRD 3LR8A 4C2MA 2LPIA 2Y0NA 2R93A 2E2IA 3GTJA 1YNND 2CW0D 3H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPI A;  3LR8 A;  2K3Q A;  2MX8 A;  2MX9 A;  3LR6 A;  3LR2 A;  3LRD A;  4FBS A;  2LTH A;  5IZ2 A;  2LPJ A;  2N3E A; 
#chains in the Genus database with same CATH topology
 3EZB A;  2K3Q A;  2R92 A;  2VK9 A;  1Y1V A;  1K83 A;  1TWA A;  4QIW A;  1IW7 D;  2K3O A;  2JA5 A;  1TWC A;  2A6H D;  1I3Q A;  2LYI A;  2FIO A;  2HWG A;  4V2R A;  1I50 A;  2X0O A;  3GTL A;  1EZB A;  4C5R A;  2BE5 D;  2YII A;  2N3E A;  2JA7 A;  2X0Q A;  4CEJ A;  4CEH A;  3FKI A;  3LR6 A;  1SMY D;  3NZ4 A;  1ZYM A;  2A6E D;  3CQZ A;  1TWG A;  2YU9 A;  3GTP A;  3U44 A;  2E2H A;  2EZC A;  2MP0 A;  1TWH A;  1WCM A;  1YNJ D;  3GTM A;  5IZ2 A;  2R7Z A;  2FIP A;  3LR2 A;  2A69 D;  2LKM B;  2MX9 A;  2F5J A;  1TWF A;  2NVY A;  3EZE A;  4CQ5 A;  3LRD A;  2A68 D;  3GTQ A;  3GTG A;  3GTK A;  2X0P A;  4C5S A;  2AQL A;  2NVX A;  2LTH A;  3U4Q A;  1W27 A;  4BAA A;  1R9T A;  2EZB A;  1HQM D;  1I6V D;  4FBS A;  3GTO A;  1T6P A;  2O5J D;  2VUM A;  2B63 A;  2MX8 A;  2JA6 A;  2EZA A;  1EZA A;  2MQA A;  1Y1W A;  2LPJ A;  2K3N A;  2N1D B;  1SFO A;  4CEI A;  1ZYR D;  3LR8 A;  4C2M A;  2LPI A;  2Y0N A;  1T6J A;  2R93 A;  2HRO A;  4C6G A;  2E2I A;  3GTJ A;  4V2Q A;  3EZA A;  4BAB A;  1Y2M A;  1YNN D;  4C5U A;  2CW0 D;  3H0G A; 
#chains in the Genus database with same CATH homology
 2K3Q A;  2R92 A;  2VK9 A;  1Y1V A;  1K83 A;  1TWA A;  4QIW A;  1IW7 D;  2K3O A;  2JA5 A;  1TWC A;  2A6H D;  1I3Q A;  2LYI A;  2FIO A;  1I50 A;  2X0O A;  3GTL A;  2BE5 D;  2N3E A;  2JA7 A;  2X0Q A;  4CEJ A;  4CEH A;  3FKI A;  3LR6 A;  1SMY D;  2A6E D;  3CQZ A;  1TWG A;  2YU9 A;  3GTP A;  3U44 A;  2E2H A;  1TWH A;  1WCM A;  1YNJ D;  3GTM A;  5IZ2 A;  2R7Z A;  2FIP A;  3LR2 A;  2A69 D;  2LKM B;  2MX9 A;  2F5J A;  1TWF A;  2NVY A;  3LRD A;  2A68 D;  3GTQ A;  3GTG A;  3GTK A;  2X0P A;  2AQL A;  2NVX A;  2LTH A;  3U4Q A;  1R9T A;  1HQM D;  1I6V D;  4FBS A;  3GTO A;  2VUM A;  2O5J D;  2B63 A;  2MX8 A;  2JA6 A;  2MQA A;  1Y1W A;  2LPJ A;  2K3N A;  2N1D B;  1SFO A;  4CEI A;  1ZYR D;  3LR8 A;  4C2M A;  2LPI A;  2Y0N A;  2R93 A;  2E2I A;  3GTJ A;  1YNN D;  2CW0 D;  3H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...