3LR2A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
125
structure length
125
Chain Sequence
b'HTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 54
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr2A01
2MX8A 2N3EA 5IZ2A 3LR6A 4FBSA 2LTHA 2MX9A 3LR2A 3LRDA 3LR8A 2K3QA 2LPIA 2LPJA
chains in the Genus database with same CATH superfamily
4QIWA 1I50A 1HQMD 2MP0A 2R93A 2A69D 2YU9A 2LYIA 2A6ED 3GTKA 1YNND 1K83A 1Y2MA 2X0OA 4V2QA 1IW7D 2B63A 3GTOA 2JA5A 3LRDA 2AQLA 2LPJA 1I3QA 3GTGA 2EZBA 2MX8A 3GTQA 2R92A 1SMYD 2EZCA 1TWFA 3EZBA 4BAAA 2MX9A 1Y1VA 4CEHA 1T6JA 2HWGA 1I6VD 1TWCA 1TWGA 4C5SA 3GTJA 2X0PA 2N1DB 2VK9A 2HROA 2JA7A 2NVXA 1EZBA 3LR6A 2FIPA 4FBSA 1EZAA 2YIIA 2K3QA 3CQZA 3FKIA 1ZYMA 1R9TA 4CEJA 2E2HA 2Y0NA 4C5RA 3U4QA 3U44A 1TWAA 2JA6A 2FIOA 1WCMA 3NZ4A 4CQ5A 2A6HD 2F5JA 4BABA 1W27A 3EZAA 2LKMB 1ZYRD 2VUMA 2R7ZA 2NVYA 4C5UA 1SFOA 3GTLA 2BE5D 2X0QA 2MQAA 2LPIA 4CEIA 2EZAA 2N3EA 2K3OA 1YNJD 2O5JD 2CW0D 1T6PA 5IZ2A 4C6GA 3H0GA 3EZEA 3LR8A 3GTMA 1TWHA 2E2IA 4C2MA 3LR2A 3GTPA 4V2RA 2LTHA 2A68D 2K3NA 1Y1WA
chains in the Genus database with same CATH topology
4QIWA 1I50A 1HQMD 2R93A 2A69D 2YU9A 2LYIA 2A6ED 3GTKA 1YNND 1K83A 2X0OA 1IW7D 2B63A 3GTOA 2JA5A 3LRDA 2AQLA 2LPJA 1I3QA 3GTGA 2MX8A 3GTQA 2R92A 1SMYD 1TWFA 2MX9A 1Y1VA 4CEHA 1I6VD 1TWCA 1TWGA 3GTJA 2X0PA 2N1DB 2VK9A 2JA7A 2NVXA 3LR6A 2FIPA 4FBSA 2K3QA 3CQZA 3FKIA 1R9TA 4CEJA 2E2HA 2Y0NA 3U4QA 3U44A 1TWAA 2JA6A 2FIOA 1WCMA 2A6HD 2F5JA 2LKMB 1ZYRD 2VUMA 2R7ZA 2NVYA 1SFOA 3GTLA 2BE5D 2X0QA 2MQAA 4CEIA 2LPIA 2N3EA 2K3OA 1YNJD 2O5JD 2CW0D 5IZ2A 3H0GA 3LR8A 3GTMA 1TWHA 2E2IA 4C2MA 3LR2A 3GTPA 2LTHA 2A68D 2K3NA 1Y1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MX8 A;  2N3E A;  5IZ2 A;  3LR6 A;  4FBS A;  2LTH A;  2MX9 A;  3LR2 A;  3LRD A;  3LR8 A;  2K3Q A;  2LPI A;  2LPJ A; 
#chains in the Genus database with same CATH topology
 4QIW A;  1I50 A;  1HQM D;  2MP0 A;  2R93 A;  2A69 D;  2YU9 A;  2LYI A;  2A6E D;  3GTK A;  1YNN D;  1K83 A;  1Y2M A;  2X0O A;  4V2Q A;  1IW7 D;  2B63 A;  3GTO A;  2JA5 A;  3LRD A;  2AQL A;  2LPJ A;  1I3Q A;  3GTG A;  2EZB A;  2MX8 A;  3GTQ A;  2R92 A;  1SMY D;  2EZC A;  1TWF A;  3EZB A;  4BAA A;  2MX9 A;  1Y1V A;  4CEH A;  1T6J A;  2HWG A;  1I6V D;  1TWC A;  1TWG A;  4C5S A;  3GTJ A;  2X0P A;  2N1D B;  2VK9 A;  2HRO A;  2JA7 A;  2NVX A;  1EZB A;  3LR6 A;  2FIP A;  4FBS A;  1EZA A;  2YII A;  2K3Q A;  3CQZ A;  3FKI A;  1ZYM A;  1R9T A;  4CEJ A;  2E2H A;  2Y0N A;  4C5R A;  3U4Q A;  3U44 A;  1TWA A;  2JA6 A;  2FIO A;  1WCM A;  3NZ4 A;  4CQ5 A;  2A6H D;  2F5J A;  4BAB A;  1W27 A;  3EZA A;  2LKM B;  1ZYR D;  2VUM A;  2R7Z A;  2NVY A;  4C5U A;  1SFO A;  3GTL A;  2BE5 D;  2X0Q A;  2MQA A;  2LPI A;  4CEI A;  2EZA A;  2N3E A;  2K3O A;  1YNJ D;  2O5J D;  2CW0 D;  1T6P A;  5IZ2 A;  4C6G A;  3H0G A;  3EZE A;  3LR8 A;  3GTM A;  1TWH A;  2E2I A;  4C2M A;  3LR2 A;  3GTP A;  4V2R A;  2LTH A;  2A68 D;  2K3N A;  1Y1W A; 
#chains in the Genus database with same CATH homology
 4QIW A;  1I50 A;  1HQM D;  2R93 A;  2A69 D;  2YU9 A;  2LYI A;  2A6E D;  3GTK A;  1YNN D;  1K83 A;  2X0O A;  1IW7 D;  2B63 A;  3GTO A;  2JA5 A;  3LRD A;  2AQL A;  2LPJ A;  1I3Q A;  3GTG A;  2MX8 A;  3GTQ A;  2R92 A;  1SMY D;  1TWF A;  2MX9 A;  1Y1V A;  4CEH A;  1I6V D;  1TWC A;  1TWG A;  3GTJ A;  2X0P A;  2N1D B;  2VK9 A;  2JA7 A;  2NVX A;  3LR6 A;  2FIP A;  4FBS A;  2K3Q A;  3CQZ A;  3FKI A;  1R9T A;  4CEJ A;  2E2H A;  2Y0N A;  3U4Q A;  3U44 A;  1TWA A;  2JA6 A;  2FIO A;  1WCM A;  2A6H D;  2F5J A;  2LKM B;  1ZYR D;  2VUM A;  2R7Z A;  2NVY A;  1SFO A;  3GTL A;  2BE5 D;  2X0Q A;  2MQA A;  4CEI A;  2LPI A;  2N3E A;  2K3O A;  1YNJ D;  2O5J D;  2CW0 D;  5IZ2 A;  3H0G A;  3LR8 A;  3GTM A;  1TWH A;  2E2I A;  4C2M A;  3LR2 A;  3GTP A;  2LTH A;  2A68 D;  2K3N A;  1Y1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...