2N1DB

Solution structure of the mrg15-mrgbp complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
172
structure length
172
Chain Sequence
b'SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRG/MORF4L-binding protein
molecule tags Protein binding
source organism Homo sapiens
publication title Structural Basis for Multi-specificity of MRG Domains.
pubmed doi rcsb
total genus 54
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2n1dB00
2N1DB 2Y0NA 2AQLA 2F5JA 2LKMB
chains in the Genus database with same CATH superfamily
2EZBA 2Y0NA 1R9TA 4BAAA 2X0PA 4CQ5A 1EZBA 3EZBA 4C6GA 2JA6A 1SMYD 2X0OA 1W27A 3H0GA 1I50A 1T6JA 4CEHA 2K3OA 1T6PA 2AQLA 1TWCA 2BE5D 3U4QA 4C5SA 3EZEA 1I6VD 3GTOA 1K83A 2YIIA 3LRDA 5IZ2A 2F5JA 2LKMB 2MP0A 1YNJD 3GTJA 2A6ED 1IW7D 2HWGA 2JA5A 3GTMA 2A6HD 1Y1VA 3LR2A 2VK9A 1TWFA 2VUMA 1Y1WA 3FKIA 2MQAA 2HROA 2JA7A 2LYIA 2X0QA 2E2IA 4FBSA 2R7ZA 2MX9A 4CEIA 4V2QA 2CW0D 2R93A 1TWHA 2O5JD 1ZYRD 2R92A 2E2HA 4QIWA 2FIPA 4C5UA 3LR8A 3U44A 2LPJA 3GTGA 2YU9A 2NVYA 2LTHA 1EZAA 3EZAA 2EZCA 1Y2MA 1I3QA 2B63A 4C5RA 2NVXA 2LPIA 3GTPA 1TWAA 2K3NA 2N1DB 2K3QA 2MX8A 1SFOA 1ZYMA 2FIOA 3GTQA 1WCMA 3LR6A 3CQZA 2A68D 4V2RA 4BABA 1HQMD 4CEJA 2EZAA 3GTKA 1TWGA 4C2MA 2A69D 3GTLA 3NZ4A 2N3EA 1YNND
chains in the Genus database with same CATH topology
2Y0NA 1R9TA 2X0PA 2JA6A 1SMYD 2X0OA 3H0GA 1I50A 4CEHA 2K3OA 2AQLA 1TWCA 2BE5D 3U4QA 1I6VD 3GTOA 1K83A 3LRDA 5IZ2A 2F5JA 2LKMB 3GTJA 1YNJD 2A6ED 1IW7D 2JA5A 3GTMA 2A6HD 1Y1VA 3LR2A 2VK9A 1TWFA 2VUMA 1Y1WA 3FKIA 2MQAA 2JA7A 2LYIA 2X0QA 2E2IA 4FBSA 2R7ZA 2MX9A 4CEIA 2CW0D 2R93A 1TWHA 2O5JD 1ZYRD 2R92A 2E2HA 4QIWA 2FIPA 3LR8A 3U44A 2LPJA 3GTGA 2YU9A 2NVYA 2LTHA 1I3QA 2B63A 2NVXA 2LPIA 3GTPA 1TWAA 2K3NA 2N1DB 2K3QA 2MX8A 1SFOA 2FIOA 3GTQA 1WCMA 3LR6A 3CQZA 2A68D 1HQMD 4CEJA 3GTKA 1TWGA 4C2MA 2A69D 3GTLA 2N3EA 1YNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1D B;  2Y0N A;  2AQL A;  2F5J A;  2LKM B; 
#chains in the Genus database with same CATH topology
 2EZB A;  2Y0N A;  1R9T A;  4BAA A;  2X0P A;  4CQ5 A;  1EZB A;  3EZB A;  4C6G A;  2JA6 A;  1SMY D;  2X0O A;  1W27 A;  3H0G A;  1I50 A;  1T6J A;  4CEH A;  2K3O A;  1T6P A;  2AQL A;  1TWC A;  2BE5 D;  3U4Q A;  4C5S A;  3EZE A;  1I6V D;  3GTO A;  1K83 A;  2YII A;  3LRD A;  5IZ2 A;  2F5J A;  2LKM B;  2MP0 A;  1YNJ D;  3GTJ A;  2A6E D;  1IW7 D;  2HWG A;  2JA5 A;  3GTM A;  2A6H D;  1Y1V A;  3LR2 A;  2VK9 A;  1TWF A;  2VUM A;  1Y1W A;  3FKI A;  2MQA A;  2HRO A;  2JA7 A;  2LYI A;  2X0Q A;  2E2I A;  4FBS A;  2R7Z A;  2MX9 A;  4CEI A;  4V2Q A;  2CW0 D;  2R93 A;  1TWH A;  2O5J D;  1ZYR D;  2R92 A;  2E2H A;  4QIW A;  2FIP A;  4C5U A;  3LR8 A;  3U44 A;  2LPJ A;  3GTG A;  2YU9 A;  2NVY A;  2LTH A;  1EZA A;  3EZA A;  2EZC A;  1Y2M A;  1I3Q A;  2B63 A;  4C5R A;  2NVX A;  2LPI A;  3GTP A;  1TWA A;  2K3N A;  2N1D B;  2K3Q A;  2MX8 A;  1SFO A;  1ZYM A;  2FIO A;  3GTQ A;  1WCM A;  3LR6 A;  3CQZ A;  2A68 D;  4V2R A;  4BAB A;  1HQM D;  4CEJ A;  2EZA A;  3GTK A;  1TWG A;  4C2M A;  2A69 D;  3GTL A;  3NZ4 A;  2N3E A;  1YNN D; 
#chains in the Genus database with same CATH homology
 2Y0N A;  1R9T A;  2X0P A;  2JA6 A;  1SMY D;  2X0O A;  3H0G A;  1I50 A;  4CEH A;  2K3O A;  2AQL A;  1TWC A;  2BE5 D;  3U4Q A;  1I6V D;  3GTO A;  1K83 A;  3LRD A;  5IZ2 A;  2F5J A;  2LKM B;  3GTJ A;  1YNJ D;  2A6E D;  1IW7 D;  2JA5 A;  3GTM A;  2A6H D;  1Y1V A;  3LR2 A;  2VK9 A;  1TWF A;  2VUM A;  1Y1W A;  3FKI A;  2MQA A;  2JA7 A;  2LYI A;  2X0Q A;  2E2I A;  4FBS A;  2R7Z A;  2MX9 A;  4CEI A;  2CW0 D;  2R93 A;  1TWH A;  2O5J D;  1ZYR D;  2R92 A;  2E2H A;  4QIW A;  2FIP A;  3LR8 A;  3U44 A;  2LPJ A;  3GTG A;  2YU9 A;  2NVY A;  2LTH A;  1I3Q A;  2B63 A;  2NVX A;  2LPI A;  3GTP A;  1TWA A;  2K3N A;  2N1D B;  2K3Q A;  2MX8 A;  1SFO A;  2FIO A;  3GTQ A;  1WCM A;  3LR6 A;  3CQZ A;  2A68 D;  1HQM D;  4CEJ A;  3GTK A;  1TWG A;  4C2M A;  2A69 D;  3GTL A;  2N3E A;  1YNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...