2N1DB

Solution structure of the mrg15-mrgbp complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
172
structure length
172
Chain Sequence
SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords MRG/MORF4L-binding protein
publication title Structural Basis for Multi-specificity of MRG Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2n1dB00
2Y0NA 2AQLA 2F5JA 2N1DB 2LKMB
chains in the Genus database with same CATH superfamily
1Y2MA 1K83A 3GTMA 2R7ZA 2JA7A 2EZAA 2NVXA 4CEJA 1R9TA 4C2MA 2EZCA 2BE5D 2YU9A 1HQMD 3NZ4A 1W27A 2LKMB 1TWFA 1I50A 4CEHA 1Y1WA 4FBSA 2MP0A 2LPIA 4CQ5A 3EZEA 3GTLA 2LPJA 1ZYRD 4BAAA 3LR2A 1I3QA 2F5JA 3U4QA 1TWHA 3U44A 1TWAA 3LR8A 4C5SA 2K3QA 1YNJD 1I6VD 2HWGA 1WCMA 3GTQA 3GTPA 2LYIA 2MX9A 3FKIA 5IZ2A 4QIWA 2R93A 2E2IA 2A6ED 4C5UA 2N3EA 3H0GA 3EZAA 2A6HD 3GTGA 2B63A 2FIOA 2MQAA 3LR6A 1SFOA 4CEIA 2FIPA 1EZBA 1SMYD 1EZAA 2MX8A 4C5RA 2O5JD 1YNND 2JA5A 1Y1VA 2R92A 2JA6A 2X0QA 4C6GA 1T6JA 4BABA 2X0PA 3GTJA 2X0OA 3EZBA 2A68D 2NVYA 1TWCA 3CQZA 2Y0NA 2N1DB 2HROA 1IW7D 3GTOA 3LRDA 3GTKA 4V2RA 1TWGA 2EZBA 2VUMA 2YIIA 1T6PA 2A69D 2E2HA 2K3OA 2VK9A 2LTHA 1ZYMA 2AQLA 2K3NA 4V2QA 2CW0D
chains in the Genus database with same CATH topology
1K83A 3GTMA 2R7ZA 2JA7A 2NVXA 4CEJA 1R9TA 4C2MA 2BE5D 2YU9A 1HQMD 2LKMB 1TWFA 1I50A 4CEHA 1Y1WA 4FBSA 2LPIA 3GTLA 2LPJA 1ZYRD 3LR2A 1I3QA 2F5JA 3U4QA 1TWHA 3U44A 1TWAA 3LR8A 2K3QA 1YNJD 1I6VD 3GTQA 1WCMA 3GTPA 2LYIA 2MX9A 3FKIA 5IZ2A 4QIWA 2R93A 2E2IA 2A6ED 2N3EA 3H0GA 2A6HD 3GTGA 2B63A 2FIOA 2MQAA 3LR6A 1SFOA 4CEIA 2FIPA 1SMYD 2MX8A 2O5JD 1YNND 2JA5A 1Y1VA 2R92A 2JA6A 2X0QA 2X0PA 3GTJA 2X0OA 2A68D 2NVYA 1TWCA 3CQZA 2Y0NA 2N1DB 1IW7D 3GTOA 3LRDA 3GTKA 1TWGA 2VUMA 2A69D 2E2HA 2K3OA 2VK9A 2LTHA 2AQLA 2K3NA 2CW0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0N A;  2AQL A;  2F5J A;  2N1D B;  2LKM B; 
#chains in the Genus database with same CATH topology
 1Y2M A;  1K83 A;  3GTM A;  2R7Z A;  2JA7 A;  2EZA A;  2NVX A;  4CEJ A;  1R9T A;  4C2M A;  2EZC A;  2BE5 D;  2YU9 A;  1HQM D;  3NZ4 A;  1W27 A;  2LKM B;  1TWF A;  1I50 A;  4CEH A;  1Y1W A;  4FBS A;  2MP0 A;  2LPI A;  4CQ5 A;  3EZE A;  3GTL A;  2LPJ A;  1ZYR D;  4BAA A;  3LR2 A;  1I3Q A;  2F5J A;  3U4Q A;  1TWH A;  3U44 A;  1TWA A;  3LR8 A;  4C5S A;  2K3Q A;  1YNJ D;  1I6V D;  2HWG A;  1WCM A;  3GTQ A;  3GTP A;  2LYI A;  2MX9 A;  3FKI A;  5IZ2 A;  4QIW A;  2R93 A;  2E2I A;  2A6E D;  4C5U A;  2N3E A;  3H0G A;  3EZA A;  2A6H D;  3GTG A;  2B63 A;  2FIO A;  2MQA A;  3LR6 A;  1SFO A;  4CEI A;  2FIP A;  1EZB A;  1SMY D;  1EZA A;  2MX8 A;  4C5R A;  2O5J D;  1YNN D;  2JA5 A;  1Y1V A;  2R92 A;  2JA6 A;  2X0Q A;  4C6G A;  1T6J A;  4BAB A;  2X0P A;  3GTJ A;  2X0O A;  3EZB A;  2A68 D;  2NVY A;  1TWC A;  3CQZ A;  2Y0N A;  2N1D B;  2HRO A;  1IW7 D;  3GTO A;  3LRD A;  3GTK A;  4V2R A;  1TWG A;  2EZB A;  2VUM A;  2YII A;  1T6P A;  2A69 D;  2E2H A;  2K3O A;  2VK9 A;  2LTH A;  1ZYM A;  2AQL A;  2K3N A;  4V2Q A;  2CW0 D; 
#chains in the Genus database with same CATH homology
 1K83 A;  3GTM A;  2R7Z A;  2JA7 A;  2NVX A;  4CEJ A;  1R9T A;  4C2M A;  2BE5 D;  2YU9 A;  1HQM D;  2LKM B;  1TWF A;  1I50 A;  4CEH A;  1Y1W A;  4FBS A;  2LPI A;  3GTL A;  2LPJ A;  1ZYR D;  3LR2 A;  1I3Q A;  2F5J A;  3U4Q A;  1TWH A;  3U44 A;  1TWA A;  3LR8 A;  2K3Q A;  1YNJ D;  1I6V D;  3GTQ A;  1WCM A;  3GTP A;  2LYI A;  2MX9 A;  3FKI A;  5IZ2 A;  4QIW A;  2R93 A;  2E2I A;  2A6E D;  2N3E A;  3H0G A;  2A6H D;  3GTG A;  2B63 A;  2FIO A;  2MQA A;  3LR6 A;  1SFO A;  4CEI A;  2FIP A;  1SMY D;  2MX8 A;  2O5J D;  1YNN D;  2JA5 A;  1Y1V A;  2R92 A;  2JA6 A;  2X0Q A;  2X0P A;  3GTJ A;  2X0O A;  2A68 D;  2NVY A;  1TWC A;  3CQZ A;  2Y0N A;  2N1D B;  1IW7 D;  3GTO A;  3LRD A;  3GTK A;  1TWG A;  2VUM A;  2A69 D;  2E2H A;  2K3O A;  2VK9 A;  2LTH A;  2AQL A;  2K3N A;  2CW0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...