2N1DB

Solution structure of the mrg15-mrgbp complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
172
structure length
172
Chain Sequence
SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRG/MORF4L-binding protein
publication title Structural Basis for Multi-specificity of MRG Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 54
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2n1dB00
2LKMB 2N1DB 2F5JA 2Y0NA 2AQLA
chains in the Genus database with same CATH superfamily
2R92A 1HQMD 2X0OA 2EZAA 1W27A 2N1DB 1ZYRD 2NVXA 1EZBA 2HWGA 2A69D 2A6ED 3LRDA 2HROA 2MX8A 1TWAA 4C5SA 1SFOA 2LTHA 2YU9A 2JA6A 4FBSA 1TWCA 2X0QA 3GTOA 2EZBA 3GTPA 2MP0A 3H0GA 2EZCA 2R93A 4C2MA 2O5JD 4BAAA 3LR6A 1TWHA 3LR2A 3NZ4A 2R7ZA 2FIOA 3CQZA 5IZ2A 4CEHA 3EZAA 3EZBA 1Y2MA 2A68D 3U4QA 2AQLA 4CEJA 2N3EA 2LKMB 2JA5A 3GTQA 1I6VD 3GTJA 1I50A 1I3QA 2YIIA 4C6GA 3U44A 2BE5D 1T6PA 1TWGA 3GTLA 2K3QA 3LR8A 3EZEA 2LPIA 1R9TA 1YNJD 2LPJA 1EZAA 2VK9A 2X0PA 1K83A 3FKIA 1TWFA 2K3OA 4QIWA 2VUMA 1Y1WA 4V2RA 1SMYD 2FIPA 1WCMA 2LYIA 4C5UA 2MX9A 3GTGA 2B63A 2E2HA 2F5JA 3GTMA 2JA7A 1Y1VA 3GTKA 1IW7D 4CQ5A 4V2QA 1T6JA 2NVYA 2K3NA 4C5RA 2E2IA 2MQAA 2CW0D 4CEIA 2A6HD 4BABA 2Y0NA 1YNND 1ZYMA
chains in the Genus database with same CATH topology
2R92A 1HQMD 2X0OA 2N1DB 1ZYRD 2NVXA 2A69D 2A6ED 3LRDA 2MX8A 1TWAA 1SFOA 2LTHA 2YU9A 2JA6A 4FBSA 1TWCA 2X0QA 3GTOA 3GTPA 3H0GA 2R93A 4C2MA 2O5JD 3LR6A 1TWHA 3LR2A 2R7ZA 2FIOA 3CQZA 5IZ2A 4CEHA 4CEJA 2A68D 2AQLA 3U4QA 2N3EA 2LKMB 2JA5A 3GTQA 1I6VD 3GTJA 1I50A 1I3QA 3U44A 2BE5D 1TWGA 3GTLA 2K3QA 3LR8A 2LPIA 1R9TA 1YNJD 2LPJA 2VK9A 2X0PA 1K83A 3FKIA 1TWFA 2K3OA 4QIWA 2VUMA 1Y1WA 1SMYD 2FIPA 1WCMA 2LYIA 2MX9A 3GTGA 2B63A 2E2HA 2F5JA 3GTMA 2JA7A 1Y1VA 3GTKA 1IW7D 2NVYA 2K3NA 2E2IA 2MQAA 2CW0D 4CEIA 2A6HD 2Y0NA 1YNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKM B;  2N1D B;  2F5J A;  2Y0N A;  2AQL A; 
#chains in the Genus database with same CATH topology
 2R92 A;  1HQM D;  2X0O A;  2EZA A;  1W27 A;  2N1D B;  1ZYR D;  2NVX A;  1EZB A;  2HWG A;  2A69 D;  2A6E D;  3LRD A;  2HRO A;  2MX8 A;  1TWA A;  4C5S A;  1SFO A;  2LTH A;  2YU9 A;  2JA6 A;  4FBS A;  1TWC A;  2X0Q A;  3GTO A;  2EZB A;  3GTP A;  2MP0 A;  3H0G A;  2EZC A;  2R93 A;  4C2M A;  2O5J D;  4BAA A;  3LR6 A;  1TWH A;  3LR2 A;  3NZ4 A;  2R7Z A;  2FIO A;  3CQZ A;  5IZ2 A;  4CEH A;  3EZA A;  3EZB A;  1Y2M A;  2A68 D;  3U4Q A;  2AQL A;  4CEJ A;  2N3E A;  2LKM B;  2JA5 A;  3GTQ A;  1I6V D;  3GTJ A;  1I50 A;  1I3Q A;  2YII A;  4C6G A;  3U44 A;  2BE5 D;  1T6P A;  1TWG A;  3GTL A;  2K3Q A;  3LR8 A;  3EZE A;  2LPI A;  1R9T A;  1YNJ D;  2LPJ A;  1EZA A;  2VK9 A;  2X0P A;  1K83 A;  3FKI A;  1TWF A;  2K3O A;  4QIW A;  2VUM A;  1Y1W A;  4V2R A;  1SMY D;  2FIP A;  1WCM A;  2LYI A;  4C5U A;  2MX9 A;  3GTG A;  2B63 A;  2E2H A;  2F5J A;  3GTM A;  2JA7 A;  1Y1V A;  3GTK A;  1IW7 D;  4CQ5 A;  4V2Q A;  1T6J A;  2NVY A;  2K3N A;  4C5R A;  2E2I A;  2MQA A;  2CW0 D;  4CEI A;  2A6H D;  4BAB A;  2Y0N A;  1YNN D;  1ZYM A; 
#chains in the Genus database with same CATH homology
 2R92 A;  1HQM D;  2X0O A;  2N1D B;  1ZYR D;  2NVX A;  2A69 D;  2A6E D;  3LRD A;  2MX8 A;  1TWA A;  1SFO A;  2LTH A;  2YU9 A;  2JA6 A;  4FBS A;  1TWC A;  2X0Q A;  3GTO A;  3GTP A;  3H0G A;  2R93 A;  4C2M A;  2O5J D;  3LR6 A;  1TWH A;  3LR2 A;  2R7Z A;  2FIO A;  3CQZ A;  5IZ2 A;  4CEH A;  4CEJ A;  2A68 D;  2AQL A;  3U4Q A;  2N3E A;  2LKM B;  2JA5 A;  3GTQ A;  1I6V D;  3GTJ A;  1I50 A;  1I3Q A;  3U44 A;  2BE5 D;  1TWG A;  3GTL A;  2K3Q A;  3LR8 A;  2LPI A;  1R9T A;  1YNJ D;  2LPJ A;  2VK9 A;  2X0P A;  1K83 A;  3FKI A;  1TWF A;  2K3O A;  4QIW A;  2VUM A;  1Y1W A;  1SMY D;  2FIP A;  1WCM A;  2LYI A;  2MX9 A;  3GTG A;  2B63 A;  2E2H A;  2F5J A;  3GTM A;  2JA7 A;  1Y1V A;  3GTK A;  1IW7 D;  2NVY A;  2K3N A;  2E2I A;  2MQA A;  2CW0 D;  4CEI A;  2A6H D;  2Y0N A;  1YNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...