2N1DB

Solution structure of the mrg15-mrgbp complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
172
structure length
172
Chain Sequence
SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Multi-specificity of MRG Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords MRG/MORF4L-binding protein
total genus 54
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2n1dB00
2F5JA 2LKMB 2Y0NA 2N1DB 2AQLA
chains in the Genus database with same CATH superfamily
1Y2MA 2K3OA 2F5JA 2JA6A 2VUMA 1I50A 1YNJD 2EZCA 3NZ4A 3LR2A 1I6VD 2LPJA 2CW0D 2X0QA 3LR8A 2FIPA 2EZAA 4C5SA 4QIWA 1K83A 2LPIA 2HROA 3GTPA 2B63A 1TWAA 3EZAA 2A6ED 2A6HD 4C6GA 2R7ZA 2R93A 4V2QA 2JA5A 3FKIA 4C5UA 4CEIA 3GTGA 3GTKA 2EZBA 1SFOA 5IZ2A 1SMYD 2YU9A 1T6PA 4CEHA 3GTJA 2MQAA 3GTMA 1TWHA 1YNND 2NVYA 2R92A 4CEJA 1T6JA 4C2MA 2HWGA 2LYIA 2K3QA 2Y0NA 4CQ5A 2NVXA 4BAAA 3U44A 4V2RA 3U4QA 2X0OA 2N1DB 1Y1VA 2A69D 2X0PA 3CQZA 3GTOA 2VK9A 1TWCA 1EZBA 3LRDA 4C5RA 1HQMD 4BABA 3H0GA 4FBSA 2YIIA 1I3QA 2N3EA 2MX9A 2FIOA 3GTQA 2JA7A 1W27A 1TWFA 2K3NA 3EZEA 1R9TA 2BE5D 3LR6A 2MX8A 2LKMB 1WCMA 3EZBA 2O5JD 2A68D 2AQLA 1Y1WA 1ZYMA 1TWGA 2LTHA 3GTLA 2E2HA 2MP0A 1ZYRD 2E2IA 1EZAA 1IW7D
chains in the Genus database with same CATH topology
2K3OA 2F5JA 2JA6A 2VUMA 1I50A 1YNJD 3LR2A 1I6VD 2LPJA 2CW0D 2X0QA 3LR8A 2FIPA 4QIWA 1K83A 2LPIA 3GTPA 2B63A 1TWAA 2A6ED 2A6HD 2R7ZA 2R93A 2JA5A 3FKIA 4CEIA 3GTKA 3GTGA 1SFOA 5IZ2A 1SMYD 2YU9A 4CEHA 3GTJA 2MQAA 3GTMA 1TWHA 1YNND 2NVYA 2R92A 4CEJA 4C2MA 2LYIA 2K3QA 2Y0NA 2NVXA 3U44A 3U4QA 2X0OA 2N1DB 1Y1VA 2A69D 2X0PA 3CQZA 3GTOA 2VK9A 1TWCA 3LRDA 1HQMD 3H0GA 4FBSA 1I3QA 2N3EA 2MX9A 2FIOA 3GTQA 2JA7A 1TWFA 2K3NA 1R9TA 2BE5D 3LR6A 2MX8A 2LKMB 1WCMA 2O5JD 2A68D 2AQLA 1Y1WA 1TWGA 2LTHA 3GTLA 2E2HA 1ZYRD 2E2IA 1IW7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5J A;  2LKM B;  2Y0N A;  2N1D B;  2AQL A; 
#chains in the Genus database with same CATH topology
 1Y2M A;  2K3O A;  2F5J A;  2JA6 A;  2VUM A;  1I50 A;  1YNJ D;  2EZC A;  3NZ4 A;  3LR2 A;  1I6V D;  2LPJ A;  2CW0 D;  2X0Q A;  3LR8 A;  2FIP A;  2EZA A;  4C5S A;  4QIW A;  1K83 A;  2LPI A;  2HRO A;  3GTP A;  2B63 A;  1TWA A;  3EZA A;  2A6E D;  2A6H D;  4C6G A;  2R7Z A;  2R93 A;  4V2Q A;  2JA5 A;  3FKI A;  4C5U A;  4CEI A;  3GTG A;  3GTK A;  2EZB A;  1SFO A;  5IZ2 A;  1SMY D;  2YU9 A;  1T6P A;  4CEH A;  3GTJ A;  2MQA A;  3GTM A;  1TWH A;  1YNN D;  2NVY A;  2R92 A;  4CEJ A;  1T6J A;  4C2M A;  2HWG A;  2LYI A;  2K3Q A;  2Y0N A;  4CQ5 A;  2NVX A;  4BAA A;  3U44 A;  4V2R A;  3U4Q A;  2X0O A;  2N1D B;  1Y1V A;  2A69 D;  2X0P A;  3CQZ A;  3GTO A;  2VK9 A;  1TWC A;  1EZB A;  3LRD A;  4C5R A;  1HQM D;  4BAB A;  3H0G A;  4FBS A;  2YII A;  1I3Q A;  2N3E A;  2MX9 A;  2FIO A;  3GTQ A;  2JA7 A;  1W27 A;  1TWF A;  2K3N A;  3EZE A;  1R9T A;  2BE5 D;  3LR6 A;  2MX8 A;  2LKM B;  1WCM A;  3EZB A;  2O5J D;  2A68 D;  2AQL A;  1Y1W A;  1ZYM A;  1TWG A;  2LTH A;  3GTL A;  2E2H A;  2MP0 A;  1ZYR D;  2E2I A;  1EZA A;  1IW7 D; 
#chains in the Genus database with same CATH homology
 2K3O A;  2F5J A;  2JA6 A;  2VUM A;  1I50 A;  1YNJ D;  3LR2 A;  1I6V D;  2LPJ A;  2CW0 D;  2X0Q A;  3LR8 A;  2FIP A;  4QIW A;  1K83 A;  2LPI A;  3GTP A;  2B63 A;  1TWA A;  2A6E D;  2A6H D;  2R7Z A;  2R93 A;  2JA5 A;  3FKI A;  4CEI A;  3GTK A;  3GTG A;  1SFO A;  5IZ2 A;  1SMY D;  2YU9 A;  4CEH A;  3GTJ A;  2MQA A;  3GTM A;  1TWH A;  1YNN D;  2NVY A;  2R92 A;  4CEJ A;  4C2M A;  2LYI A;  2K3Q A;  2Y0N A;  2NVX A;  3U44 A;  3U4Q A;  2X0O A;  2N1D B;  1Y1V A;  2A69 D;  2X0P A;  3CQZ A;  3GTO A;  2VK9 A;  1TWC A;  3LRD A;  1HQM D;  3H0G A;  4FBS A;  1I3Q A;  2N3E A;  2MX9 A;  2FIO A;  3GTQ A;  2JA7 A;  1TWF A;  2K3N A;  1R9T A;  2BE5 D;  3LR6 A;  2MX8 A;  2LKM B;  1WCM A;  2O5J D;  2A68 D;  2AQL A;  1Y1W A;  1TWG A;  2LTH A;  3GTL A;  2E2H A;  1ZYR D;  2E2I A;  1IW7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...