2N1DB

Solution structure of the mrg15-mrgbp complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
172
structure length
172
Chain Sequence
SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRG/MORF4L-binding protein
publication title Structural Basis for Multi-specificity of MRG Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 54
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2n1dB00
2LKMB 2Y0NA 2F5JA 2N1DB 2AQLA
chains in the Genus database with same CATH superfamily
3CQZA 1SFOA 2B63A 2YIIA 4FBSA 2FIOA 2R7ZA 4BABA 2MX8A 2EZBA 4V2QA 1R9TA 2MX9A 4CEJA 1EZBA 2X0QA 2FIPA 1YNJD 2AQLA 3GTGA 4C2MA 3GTOA 2Y0NA 4C6GA 2LPIA 3GTMA 2R92A 1I3QA 3EZEA 1TWAA 4QIWA 1TWHA 1K83A 2O5JD 3EZAA 1YNND 1SMYD 3EZBA 3GTPA 2E2IA 3GTKA 2X0PA 1ZYRD 2N3EA 3GTJA 4CEIA 1WCMA 1Y1WA 3LR6A 1TWGA 2LYIA 2NVYA 1Y1VA 3U4QA 3NZ4A 2MP0A 3H0GA 1I50A 2VK9A 2EZCA 2HWGA 3LRDA 4V2RA 1T6JA 1TWCA 2JA7A 4CEHA 3LR2A 3GTLA 2BE5D 1W27A 1IW7D 2NVXA 1TWFA 2CW0D 3LR8A 2YU9A 3GTQA 2X0OA 2LKMB 1EZAA 1T6PA 2F5JA 1I6VD 2LPJA 1HQMD 2JA5A 4C5UA 4BAAA 3FKIA 4CQ5A 2A6ED 1ZYMA 2A6HD 2VUMA 1Y2MA 2E2HA 3U44A 2JA6A 2A69D 2K3OA 2A68D 4C5RA 2LTHA 2K3NA 2K3QA 2R93A 2EZAA 2HROA 2MQAA 2N1DB 4C5SA 5IZ2A
chains in the Genus database with same CATH topology
3CQZA 1SFOA 2B63A 4FBSA 2FIOA 2R7ZA 2MX8A 1R9TA 2MX9A 4CEJA 2X0QA 2FIPA 3GTGA 2AQLA 1YNJD 4C2MA 3GTOA 2Y0NA 2LPIA 3GTMA 2R92A 1I3QA 1TWAA 4QIWA 1TWHA 1K83A 2O5JD 1YNND 1SMYD 3GTPA 2E2IA 3GTKA 2X0PA 1ZYRD 2N3EA 3GTJA 4CEIA 1WCMA 1Y1WA 3LR6A 1TWGA 2LYIA 2NVYA 1Y1VA 3U4QA 3H0GA 1I50A 2VK9A 3LRDA 1TWCA 2JA7A 4CEHA 3LR2A 3GTLA 2BE5D 1IW7D 2NVXA 1TWFA 2CW0D 3LR8A 2YU9A 3GTQA 2X0OA 2LKMB 2F5JA 1I6VD 2LPJA 1HQMD 2JA5A 3FKIA 2A6ED 2A6HD 2VUMA 2E2HA 3U44A 2JA6A 2A69D 2K3OA 2A68D 2LTHA 2K3NA 2K3QA 2R93A 2MQAA 2N1DB 5IZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKM B;  2Y0N A;  2F5J A;  2N1D B;  2AQL A; 
#chains in the Genus database with same CATH topology
 3CQZ A;  1SFO A;  2B63 A;  2YII A;  4FBS A;  2FIO A;  2R7Z A;  4BAB A;  2MX8 A;  2EZB A;  4V2Q A;  1R9T A;  2MX9 A;  4CEJ A;  1EZB A;  2X0Q A;  2FIP A;  1YNJ D;  2AQL A;  3GTG A;  4C2M A;  3GTO A;  2Y0N A;  4C6G A;  2LPI A;  3GTM A;  2R92 A;  1I3Q A;  3EZE A;  1TWA A;  4QIW A;  1TWH A;  1K83 A;  2O5J D;  3EZA A;  1YNN D;  1SMY D;  3EZB A;  3GTP A;  2E2I A;  3GTK A;  2X0P A;  1ZYR D;  2N3E A;  3GTJ A;  4CEI A;  1WCM A;  1Y1W A;  3LR6 A;  1TWG A;  2LYI A;  2NVY A;  1Y1V A;  3U4Q A;  3NZ4 A;  2MP0 A;  3H0G A;  1I50 A;  2VK9 A;  2EZC A;  2HWG A;  3LRD A;  4V2R A;  1T6J A;  1TWC A;  2JA7 A;  4CEH A;  3LR2 A;  3GTL A;  2BE5 D;  1W27 A;  1IW7 D;  2NVX A;  1TWF A;  2CW0 D;  3LR8 A;  2YU9 A;  3GTQ A;  2X0O A;  2LKM B;  1EZA A;  1T6P A;  2F5J A;  1I6V D;  2LPJ A;  1HQM D;  2JA5 A;  4C5U A;  4BAA A;  3FKI A;  4CQ5 A;  2A6E D;  1ZYM A;  2A6H D;  2VUM A;  1Y2M A;  2E2H A;  3U44 A;  2JA6 A;  2A69 D;  2K3O A;  2A68 D;  4C5R A;  2LTH A;  2K3N A;  2K3Q A;  2R93 A;  2EZA A;  2HRO A;  2MQA A;  2N1D B;  4C5S A;  5IZ2 A; 
#chains in the Genus database with same CATH homology
 3CQZ A;  1SFO A;  2B63 A;  4FBS A;  2FIO A;  2R7Z A;  2MX8 A;  1R9T A;  2MX9 A;  4CEJ A;  2X0Q A;  2FIP A;  3GTG A;  2AQL A;  1YNJ D;  4C2M A;  3GTO A;  2Y0N A;  2LPI A;  3GTM A;  2R92 A;  1I3Q A;  1TWA A;  4QIW A;  1TWH A;  1K83 A;  2O5J D;  1YNN D;  1SMY D;  3GTP A;  2E2I A;  3GTK A;  2X0P A;  1ZYR D;  2N3E A;  3GTJ A;  4CEI A;  1WCM A;  1Y1W A;  3LR6 A;  1TWG A;  2LYI A;  2NVY A;  1Y1V A;  3U4Q A;  3H0G A;  1I50 A;  2VK9 A;  3LRD A;  1TWC A;  2JA7 A;  4CEH A;  3LR2 A;  3GTL A;  2BE5 D;  1IW7 D;  2NVX A;  1TWF A;  2CW0 D;  3LR8 A;  2YU9 A;  3GTQ A;  2X0O A;  2LKM B;  2F5J A;  1I6V D;  2LPJ A;  1HQM D;  2JA5 A;  3FKI A;  2A6E D;  2A6H D;  2VUM A;  2E2H A;  3U44 A;  2JA6 A;  2A69 D;  2K3O A;  2A68 D;  2LTH A;  2K3N A;  2K3Q A;  2R93 A;  2MQA A;  2N1D B;  5IZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...