2LPJA

Nmr structure of major ampullate spidroin 1 n-terminal domain at ph 7.2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 46
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lpjA01
3LR8A 2LPJA 2MX9A 3LR6A 2K3QA 2LPIA 3LR2A 4FBSA 2N3EA 5IZ2A 3LRDA 2LTHA 2MX8A
chains in the Genus database with same CATH superfamily
1Y1VA 1TWFA 4FBSA 2HWGA 2R92A 3FKIA 2JA5A 2E2IA 2K3QA 3EZEA 4C2MA 2R93A 2LYIA 2VK9A 1W27A 3LR6A 2AQLA 1TWAA 2JA7A 2E2HA 2MQAA 4C5SA 2N3EA 2FIOA 2MX8A 1Y1WA 4CEJA 1T6JA 2YIIA 3EZBA 3GTGA 4C5UA 2N1DB 2VUMA 2HROA 4V2RA 2CW0D 3H0GA 3U44A 1EZAA 3GTLA 4V2QA 3GTMA 2LPIA 1K83A 1T6PA 2A6ED 2LKMB 2X0QA 4CEHA 1R9TA 1I3QA 1SFOA 4C6GA 4BABA 2A6HD 1I6VD 4QIWA 3LR8A 1EZBA 1Y2MA 3GTJA 2B63A 2BE5D 2LPJA 3CQZA 2NVXA 3NZ4A 2EZCA 2X0OA 3GTOA 1YNJD 1ZYRD 2LTHA 1TWHA 2EZBA 2X0PA 2K3NA 1WCMA 3GTKA 2Y0NA 2R7ZA 3EZAA 3LR2A 1I50A 2FIPA 3GTPA 1TWCA 2F5JA 2NVYA 2K3OA 1SMYD 2A69D 2O5JD 4CEIA 5IZ2A 3U4QA 2JA6A 1YNND 4BAAA 2EZAA 4C5RA 2YU9A 1HQMD 2A68D 1ZYMA 2MX9A 1TWGA 2MP0A 3LRDA 3GTQA 4CQ5A 1IW7D
chains in the Genus database with same CATH topology
1Y1VA 1TWFA 4FBSA 2R92A 3FKIA 2JA5A 2E2IA 2K3QA 4C2MA 2R93A 2LYIA 2VK9A 3LR6A 2AQLA 1TWAA 2JA7A 2E2HA 2MQAA 2N3EA 2FIOA 2MX8A 1Y1WA 4CEJA 3GTGA 2N1DB 2VUMA 2CW0D 3H0GA 3U44A 3GTLA 3GTMA 2LPIA 1K83A 2A6ED 2LKMB 4CEHA 2X0QA 1R9TA 1I3QA 1SFOA 2A6HD 1I6VD 4QIWA 3LR8A 3GTJA 2B63A 2BE5D 2LPJA 3CQZA 2NVXA 2X0OA 3GTOA 1YNJD 1ZYRD 2LTHA 1TWHA 2X0PA 2K3NA 1WCMA 3GTKA 2Y0NA 2R7ZA 3LR2A 1I50A 2FIPA 3GTPA 1TWCA 2F5JA 2NVYA 2K3OA 1SMYD 2A69D 2O5JD 4CEIA 5IZ2A 3U4QA 2JA6A 1YNND 2YU9A 1HQMD 2A68D 2MX9A 1TWGA 3LRDA 3GTQA 1IW7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR8 A;  2LPJ A;  2MX9 A;  3LR6 A;  2K3Q A;  2LPI A;  3LR2 A;  4FBS A;  2N3E A;  5IZ2 A;  3LRD A;  2LTH A;  2MX8 A; 
#chains in the Genus database with same CATH topology
 1Y1V A;  1TWF A;  4FBS A;  2HWG A;  2R92 A;  3FKI A;  2JA5 A;  2E2I A;  2K3Q A;  3EZE A;  4C2M A;  2R93 A;  2LYI A;  2VK9 A;  1W27 A;  3LR6 A;  2AQL A;  1TWA A;  2JA7 A;  2E2H A;  2MQA A;  4C5S A;  2N3E A;  2FIO A;  2MX8 A;  1Y1W A;  4CEJ A;  1T6J A;  2YII A;  3EZB A;  3GTG A;  4C5U A;  2N1D B;  2VUM A;  2HRO A;  4V2R A;  2CW0 D;  3H0G A;  3U44 A;  1EZA A;  3GTL A;  4V2Q A;  3GTM A;  2LPI A;  1K83 A;  1T6P A;  2A6E D;  2LKM B;  2X0Q A;  4CEH A;  1R9T A;  1I3Q A;  1SFO A;  4C6G A;  4BAB A;  2A6H D;  1I6V D;  4QIW A;  3LR8 A;  1EZB A;  1Y2M A;  3GTJ A;  2B63 A;  2BE5 D;  2LPJ A;  3CQZ A;  2NVX A;  3NZ4 A;  2EZC A;  2X0O A;  3GTO A;  1YNJ D;  1ZYR D;  2LTH A;  1TWH A;  2EZB A;  2X0P A;  2K3N A;  1WCM A;  3GTK A;  2Y0N A;  2R7Z A;  3EZA A;  3LR2 A;  1I50 A;  2FIP A;  3GTP A;  1TWC A;  2F5J A;  2NVY A;  2K3O A;  1SMY D;  2A69 D;  2O5J D;  4CEI A;  5IZ2 A;  3U4Q A;  2JA6 A;  1YNN D;  4BAA A;  2EZA A;  4C5R A;  2YU9 A;  1HQM D;  2A68 D;  1ZYM A;  2MX9 A;  1TWG A;  2MP0 A;  3LRD A;  3GTQ A;  4CQ5 A;  1IW7 D; 
#chains in the Genus database with same CATH homology
 1Y1V A;  1TWF A;  4FBS A;  2R92 A;  3FKI A;  2JA5 A;  2E2I A;  2K3Q A;  4C2M A;  2R93 A;  2LYI A;  2VK9 A;  3LR6 A;  2AQL A;  1TWA A;  2JA7 A;  2E2H A;  2MQA A;  2N3E A;  2FIO A;  2MX8 A;  1Y1W A;  4CEJ A;  3GTG A;  2N1D B;  2VUM A;  2CW0 D;  3H0G A;  3U44 A;  3GTL A;  3GTM A;  2LPI A;  1K83 A;  2A6E D;  2LKM B;  4CEH A;  2X0Q A;  1R9T A;  1I3Q A;  1SFO A;  2A6H D;  1I6V D;  4QIW A;  3LR8 A;  3GTJ A;  2B63 A;  2BE5 D;  2LPJ A;  3CQZ A;  2NVX A;  2X0O A;  3GTO A;  1YNJ D;  1ZYR D;  2LTH A;  1TWH A;  2X0P A;  2K3N A;  1WCM A;  3GTK A;  2Y0N A;  2R7Z A;  3LR2 A;  1I50 A;  2FIP A;  3GTP A;  1TWC A;  2F5J A;  2NVY A;  2K3O A;  1SMY D;  2A69 D;  2O5J D;  4CEI A;  5IZ2 A;  3U4Q A;  2JA6 A;  1YNN D;  2YU9 A;  1HQM D;  2A68 D;  2MX9 A;  1TWG A;  3LRD A;  3GTQ A;  1IW7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...