2LPJA

Nmr structure of major ampullate spidroin 1 n-terminal domain at ph 7.2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 46
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lpjA01
2MX9A 3LR8A 2LPJA 3LR2A 2K3QA 2LTHA 4FBSA 3LR6A 2N3EA 3LRDA 2MX8A 5IZ2A 2LPIA
chains in the Genus database with same CATH superfamily
1T6JA 1TWCA 3GTLA 2EZAA 1YNJD 1Y1VA 2E2HA 1SMYD 1I3QA 2F5JA 3GTJA 4QIWA 3H0GA 2FIOA 2EZCA 3EZAA 4CEHA 2MP0A 3EZEA 3GTKA 4C5RA 2B63A 2A6HD 2K3OA 3GTMA 3NZ4A 2HWGA 1ZYRD 2LPJA 3LR2A 1ZYMA 3EZBA 1EZBA 1TWFA 2A6ED 2CW0D 2AQLA 3CQZA 2LKMB 2N1DB 4C5UA 2VK9A 1TWHA 4V2RA 2LTHA 3LR6A 1I6VD 1I50A 1WCMA 2A69D 4CEJA 2X0OA 2MX8A 3LR8A 2YU9A 3GTPA 4C5SA 2R92A 1T6PA 2X0QA 1W27A 2JA6A 2FIPA 2JA7A 1IW7D 3U4QA 4CEIA 1SFOA 2A68D 1Y1WA 2LYIA 1TWAA 2MQAA 4C2MA 1HQMD 3FKIA 4BABA 1Y2MA 2Y0NA 2YIIA 4CQ5A 2NVXA 5IZ2A 2LPIA 2MX9A 2O5JD 2R93A 2JA5A 1TWGA 2EZBA 3GTGA 2N3EA 1R9TA 2X0PA 3GTOA 2BE5D 4C6GA 4V2QA 2K3QA 2HROA 2NVYA 1EZAA 2VUMA 4BAAA 3GTQA 1YNND 2E2IA 2R7ZA 2K3NA 1K83A 4FBSA 3U44A 3LRDA
chains in the Genus database with same CATH topology
1TWCA 3GTLA 1YNJD 1Y1VA 2E2HA 1SMYD 1I3QA 2F5JA 3GTJA 4QIWA 3H0GA 2FIOA 4CEHA 3GTKA 2B63A 2A6HD 2K3OA 3GTMA 1ZYRD 2LPJA 3LR2A 1TWFA 2A6ED 2CW0D 2AQLA 3CQZA 2LKMB 2N1DB 2VK9A 1TWHA 2LTHA 3LR6A 1I6VD 1I50A 1WCMA 2A69D 4CEJA 2X0OA 2MX8A 3LR8A 2YU9A 2R92A 2X0QA 2JA6A 2FIPA 2JA7A 1IW7D 3U4QA 4CEIA 1SFOA 2A68D 1Y1WA 2LYIA 1TWAA 2MQAA 4C2MA 1HQMD 3FKIA 2Y0NA 2NVXA 5IZ2A 2LPIA 2MX9A 2O5JD 2R93A 2JA5A 1TWGA 3GTGA 2N3EA 1R9TA 2X0PA 3GTOA 2BE5D 2K3QA 2NVYA 2VUMA 3GTQA 1YNND 3LRDA 2E2IA 2R7ZA 2K3NA 1K83A 4FBSA 3U44A 3GTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MX9 A;  3LR8 A;  2LPJ A;  3LR2 A;  2K3Q A;  2LTH A;  4FBS A;  3LR6 A;  2N3E A;  3LRD A;  2MX8 A;  5IZ2 A;  2LPI A; 
#chains in the Genus database with same CATH topology
 1T6J A;  1TWC A;  3GTL A;  2EZA A;  1YNJ D;  1Y1V A;  2E2H A;  1SMY D;  1I3Q A;  2F5J A;  3GTJ A;  4QIW A;  3H0G A;  2FIO A;  2EZC A;  3EZA A;  4CEH A;  2MP0 A;  3EZE A;  3GTK A;  4C5R A;  2B63 A;  2A6H D;  2K3O A;  3GTM A;  3NZ4 A;  2HWG A;  1ZYR D;  2LPJ A;  3LR2 A;  1ZYM A;  3EZB A;  1EZB A;  1TWF A;  2A6E D;  2CW0 D;  2AQL A;  3CQZ A;  2LKM B;  2N1D B;  4C5U A;  2VK9 A;  1TWH A;  4V2R A;  2LTH A;  3LR6 A;  1I6V D;  1I50 A;  1WCM A;  2A69 D;  4CEJ A;  2X0O A;  2MX8 A;  3LR8 A;  2YU9 A;  3GTP A;  4C5S A;  2R92 A;  1T6P A;  2X0Q A;  1W27 A;  2JA6 A;  2FIP A;  2JA7 A;  1IW7 D;  3U4Q A;  4CEI A;  1SFO A;  2A68 D;  1Y1W A;  2LYI A;  1TWA A;  2MQA A;  4C2M A;  1HQM D;  3FKI A;  4BAB A;  1Y2M A;  2Y0N A;  2YII A;  4CQ5 A;  2NVX A;  5IZ2 A;  2LPI A;  2MX9 A;  2O5J D;  2R93 A;  2JA5 A;  1TWG A;  2EZB A;  3GTG A;  2N3E A;  1R9T A;  2X0P A;  3GTO A;  2BE5 D;  4C6G A;  4V2Q A;  2K3Q A;  2HRO A;  2NVY A;  1EZA A;  2VUM A;  4BAA A;  3GTQ A;  1YNN D;  2E2I A;  2R7Z A;  2K3N A;  1K83 A;  4FBS A;  3U44 A;  3LRD A; 
#chains in the Genus database with same CATH homology
 1TWC A;  3GTL A;  1YNJ D;  1Y1V A;  2E2H A;  1SMY D;  1I3Q A;  2F5J A;  3GTJ A;  4QIW A;  3H0G A;  2FIO A;  4CEH A;  3GTK A;  2B63 A;  2A6H D;  2K3O A;  3GTM A;  1ZYR D;  2LPJ A;  3LR2 A;  1TWF A;  2A6E D;  2CW0 D;  2AQL A;  3CQZ A;  2LKM B;  2N1D B;  2VK9 A;  1TWH A;  2LTH A;  3LR6 A;  1I6V D;  1I50 A;  1WCM A;  2A69 D;  4CEJ A;  2X0O A;  2MX8 A;  3LR8 A;  2YU9 A;  2R92 A;  2X0Q A;  2JA6 A;  2FIP A;  2JA7 A;  1IW7 D;  3U4Q A;  4CEI A;  1SFO A;  2A68 D;  1Y1W A;  2LYI A;  1TWA A;  2MQA A;  4C2M A;  1HQM D;  3FKI A;  2Y0N A;  2NVX A;  5IZ2 A;  2LPI A;  2MX9 A;  2O5J D;  2R93 A;  2JA5 A;  1TWG A;  3GTG A;  2N3E A;  1R9T A;  2X0P A;  3GTO A;  2BE5 D;  2K3Q A;  2NVY A;  2VUM A;  3GTQ A;  1YNN D;  3LRD A;  2E2I A;  2R7Z A;  2K3N A;  1K83 A;  4FBS A;  3U44 A;  3GTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...