2LPJA

Nmr structure of major ampullate spidroin 1 n-terminal domain at ph 7.2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
137
structure length
137
Chain Sequence
b'GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 46
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lpjA01
2LPJA 3LRDA 4FBSA 2K3QA 3LR8A 3LR2A 2N3EA 2LPIA 2LTHA 3LR6A 5IZ2A 2MX9A 2MX8A
chains in the Genus database with same CATH superfamily
4BAAA 2N1DB 2MQAA 3U44A 2E2IA 3LR2A 2O5JD 2LPIA 2JA5A 3GTOA 1TWHA 1I50A 2A69D 2R92A 1HQMD 2JA6A 1ZYRD 2FIPA 3EZBA 4CEJA 2JA7A 2MP0A 1TWGA 2LKMB 1EZAA 3LRDA 4C5RA 3GTKA 1ZYMA 3NZ4A 1R9TA 3EZEA 3GTJA 4C6GA 2FIOA 3EZAA 3GTGA 1WCMA 1Y2MA 3GTMA 2R7ZA 2EZBA 1TWAA 2E2HA 1TWCA 4CEHA 2A68D 2X0QA 4C5UA 3CQZA 2YIIA 4V2RA 2AQLA 3GTQA 2K3QA 2F5JA 2HROA 2K3NA 2VUMA 1SFOA 1I6VD 2EZCA 1T6PA 4CEIA 2NVXA 4C5SA 1T6JA 4FBSA 1EZBA 1YNJD 4BABA 1W27A 2LYIA 2EZAA 1SMYD 5IZ2A 2LPJA 1TWFA 1Y1WA 1I3QA 2K3OA 2MX9A 2BE5D 2B63A 1YNND 3FKIA 3GTLA 2HWGA 4C2MA 3GTPA 2N3EA 2X0PA 2LTHA 2CW0D 4CQ5A 2A6HD 4QIWA 3U4QA 1K83A 1Y1VA 2A6ED 2Y0NA 1IW7D 2R93A 2X0OA 2MX8A 3H0GA 2YU9A 4V2QA 3LR8A 3LR6A 2VK9A 2NVYA
chains in the Genus database with same CATH topology
2N1DB 2MQAA 3U44A 2E2IA 3LR2A 2O5JD 2LPIA 2JA5A 3GTOA 1TWHA 1I50A 2A69D 2R92A 1HQMD 2JA6A 1ZYRD 2FIPA 4CEJA 2JA7A 1TWGA 2LKMB 3LRDA 3GTKA 1R9TA 3GTJA 2FIOA 3GTGA 1WCMA 3GTMA 2R7ZA 2E2HA 1TWAA 1TWCA 4CEHA 2A68D 2X0QA 3CQZA 2AQLA 3GTQA 2K3QA 2F5JA 2K3NA 2VUMA 1SFOA 1I6VD 4CEIA 2NVXA 4FBSA 1YNJD 2LYIA 1SMYD 5IZ2A 2LPJA 1TWFA 1Y1WA 1I3QA 2K3OA 2MX9A 2BE5D 2B63A 1YNND 3FKIA 3GTLA 4C2MA 3GTPA 2N3EA 2X0PA 2LTHA 2CW0D 2A6HD 4QIWA 3U4QA 1K83A 1Y1VA 2A6ED 2Y0NA 1IW7D 2R93A 2X0OA 2MX8A 3H0GA 2YU9A 3LR8A 3LR6A 2VK9A 2NVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPJ A;  3LRD A;  4FBS A;  2K3Q A;  3LR8 A;  3LR2 A;  2N3E A;  2LPI A;  2LTH A;  3LR6 A;  5IZ2 A;  2MX9 A;  2MX8 A; 
#chains in the Genus database with same CATH topology
 4BAA A;  2N1D B;  2MQA A;  3U44 A;  2E2I A;  3LR2 A;  2O5J D;  2LPI A;  2JA5 A;  3GTO A;  1TWH A;  1I50 A;  2A69 D;  2R92 A;  1HQM D;  2JA6 A;  1ZYR D;  2FIP A;  3EZB A;  4CEJ A;  2JA7 A;  2MP0 A;  1TWG A;  2LKM B;  1EZA A;  3LRD A;  4C5R A;  3GTK A;  1ZYM A;  3NZ4 A;  1R9T A;  3EZE A;  3GTJ A;  4C6G A;  2FIO A;  3EZA A;  3GTG A;  1WCM A;  1Y2M A;  3GTM A;  2R7Z A;  2EZB A;  1TWA A;  2E2H A;  1TWC A;  4CEH A;  2A68 D;  2X0Q A;  4C5U A;  3CQZ A;  2YII A;  4V2R A;  2AQL A;  3GTQ A;  2K3Q A;  2F5J A;  2HRO A;  2K3N A;  2VUM A;  1SFO A;  1I6V D;  2EZC A;  1T6P A;  4CEI A;  2NVX A;  4C5S A;  1T6J A;  4FBS A;  1EZB A;  1YNJ D;  4BAB A;  1W27 A;  2LYI A;  2EZA A;  1SMY D;  5IZ2 A;  2LPJ A;  1TWF A;  1Y1W A;  1I3Q A;  2K3O A;  2MX9 A;  2BE5 D;  2B63 A;  1YNN D;  3FKI A;  3GTL A;  2HWG A;  4C2M A;  3GTP A;  2N3E A;  2X0P A;  2LTH A;  2CW0 D;  4CQ5 A;  2A6H D;  4QIW A;  3U4Q A;  1K83 A;  1Y1V A;  2A6E D;  2Y0N A;  1IW7 D;  2R93 A;  2X0O A;  2MX8 A;  3H0G A;  2YU9 A;  4V2Q A;  3LR8 A;  3LR6 A;  2VK9 A;  2NVY A; 
#chains in the Genus database with same CATH homology
 2N1D B;  2MQA A;  3U44 A;  2E2I A;  3LR2 A;  2O5J D;  2LPI A;  2JA5 A;  3GTO A;  1TWH A;  1I50 A;  2A69 D;  2R92 A;  1HQM D;  2JA6 A;  1ZYR D;  2FIP A;  4CEJ A;  2JA7 A;  1TWG A;  2LKM B;  3LRD A;  3GTK A;  1R9T A;  3GTJ A;  2FIO A;  3GTG A;  1WCM A;  3GTM A;  2R7Z A;  2E2H A;  1TWA A;  1TWC A;  4CEH A;  2A68 D;  2X0Q A;  3CQZ A;  2AQL A;  3GTQ A;  2K3Q A;  2F5J A;  2K3N A;  2VUM A;  1SFO A;  1I6V D;  4CEI A;  2NVX A;  4FBS A;  1YNJ D;  2LYI A;  1SMY D;  5IZ2 A;  2LPJ A;  1TWF A;  1Y1W A;  1I3Q A;  2K3O A;  2MX9 A;  2BE5 D;  2B63 A;  1YNN D;  3FKI A;  3GTL A;  4C2M A;  3GTP A;  2N3E A;  2X0P A;  2LTH A;  2CW0 D;  2A6H D;  4QIW A;  3U4Q A;  1K83 A;  1Y1V A;  2A6E D;  2Y0N A;  1IW7 D;  2R93 A;  2X0O A;  2MX8 A;  3H0G A;  2YU9 A;  3LR8 A;  3LR6 A;  2VK9 A;  2NVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...