2LPJA

Nmr structure of major ampullate spidroin 1 n-terminal domain at ph 7.2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
total genus 46
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lpjA01
2LTHA 2MX8A 3LR2A 2K3QA 2MX9A 5IZ2A 2N3EA 3LR8A 3LRDA 3LR6A 4FBSA 2LPJA 2LPIA
chains in the Genus database with same CATH superfamily
2A69D 5IZ2A 2R7ZA 2LPIA 1I3QA 2VUMA 4C5RA 2B63A 1EZAA 3LR8A 2A6HD 2N1DB 3GTGA 1K83A 2LKMB 1TWCA 4QIWA 2K3OA 1SMYD 4FBSA 2LPJA 4V2RA 2X0QA 2F5JA 1ZYRD 4V2QA 2JA7A 1TWGA 1I6VD 3LR2A 2JA6A 2X0PA 1T6JA 3GTKA 1WCMA 3U4QA 2FIOA 2MP0A 3H0GA 2E2HA 2K3QA 2N3EA 4CEIA 3EZAA 2YU9A 2A6ED 1TWAA 2BE5D 1HQMD 3GTOA 1T6PA 2X0OA 3FKIA 2VK9A 3EZEA 2EZAA 2MX9A 1W27A 2E2IA 4C5SA 2MQAA 3NZ4A 1I50A 2LTHA 1IW7D 2R92A 1TWFA 1Y1WA 4CEJA 3CQZA 2HROA 3GTQA 1SFOA 2R93A 2YIIA 2CW0D 1R9TA 1YNJD 3LRDA 2A68D 2JA5A 3GTJA 2FIPA 2Y0NA 1Y2MA 2EZCA 2O5JD 2NVYA 3U44A 1EZBA 4C6GA 1Y1VA 4CEHA 4C2MA 2AQLA 2EZBA 3GTMA 2NVXA 3GTLA 3LR6A 1TWHA 1ZYMA 2HWGA 1YNND 3EZBA 2MX8A 2K3NA 4BAAA 3GTPA 4CQ5A 4BABA 4C5UA 2LYIA
chains in the Genus database with same CATH topology
2A69D 5IZ2A 2R7ZA 2LPIA 1I3QA 2VUMA 2B63A 3LR8A 2A6HD 2N1DB 3GTGA 1K83A 2LKMB 1TWCA 4QIWA 2K3OA 1SMYD 4FBSA 2LPJA 2X0QA 2F5JA 1ZYRD 2JA7A 1TWGA 1I6VD 3LR2A 2JA6A 2X0PA 3GTKA 1WCMA 3U4QA 2FIOA 3H0GA 2E2HA 2K3QA 2N3EA 4CEIA 2YU9A 2A6ED 1TWAA 2BE5D 1HQMD 3GTOA 2X0OA 3FKIA 2VK9A 2MX9A 2E2IA 2MQAA 1I50A 2LTHA 1IW7D 2R92A 1TWFA 1Y1WA 4CEJA 3CQZA 3GTQA 2R93A 1SFOA 2CW0D 1R9TA 1YNJD 3LRDA 2A68D 2JA5A 3GTJA 2FIPA 2Y0NA 2O5JD 2NVYA 3U44A 1Y1VA 4CEHA 4C2MA 2AQLA 3GTMA 2NVXA 3GTLA 3LR6A 1TWHA 1YNND 2MX8A 2K3NA 3GTPA 2LYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTH A;  2MX8 A;  3LR2 A;  2K3Q A;  2MX9 A;  5IZ2 A;  2N3E A;  3LR8 A;  3LRD A;  3LR6 A;  4FBS A;  2LPJ A;  2LPI A; 
#chains in the Genus database with same CATH topology
 2A69 D;  5IZ2 A;  2R7Z A;  2LPI A;  1I3Q A;  2VUM A;  4C5R A;  2B63 A;  1EZA A;  3LR8 A;  2A6H D;  2N1D B;  3GTG A;  1K83 A;  2LKM B;  1TWC A;  4QIW A;  2K3O A;  1SMY D;  4FBS A;  2LPJ A;  4V2R A;  2X0Q A;  2F5J A;  1ZYR D;  4V2Q A;  2JA7 A;  1TWG A;  1I6V D;  3LR2 A;  2JA6 A;  2X0P A;  1T6J A;  3GTK A;  1WCM A;  3U4Q A;  2FIO A;  2MP0 A;  3H0G A;  2E2H A;  2K3Q A;  2N3E A;  4CEI A;  3EZA A;  2YU9 A;  2A6E D;  1TWA A;  2BE5 D;  1HQM D;  3GTO A;  1T6P A;  2X0O A;  3FKI A;  2VK9 A;  3EZE A;  2EZA A;  2MX9 A;  1W27 A;  2E2I A;  4C5S A;  2MQA A;  3NZ4 A;  1I50 A;  2LTH A;  1IW7 D;  2R92 A;  1TWF A;  1Y1W A;  4CEJ A;  3CQZ A;  2HRO A;  3GTQ A;  1SFO A;  2R93 A;  2YII A;  2CW0 D;  1R9T A;  1YNJ D;  3LRD A;  2A68 D;  2JA5 A;  3GTJ A;  2FIP A;  2Y0N A;  1Y2M A;  2EZC A;  2O5J D;  2NVY A;  3U44 A;  1EZB A;  4C6G A;  1Y1V A;  4CEH A;  4C2M A;  2AQL A;  2EZB A;  3GTM A;  2NVX A;  3GTL A;  3LR6 A;  1TWH A;  1ZYM A;  2HWG A;  1YNN D;  3EZB A;  2MX8 A;  2K3N A;  4BAA A;  3GTP A;  4CQ5 A;  4BAB A;  4C5U A;  2LYI A; 
#chains in the Genus database with same CATH homology
 2A69 D;  5IZ2 A;  2R7Z A;  2LPI A;  1I3Q A;  2VUM A;  2B63 A;  3LR8 A;  2A6H D;  2N1D B;  3GTG A;  1K83 A;  2LKM B;  1TWC A;  4QIW A;  2K3O A;  1SMY D;  4FBS A;  2LPJ A;  2X0Q A;  2F5J A;  1ZYR D;  2JA7 A;  1TWG A;  1I6V D;  3LR2 A;  2JA6 A;  2X0P A;  3GTK A;  1WCM A;  3U4Q A;  2FIO A;  3H0G A;  2E2H A;  2K3Q A;  2N3E A;  4CEI A;  2YU9 A;  2A6E D;  1TWA A;  2BE5 D;  1HQM D;  3GTO A;  2X0O A;  3FKI A;  2VK9 A;  2MX9 A;  2E2I A;  2MQA A;  1I50 A;  2LTH A;  1IW7 D;  2R92 A;  1TWF A;  1Y1W A;  4CEJ A;  3CQZ A;  3GTQ A;  2R93 A;  1SFO A;  2CW0 D;  1R9T A;  1YNJ D;  3LRD A;  2A68 D;  2JA5 A;  3GTJ A;  2FIP A;  2Y0N A;  2O5J D;  2NVY A;  3U44 A;  1Y1V A;  4CEH A;  4C2M A;  2AQL A;  3GTM A;  2NVX A;  3GTL A;  3LR6 A;  1TWH A;  1YNN D;  2MX8 A;  2K3N A;  3GTP A;  2LYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...