2F5JA

Crystal structure of mrg domain from human mrg15
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
157
Chain Sequence
VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mortality factor 4-like protein 1
publication title The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 55
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2f5jA00
2N1DB 2LKMB 2Y0NA 2F5JA 2AQLA
chains in the Genus database with same CATH superfamily
2X0PA 3GTMA 1W27A 2VK9A 1I6VD 4CQ5A 1EZBA 3FKIA 1Y2MA 1EZAA 1TWCA 3LR2A 4C6GA 4C5RA 1HQMD 3EZAA 4C2MA 1Y1VA 3GTJA 2R7ZA 2R92A 2E2HA 1I3QA 2X0OA 2F5JA 2HROA 4BAAA 1T6PA 1ZYMA 2A69D 1TWFA 2NVYA 2LYIA 3EZBA 2Y0NA 3H0GA 2FIPA 2JA6A 3U4QA 2A6ED 2K3OA 3U44A 2LPJA 2NVXA 2MX8A 2K3QA 2LTHA 1SMYD 1ZYRD 1YNND 4CEIA 4CEHA 2B63A 2BE5D 2A68D 2A6HD 1Y1WA 4C5SA 1K83A 2MQAA 3LR6A 3GTGA 3GTOA 3GTPA 5IZ2A 1IW7D 2JA7A 2X0QA 2MP0A 1TWGA 2EZCA 3LR8A 2N3EA 2EZAA 1R9TA 4BABA 4CEJA 2FIOA 2O5JD 3NZ4A 2AQLA 1SFOA 3EZEA 3GTKA 1TWHA 2LPIA 1YNJD 2MX9A 3LRDA 2E2IA 2LKMB 1TWAA 1I50A 2VUMA 2R93A 2YU9A 2N1DB 2JA5A 2CW0D 2YIIA 4QIWA 2EZBA 2HWGA 1T6JA 1WCMA 4V2RA 3CQZA 3GTQA 3GTLA 4C5UA 4FBSA 2K3NA 4V2QA
chains in the Genus database with same CATH topology
2X0PA 3GTMA 2VK9A 1I6VD 3FKIA 1TWCA 3LR2A 1HQMD 4C2MA 1Y1VA 3GTJA 2R7ZA 2R92A 2E2HA 1I3QA 2X0OA 2F5JA 2A69D 1TWFA 2NVYA 2LYIA 2Y0NA 3H0GA 2FIPA 2JA6A 3U4QA 2A6ED 2K3OA 3U44A 2LPJA 2NVXA 2MX8A 2K3QA 2LTHA 1SMYD 1ZYRD 1YNND 4CEIA 4CEHA 2B63A 2BE5D 2A68D 2A6HD 1Y1WA 1K83A 2MQAA 3LR6A 3GTGA 3GTOA 3GTPA 5IZ2A 1IW7D 2JA7A 2X0QA 1TWGA 3LR8A 2N3EA 1R9TA 4CEJA 2FIOA 2O5JD 2AQLA 1SFOA 3GTKA 1TWHA 2LPIA 1YNJD 2MX9A 3LRDA 2E2IA 2LKMB 1I50A 1TWAA 2VUMA 2R93A 2YU9A 2N1DB 2JA5A 2CW0D 4QIWA 1WCMA 3CQZA 3GTQA 3GTLA 4FBSA 2K3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1D B;  2LKM B;  2Y0N A;  2F5J A;  2AQL A; 
#chains in the Genus database with same CATH topology
 2X0P A;  3GTM A;  1W27 A;  2VK9 A;  1I6V D;  4CQ5 A;  1EZB A;  3FKI A;  1Y2M A;  1EZA A;  1TWC A;  3LR2 A;  4C6G A;  4C5R A;  1HQM D;  3EZA A;  4C2M A;  1Y1V A;  3GTJ A;  2R7Z A;  2R92 A;  2E2H A;  1I3Q A;  2X0O A;  2F5J A;  2HRO A;  4BAA A;  1T6P A;  1ZYM A;  2A69 D;  1TWF A;  2NVY A;  2LYI A;  3EZB A;  2Y0N A;  3H0G A;  2FIP A;  2JA6 A;  3U4Q A;  2A6E D;  2K3O A;  3U44 A;  2LPJ A;  2NVX A;  2MX8 A;  2K3Q A;  2LTH A;  1SMY D;  1ZYR D;  1YNN D;  4CEI A;  4CEH A;  2B63 A;  2BE5 D;  2A68 D;  2A6H D;  1Y1W A;  4C5S A;  1K83 A;  2MQA A;  3LR6 A;  3GTG A;  3GTO A;  3GTP A;  5IZ2 A;  1IW7 D;  2JA7 A;  2X0Q A;  2MP0 A;  1TWG A;  2EZC A;  3LR8 A;  2N3E A;  2EZA A;  1R9T A;  4BAB A;  4CEJ A;  2FIO A;  2O5J D;  3NZ4 A;  2AQL A;  1SFO A;  3EZE A;  3GTK A;  1TWH A;  2LPI A;  1YNJ D;  2MX9 A;  3LRD A;  2E2I A;  2LKM B;  1TWA A;  1I50 A;  2VUM A;  2R93 A;  2YU9 A;  2N1D B;  2JA5 A;  2CW0 D;  2YII A;  4QIW A;  2EZB A;  2HWG A;  1T6J A;  1WCM A;  4V2R A;  3CQZ A;  3GTQ A;  3GTL A;  4C5U A;  4FBS A;  2K3N A;  4V2Q A; 
#chains in the Genus database with same CATH homology
 2X0P A;  3GTM A;  2VK9 A;  1I6V D;  3FKI A;  1TWC A;  3LR2 A;  1HQM D;  4C2M A;  1Y1V A;  3GTJ A;  2R7Z A;  2R92 A;  2E2H A;  1I3Q A;  2X0O A;  2F5J A;  2A69 D;  1TWF A;  2NVY A;  2LYI A;  2Y0N A;  3H0G A;  2FIP A;  2JA6 A;  3U4Q A;  2A6E D;  2K3O A;  3U44 A;  2LPJ A;  2NVX A;  2MX8 A;  2K3Q A;  2LTH A;  1SMY D;  1ZYR D;  1YNN D;  4CEI A;  4CEH A;  2B63 A;  2BE5 D;  2A68 D;  2A6H D;  1Y1W A;  1K83 A;  2MQA A;  3LR6 A;  3GTG A;  3GTO A;  3GTP A;  5IZ2 A;  1IW7 D;  2JA7 A;  2X0Q A;  1TWG A;  3LR8 A;  2N3E A;  1R9T A;  4CEJ A;  2FIO A;  2O5J D;  2AQL A;  1SFO A;  3GTK A;  1TWH A;  2LPI A;  1YNJ D;  2MX9 A;  3LRD A;  2E2I A;  2LKM B;  1I50 A;  1TWA A;  2VUM A;  2R93 A;  2YU9 A;  2N1D B;  2JA5 A;  2CW0 D;  4QIW A;  1WCM A;  3CQZ A;  3GTQ A;  3GTL A;  4FBS A;  2K3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...