2F5JA

Crystal structure of mrg domain from human mrg15
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
157
Chain Sequence
b'VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mortality factor 4-like protein 1
publication title The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 55
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2f5jA00
2N1DB 2Y0NA 2AQLA 2F5JA 2LKMB
chains in the Genus database with same CATH superfamily
3EZAA 2LYIA 3GTOA 2HWGA 3LRDA 1HQMD 2E2HA 3EZEA 2JA6A 2MQAA 2R93A 4C5SA 3LR8A 4C2MA 1T6JA 1K83A 3U44A 3GTMA 2E2IA 2VK9A 1I50A 2K3OA 5IZ2A 2MX9A 2YIIA 2FIOA 3H0GA 4V2RA 4CEHA 1W27A 1SFOA 3CQZA 1Y2MA 2N3EA 4CEJA 2EZBA 4V2QA 1YNND 2R7ZA 2X0PA 1TWCA 3NZ4A 2EZAA 1ZYMA 1EZAA 2LTHA 1Y1WA 2AQLA 1TWGA 1T6PA 2X0QA 2N1DB 2BE5D 4C6GA 2NVXA 2NVYA 3EZBA 4BAAA 2O5JD 4FBSA 4C5UA 2LPIA 3GTPA 2YU9A 2MX8A 1EZBA 3U4QA 2R92A 2A69D 2Y0NA 1WCMA 2A68D 3FKIA 2X0OA 2K3NA 1I3QA 1YNJD 3LR6A 2JA5A 3GTQA 1IW7D 2F5JA 2LKMB 2A6ED 4C5RA 1R9TA 4QIWA 2A6HD 2EZCA 3GTGA 2CW0D 2HROA 3GTKA 3GTLA 1TWFA 1TWAA 2MP0A 2JA7A 2K3QA 1I6VD 3GTJA 4CQ5A 3LR2A 2LPJA 1Y1VA 1ZYRD 1SMYD 4CEIA 2B63A 1TWHA 4BABA 2VUMA 2FIPA
chains in the Genus database with same CATH topology
2LYIA 3GTOA 3LRDA 1HQMD 2E2HA 2JA6A 2MQAA 2R93A 3LR8A 4C2MA 1K83A 3U44A 3GTMA 2E2IA 2VK9A 1I50A 2K3OA 5IZ2A 2MX9A 2FIOA 3H0GA 4CEHA 1SFOA 3CQZA 2N3EA 4CEJA 1YNND 2R7ZA 2X0PA 1TWCA 2LTHA 1Y1WA 2AQLA 1TWGA 2X0QA 2N1DB 2BE5D 2NVXA 2NVYA 2O5JD 4FBSA 2LPIA 3GTPA 2YU9A 2MX8A 3U4QA 2R92A 2A69D 2Y0NA 1WCMA 2A68D 3FKIA 2X0OA 2K3NA 1I3QA 1YNJD 3LR6A 2JA5A 3GTQA 1IW7D 2F5JA 2LKMB 2A6ED 1R9TA 4QIWA 2A6HD 3GTGA 2CW0D 3GTKA 3GTLA 1TWFA 1TWAA 2JA7A 2K3QA 1I6VD 3GTJA 3LR2A 2LPJA 1Y1VA 1ZYRD 1SMYD 4CEIA 2B63A 1TWHA 2VUMA 2FIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1D B;  2Y0N A;  2AQL A;  2F5J A;  2LKM B; 
#chains in the Genus database with same CATH topology
 3EZA A;  2LYI A;  3GTO A;  2HWG A;  3LRD A;  1HQM D;  2E2H A;  3EZE A;  2JA6 A;  2MQA A;  2R93 A;  4C5S A;  3LR8 A;  4C2M A;  1T6J A;  1K83 A;  3U44 A;  3GTM A;  2E2I A;  2VK9 A;  1I50 A;  2K3O A;  5IZ2 A;  2MX9 A;  2YII A;  2FIO A;  3H0G A;  4V2R A;  4CEH A;  1W27 A;  1SFO A;  3CQZ A;  1Y2M A;  2N3E A;  4CEJ A;  2EZB A;  4V2Q A;  1YNN D;  2R7Z A;  2X0P A;  1TWC A;  3NZ4 A;  2EZA A;  1ZYM A;  1EZA A;  2LTH A;  1Y1W A;  2AQL A;  1TWG A;  1T6P A;  2X0Q A;  2N1D B;  2BE5 D;  4C6G A;  2NVX A;  2NVY A;  3EZB A;  4BAA A;  2O5J D;  4FBS A;  4C5U A;  2LPI A;  3GTP A;  2YU9 A;  2MX8 A;  1EZB A;  3U4Q A;  2R92 A;  2A69 D;  2Y0N A;  1WCM A;  2A68 D;  3FKI A;  2X0O A;  2K3N A;  1I3Q A;  1YNJ D;  3LR6 A;  2JA5 A;  3GTQ A;  1IW7 D;  2F5J A;  2LKM B;  2A6E D;  4C5R A;  1R9T A;  4QIW A;  2A6H D;  2EZC A;  3GTG A;  2CW0 D;  2HRO A;  3GTK A;  3GTL A;  1TWF A;  1TWA A;  2MP0 A;  2JA7 A;  2K3Q A;  1I6V D;  3GTJ A;  4CQ5 A;  3LR2 A;  2LPJ A;  1Y1V A;  1ZYR D;  1SMY D;  4CEI A;  2B63 A;  1TWH A;  4BAB A;  2VUM A;  2FIP A; 
#chains in the Genus database with same CATH homology
 2LYI A;  3GTO A;  3LRD A;  1HQM D;  2E2H A;  2JA6 A;  2MQA A;  2R93 A;  3LR8 A;  4C2M A;  1K83 A;  3U44 A;  3GTM A;  2E2I A;  2VK9 A;  1I50 A;  2K3O A;  5IZ2 A;  2MX9 A;  2FIO A;  3H0G A;  4CEH A;  1SFO A;  3CQZ A;  2N3E A;  4CEJ A;  1YNN D;  2R7Z A;  2X0P A;  1TWC A;  2LTH A;  1Y1W A;  2AQL A;  1TWG A;  2X0Q A;  2N1D B;  2BE5 D;  2NVX A;  2NVY A;  2O5J D;  4FBS A;  2LPI A;  3GTP A;  2YU9 A;  2MX8 A;  3U4Q A;  2R92 A;  2A69 D;  2Y0N A;  1WCM A;  2A68 D;  3FKI A;  2X0O A;  2K3N A;  1I3Q A;  1YNJ D;  3LR6 A;  2JA5 A;  3GTQ A;  1IW7 D;  2F5J A;  2LKM B;  2A6E D;  1R9T A;  4QIW A;  2A6H D;  3GTG A;  2CW0 D;  3GTK A;  3GTL A;  1TWF A;  1TWA A;  2JA7 A;  2K3Q A;  1I6V D;  3GTJ A;  3LR2 A;  2LPJ A;  1Y1V A;  1ZYR D;  1SMY D;  4CEI A;  2B63 A;  1TWH A;  2VUM A;  2FIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...