2F5JA

Crystal structure of mrg domain from human mrg15
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
157
Chain Sequence
b'VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mortality factor 4-like protein 1
publication title The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 55
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2f5jA00
2AQLA 2Y0NA 2F5JA 2LKMB 2N1DB
chains in the Genus database with same CATH superfamily
1Y2MA 2X0PA 3GTQA 3GTOA 1HQMD 2A69D 2NVYA 1YNJD 1ZYMA 2JA6A 1TWCA 2N1DB 1I50A 2A6ED 3CQZA 4QIWA 4CEIA 2Y0NA 2VUMA 4C5SA 1YNND 4FBSA 2MP0A 3EZAA 2R92A 2YU9A 4CEHA 3GTJA 1SFOA 3LRDA 1K83A 2K3NA 2F5JA 1EZBA 1TWFA 2MX8A 3U4QA 4C5UA 2K3QA 1TWHA 2HWGA 2A6HD 2YIIA 4V2QA 2LPIA 2LPJA 3GTMA 2LTHA 3GTPA 2X0OA 4CQ5A 3FKIA 2BE5D 3EZBA 2A68D 3EZEA 3GTKA 2JA7A 4C6GA 2E2HA 2R7ZA 1Y1WA 3LR2A 1W27A 2EZAA 1SMYD 2LYIA 1TWAA 1TWGA 4C5RA 1WCMA 2X0QA 2R93A 4BAAA 3LR6A 3NZ4A 1T6JA 2LKMB 2B63A 2AQLA 2MX9A 2FIOA 3U44A 4CEJA 2E2IA 1I3QA 2N3EA 2HROA 2NVXA 5IZ2A 3GTGA 1Y1VA 1EZAA 2CW0D 1R9TA 2FIPA 3H0GA 4V2RA 1IW7D 2VK9A 3GTLA 4C2MA 2O5JD 1I6VD 2EZCA 2JA5A 1ZYRD 1T6PA 4BABA 3LR8A 2MQAA 2EZBA 2K3OA
chains in the Genus database with same CATH topology
2X0PA 3GTQA 3GTOA 1HQMD 2A69D 2NVYA 1YNJD 2JA6A 1TWCA 2N1DB 1I50A 2A6ED 3CQZA 4QIWA 4CEIA 2Y0NA 2VUMA 1YNND 4FBSA 2R92A 2YU9A 4CEHA 3GTJA 1SFOA 3LRDA 1K83A 2K3NA 2F5JA 1TWFA 2MX8A 3U4QA 2K3QA 1TWHA 2A6HD 2LPIA 2LPJA 3GTMA 2LTHA 3GTPA 2X0OA 3FKIA 2BE5D 2A68D 3GTKA 2JA7A 2E2HA 2R7ZA 1Y1WA 3LR2A 2LYIA 1SMYD 1TWAA 1TWGA 1WCMA 2X0QA 2R93A 3LR6A 2LKMB 2B63A 2AQLA 2MX9A 2FIOA 3U44A 4CEJA 2E2IA 1I3QA 2N3EA 2NVXA 5IZ2A 3GTGA 1Y1VA 2CW0D 1R9TA 2FIPA 3H0GA 1IW7D 2VK9A 3GTLA 4C2MA 2O5JD 1I6VD 2JA5A 1ZYRD 3LR8A 2MQAA 2K3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQL A;  2Y0N A;  2F5J A;  2LKM B;  2N1D B; 
#chains in the Genus database with same CATH topology
 1Y2M A;  2X0P A;  3GTQ A;  3GTO A;  1HQM D;  2A69 D;  2NVY A;  1YNJ D;  1ZYM A;  2JA6 A;  1TWC A;  2N1D B;  1I50 A;  2A6E D;  3CQZ A;  4QIW A;  4CEI A;  2Y0N A;  2VUM A;  4C5S A;  1YNN D;  4FBS A;  2MP0 A;  3EZA A;  2R92 A;  2YU9 A;  4CEH A;  3GTJ A;  1SFO A;  3LRD A;  1K83 A;  2K3N A;  2F5J A;  1EZB A;  1TWF A;  2MX8 A;  3U4Q A;  4C5U A;  2K3Q A;  1TWH A;  2HWG A;  2A6H D;  2YII A;  4V2Q A;  2LPI A;  2LPJ A;  3GTM A;  2LTH A;  3GTP A;  2X0O A;  4CQ5 A;  3FKI A;  2BE5 D;  3EZB A;  2A68 D;  3EZE A;  3GTK A;  2JA7 A;  4C6G A;  2E2H A;  2R7Z A;  1Y1W A;  3LR2 A;  1W27 A;  2EZA A;  1SMY D;  2LYI A;  1TWA A;  1TWG A;  4C5R A;  1WCM A;  2X0Q A;  2R93 A;  4BAA A;  3LR6 A;  3NZ4 A;  1T6J A;  2LKM B;  2B63 A;  2AQL A;  2MX9 A;  2FIO A;  3U44 A;  4CEJ A;  2E2I A;  1I3Q A;  2N3E A;  2HRO A;  2NVX A;  5IZ2 A;  3GTG A;  1Y1V A;  1EZA A;  2CW0 D;  1R9T A;  2FIP A;  3H0G A;  4V2R A;  1IW7 D;  2VK9 A;  3GTL A;  4C2M A;  2O5J D;  1I6V D;  2EZC A;  2JA5 A;  1ZYR D;  1T6P A;  4BAB A;  3LR8 A;  2MQA A;  2EZB A;  2K3O A; 
#chains in the Genus database with same CATH homology
 2X0P A;  3GTQ A;  3GTO A;  1HQM D;  2A69 D;  2NVY A;  1YNJ D;  2JA6 A;  1TWC A;  2N1D B;  1I50 A;  2A6E D;  3CQZ A;  4QIW A;  4CEI A;  2Y0N A;  2VUM A;  1YNN D;  4FBS A;  2R92 A;  2YU9 A;  4CEH A;  3GTJ A;  1SFO A;  3LRD A;  1K83 A;  2K3N A;  2F5J A;  1TWF A;  2MX8 A;  3U4Q A;  2K3Q A;  1TWH A;  2A6H D;  2LPI A;  2LPJ A;  3GTM A;  2LTH A;  3GTP A;  2X0O A;  3FKI A;  2BE5 D;  2A68 D;  3GTK A;  2JA7 A;  2E2H A;  2R7Z A;  1Y1W A;  3LR2 A;  2LYI A;  1SMY D;  1TWA A;  1TWG A;  1WCM A;  2X0Q A;  2R93 A;  3LR6 A;  2LKM B;  2B63 A;  2AQL A;  2MX9 A;  2FIO A;  3U44 A;  4CEJ A;  2E2I A;  1I3Q A;  2N3E A;  2NVX A;  5IZ2 A;  3GTG A;  1Y1V A;  2CW0 D;  1R9T A;  2FIP A;  3H0G A;  1IW7 D;  2VK9 A;  3GTL A;  4C2M A;  2O5J D;  1I6V D;  2JA5 A;  1ZYR D;  3LR8 A;  2MQA A;  2K3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...