2F5JA

Crystal structure of mrg domain from human mrg15
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
157
Chain Sequence
b'VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14
pubmed doi rcsb
molecule keywords Mortality factor 4-like protein 1
source organism Homo sapiens
molecule tags Gene regulation
total genus 55
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2f5jA00
2Y0NA 2LKMB 2N1DB 2F5JA 2AQLA
chains in the Genus database with same CATH superfamily
2K3OA 2LTHA 2YU9A 2MX8A 3LR6A 4CEJA 2JA5A 2FIPA 1W27A 5IZ2A 2LPJA 1Y1WA 1I3QA 1ZYMA 2N1DB 1TWHA 3EZAA 2Y0NA 2EZCA 2YIIA 1TWAA 2VK9A 4V2QA 4CEHA 3GTOA 3U4QA 1I50A 1HQMD 4BABA 1K83A 1R9TA 4C5SA 3GTKA 1TWGA 2E2IA 1T6JA 2E2HA 4FBSA 1T6PA 3GTMA 2K3QA 2CW0D 1WCMA 3FKIA 3GTLA 1YNND 3EZEA 1ZYRD 2NVYA 3GTJA 4QIWA 2FIOA 2R93A 3CQZA 3LR8A 3GTQA 2EZBA 4CEIA 2N3EA 1SFOA 2A6HD 2A69D 2HROA 2NVXA 3GTGA 3LRDA 3NZ4A 1EZBA 1TWCA 2X0PA 2HWGA 2AQLA 1Y1VA 3EZBA 1YNJD 1Y2MA 4CQ5A 2F5JA 2MX9A 2K3NA 2MP0A 3H0GA 2R92A 2LPIA 4C5UA 2LYIA 1I6VD 2B63A 4C5RA 3LR2A 1EZAA 2MQAA 4C2MA 4V2RA 2EZAA 2A68D 2X0QA 4C6GA 2JA7A 1SMYD 2A6ED 1TWFA 2JA6A 1IW7D 2O5JD 2X0OA 2LKMB 4BAAA 3GTPA 3U44A 2VUMA 2BE5D 2R7ZA
chains in the Genus database with same CATH topology
2K3OA 2LTHA 2YU9A 2MX8A 3LR6A 4CEJA 2JA5A 2FIPA 5IZ2A 2LPJA 1Y1WA 1I3QA 2N1DB 1TWHA 2Y0NA 1TWAA 2VK9A 4CEHA 3GTOA 3U4QA 1I50A 1HQMD 1K83A 1R9TA 3GTKA 1TWGA 2E2IA 2E2HA 4FBSA 3GTMA 2K3QA 2CW0D 1WCMA 3FKIA 3GTLA 1YNND 1ZYRD 2NVYA 3GTJA 4QIWA 2FIOA 2R93A 3CQZA 3LR8A 3GTQA 4CEIA 2N3EA 1SFOA 2A6HD 2A69D 2NVXA 3GTGA 3LRDA 1TWCA 2X0PA 2AQLA 1Y1VA 1YNJD 2F5JA 2MX9A 2K3NA 3H0GA 2R92A 2LPIA 2LYIA 1I6VD 2B63A 3LR2A 2MQAA 4C2MA 2A68D 2X0QA 2JA7A 1SMYD 2A6ED 1TWFA 2JA6A 1IW7D 2O5JD 2X0OA 2LKMB 3GTPA 3U44A 2VUMA 2BE5D 2R7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0N A;  2LKM B;  2N1D B;  2F5J A;  2AQL A; 
#chains in the Genus database with same CATH topology
 2K3O A;  2LTH A;  2YU9 A;  2MX8 A;  3LR6 A;  4CEJ A;  2JA5 A;  2FIP A;  1W27 A;  5IZ2 A;  2LPJ A;  1Y1W A;  1I3Q A;  1ZYM A;  2N1D B;  1TWH A;  3EZA A;  2Y0N A;  2EZC A;  2YII A;  1TWA A;  2VK9 A;  4V2Q A;  4CEH A;  3GTO A;  3U4Q A;  1I50 A;  1HQM D;  4BAB A;  1K83 A;  1R9T A;  4C5S A;  3GTK A;  1TWG A;  2E2I A;  1T6J A;  2E2H A;  4FBS A;  1T6P A;  3GTM A;  2K3Q A;  2CW0 D;  1WCM A;  3FKI A;  3GTL A;  1YNN D;  3EZE A;  1ZYR D;  2NVY A;  3GTJ A;  4QIW A;  2FIO A;  2R93 A;  3CQZ A;  3LR8 A;  3GTQ A;  2EZB A;  4CEI A;  2N3E A;  1SFO A;  2A6H D;  2A69 D;  2HRO A;  2NVX A;  3GTG A;  3LRD A;  3NZ4 A;  1EZB A;  1TWC A;  2X0P A;  2HWG A;  2AQL A;  1Y1V A;  3EZB A;  1YNJ D;  1Y2M A;  4CQ5 A;  2F5J A;  2MX9 A;  2K3N A;  2MP0 A;  3H0G A;  2R92 A;  2LPI A;  4C5U A;  2LYI A;  1I6V D;  2B63 A;  4C5R A;  3LR2 A;  1EZA A;  2MQA A;  4C2M A;  4V2R A;  2EZA A;  2A68 D;  2X0Q A;  4C6G A;  2JA7 A;  1SMY D;  2A6E D;  1TWF A;  2JA6 A;  1IW7 D;  2O5J D;  2X0O A;  2LKM B;  4BAA A;  3GTP A;  3U44 A;  2VUM A;  2BE5 D;  2R7Z A; 
#chains in the Genus database with same CATH homology
 2K3O A;  2LTH A;  2YU9 A;  2MX8 A;  3LR6 A;  4CEJ A;  2JA5 A;  2FIP A;  5IZ2 A;  2LPJ A;  1Y1W A;  1I3Q A;  2N1D B;  1TWH A;  2Y0N A;  1TWA A;  2VK9 A;  4CEH A;  3GTO A;  3U4Q A;  1I50 A;  1HQM D;  1K83 A;  1R9T A;  3GTK A;  1TWG A;  2E2I A;  2E2H A;  4FBS A;  3GTM A;  2K3Q A;  2CW0 D;  1WCM A;  3FKI A;  3GTL A;  1YNN D;  1ZYR D;  2NVY A;  3GTJ A;  4QIW A;  2FIO A;  2R93 A;  3CQZ A;  3LR8 A;  3GTQ A;  4CEI A;  2N3E A;  1SFO A;  2A6H D;  2A69 D;  2NVX A;  3GTG A;  3LRD A;  1TWC A;  2X0P A;  2AQL A;  1Y1V A;  1YNJ D;  2F5J A;  2MX9 A;  2K3N A;  3H0G A;  2R92 A;  2LPI A;  2LYI A;  1I6V D;  2B63 A;  3LR2 A;  2MQA A;  4C2M A;  2A68 D;  2X0Q A;  2JA7 A;  1SMY D;  2A6E D;  1TWF A;  2JA6 A;  1IW7 D;  2O5J D;  2X0O A;  2LKM B;  3GTP A;  3U44 A;  2VUM A;  2BE5 D;  2R7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...