2F5JA

Crystal structure of mrg domain from human mrg15
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
157
Chain Sequence
VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Mortality factor 4-like protein 1
total genus 55
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2f5jA00
2AQLA 2N1DB 2Y0NA 2LKMB 2F5JA
chains in the Genus database with same CATH superfamily
2AQLA 4V2RA 5IZ2A 1ZYRD 3LRDA 3GTLA 2LPIA 2X0PA 2E2HA 3GTKA 2FIOA 2VK9A 2MX9A 2CW0D 2A6HD 2JA7A 2Y0NA 4CEHA 2K3OA 3LR2A 1ZYMA 3U4QA 3H0GA 3LR8A 2VUMA 2YIIA 4FBSA 2X0OA 1K83A 3GTGA 2N3EA 4CEIA 2F5JA 2LTHA 1I6VD 1TWHA 2YU9A 2A69D 4C6GA 2LPJA 2R92A 1IW7D 2EZAA 2LKMB 4C5UA 1SMYD 3EZAA 4C5RA 1R9TA 1EZBA 2LYIA 2O5JD 2NVYA 2MX8A 4C5SA 1WCMA 2E2IA 1T6JA 4CQ5A 1Y1VA 2X0QA 3NZ4A 3CQZA 2FIPA 4QIWA 2MP0A 1Y1WA 2MQAA 3GTMA 1W27A 1HQMD 2HROA 4C2MA 1EZAA 3EZEA 2N1DB 3FKIA 3U44A 3EZBA 4CEJA 2EZBA 3LR6A 1I3QA 2A68D 2K3NA 2K3QA 4BAAA 1TWFA 1TWGA 2NVXA 2A6ED 2JA5A 3GTOA 1T6PA 4V2QA 1TWCA 1YNND 1I50A 2BE5D 3GTJA 3GTPA 2JA6A 1YNJD 1SFOA 2B63A 2HWGA 2EZCA 1Y2MA 1TWAA 2R93A 4BABA 3GTQA 2R7ZA
chains in the Genus database with same CATH topology
2AQLA 5IZ2A 1ZYRD 3LRDA 3GTLA 2LPIA 2X0PA 2E2HA 3GTKA 2FIOA 2VK9A 2MX9A 2CW0D 2A6HD 2JA7A 2Y0NA 4CEHA 2K3OA 3LR2A 3U4QA 3H0GA 3LR8A 2VUMA 4FBSA 2X0OA 1K83A 3GTGA 2N3EA 4CEIA 2F5JA 2LTHA 1I6VD 1TWHA 2YU9A 2A69D 2LPJA 2R92A 1IW7D 2LKMB 1SMYD 1R9TA 2LYIA 2O5JD 2NVYA 2MX8A 2E2IA 1WCMA 1Y1VA 2X0QA 3CQZA 2FIPA 4QIWA 1Y1WA 2MQAA 3GTMA 1HQMD 4C2MA 2N1DB 3FKIA 3U44A 4CEJA 3LR6A 1I3QA 2A68D 2K3NA 2K3QA 1TWFA 1TWGA 2NVXA 2A6ED 2JA5A 3GTOA 1TWCA 1YNND 1I50A 2BE5D 3GTJA 3GTPA 2JA6A 1YNJD 1SFOA 2B63A 1TWAA 2R93A 3GTQA 2R7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQL A;  2N1D B;  2Y0N A;  2LKM B;  2F5J A; 
#chains in the Genus database with same CATH topology
 2AQL A;  4V2R A;  5IZ2 A;  1ZYR D;  3LRD A;  3GTL A;  2LPI A;  2X0P A;  2E2H A;  3GTK A;  2FIO A;  2VK9 A;  2MX9 A;  2CW0 D;  2A6H D;  2JA7 A;  2Y0N A;  4CEH A;  2K3O A;  3LR2 A;  1ZYM A;  3U4Q A;  3H0G A;  3LR8 A;  2VUM A;  2YII A;  4FBS A;  2X0O A;  1K83 A;  3GTG A;  2N3E A;  4CEI A;  2F5J A;  2LTH A;  1I6V D;  1TWH A;  2YU9 A;  2A69 D;  4C6G A;  2LPJ A;  2R92 A;  1IW7 D;  2EZA A;  2LKM B;  4C5U A;  1SMY D;  3EZA A;  4C5R A;  1R9T A;  1EZB A;  2LYI A;  2O5J D;  2NVY A;  2MX8 A;  4C5S A;  1WCM A;  2E2I A;  1T6J A;  4CQ5 A;  1Y1V A;  2X0Q A;  3NZ4 A;  3CQZ A;  2FIP A;  4QIW A;  2MP0 A;  1Y1W A;  2MQA A;  3GTM A;  1W27 A;  1HQM D;  2HRO A;  4C2M A;  1EZA A;  3EZE A;  2N1D B;  3FKI A;  3U44 A;  3EZB A;  4CEJ A;  2EZB A;  3LR6 A;  1I3Q A;  2A68 D;  2K3N A;  2K3Q A;  4BAA A;  1TWF A;  1TWG A;  2NVX A;  2A6E D;  2JA5 A;  3GTO A;  1T6P A;  4V2Q A;  1TWC A;  1YNN D;  1I50 A;  2BE5 D;  3GTJ A;  3GTP A;  2JA6 A;  1YNJ D;  1SFO A;  2B63 A;  2HWG A;  2EZC A;  1Y2M A;  1TWA A;  2R93 A;  4BAB A;  3GTQ A;  2R7Z A; 
#chains in the Genus database with same CATH homology
 2AQL A;  5IZ2 A;  1ZYR D;  3LRD A;  3GTL A;  2LPI A;  2X0P A;  2E2H A;  3GTK A;  2FIO A;  2VK9 A;  2MX9 A;  2CW0 D;  2A6H D;  2JA7 A;  2Y0N A;  4CEH A;  2K3O A;  3LR2 A;  3U4Q A;  3H0G A;  3LR8 A;  2VUM A;  4FBS A;  2X0O A;  1K83 A;  3GTG A;  2N3E A;  4CEI A;  2F5J A;  2LTH A;  1I6V D;  1TWH A;  2YU9 A;  2A69 D;  2LPJ A;  2R92 A;  1IW7 D;  2LKM B;  1SMY D;  1R9T A;  2LYI A;  2O5J D;  2NVY A;  2MX8 A;  2E2I A;  1WCM A;  1Y1V A;  2X0Q A;  3CQZ A;  2FIP A;  4QIW A;  1Y1W A;  2MQA A;  3GTM A;  1HQM D;  4C2M A;  2N1D B;  3FKI A;  3U44 A;  4CEJ A;  3LR6 A;  1I3Q A;  2A68 D;  2K3N A;  2K3Q A;  1TWF A;  1TWG A;  2NVX A;  2A6E D;  2JA5 A;  3GTO A;  1TWC A;  1YNN D;  1I50 A;  2BE5 D;  3GTJ A;  3GTP A;  2JA6 A;  1YNJ D;  1SFO A;  2B63 A;  1TWA A;  2R93 A;  3GTQ A;  2R7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...