2F5JA

Crystal structure of mrg domain from human mrg15
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
157
Chain Sequence
VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Mortality factor 4-like protein 1
publication title The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 157
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.30 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2f5jA00
2F5JA 2LKMB 2AQLA 2Y0NA 2N1DB
chains in the Genus database with same CATH superfamily
1Y1VA 2LPIA 2MX8A 3GTJA 2YU9A 1TWGA 2LPJA 3EZBA 3GTMA 1K83A 2A6ED 2LTHA 2R7ZA 1Y2MA 4CQ5A 4CEIA 2VUMA 2X0PA 4FBSA 2B63A 2LYIA 3GTKA 2A68D 4C6GA 2JA5A 1HQMD 1YNJD 3H0GA 2EZCA 2FIPA 2VK9A 1TWHA 1YNND 2MQAA 4V2RA 3GTLA 1W27A 3GTOA 1TWFA 2Y0NA 4C5RA 2CW0D 2K3OA 3LRDA 4BAAA 1I50A 4CEJA 2K3QA 2EZBA 2HWGA 2X0OA 2YIIA 4CEHA 4C2MA 1TWCA 1T6PA 4BABA 3EZAA 1SMYD 2O5JD 1WCMA 2MX9A 2A6HD 4C5UA 1T6JA 1EZAA 2JA6A 1IW7D 2A69D 5IZ2A 2JA7A 3FKIA 2F5JA 2R92A 4QIWA 2R93A 3LR2A 2X0QA 1TWAA 2BE5D 1ZYRD 1R9TA 3LR6A 2HROA 2FIOA 1SFOA 1I6VD 2E2HA 3CQZA 4V2QA 2MP0A 2N1DB 3GTGA 3NZ4A 3U4QA 3U44A 2NVXA 2LKMB 2EZAA 3LR8A 1ZYMA 2N3EA 2K3NA 4C5SA 3EZEA 3GTPA 1I3QA 1EZBA 3GTQA 1Y1WA 2AQLA 2NVYA 2E2IA
chains in the Genus database with same CATH topology
1Y1VA 2LPIA 2MX8A 3GTJA 2YU9A 1TWGA 2LPJA 3GTMA 1K83A 2A6ED 2LTHA 2R7ZA 4CEIA 2VUMA 2X0PA 4FBSA 2B63A 2LYIA 3GTKA 2A68D 2JA5A 1HQMD 1YNJD 3H0GA 2FIPA 2VK9A 1TWHA 1YNND 2MQAA 3GTLA 3GTOA 1TWFA 2Y0NA 2CW0D 2K3OA 3LRDA 1I50A 4CEJA 2K3QA 2X0OA 4CEHA 4C2MA 1TWCA 1SMYD 2O5JD 1WCMA 2MX9A 2A6HD 2JA6A 1IW7D 2A69D 5IZ2A 2JA7A 3FKIA 2F5JA 2R92A 4QIWA 2R93A 3LR2A 2X0QA 1TWAA 2BE5D 1ZYRD 1R9TA 2FIOA 3LR6A 1SFOA 1I6VD 2E2HA 3CQZA 2N1DB 3GTGA 3U4QA 3U44A 2NVXA 2LKMB 3LR8A 2N3EA 2K3NA 3GTPA 1I3QA 3GTQA 1Y1WA 2AQLA 2NVYA 2E2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5J A;  2LKM B;  2AQL A;  2Y0N A;  2N1D B; 
#chains in the Genus database with same CATH topology
 1Y1V A;  2LPI A;  2MX8 A;  3GTJ A;  2YU9 A;  1TWG A;  2LPJ A;  3EZB A;  3GTM A;  1K83 A;  2A6E D;  2LTH A;  2R7Z A;  1Y2M A;  4CQ5 A;  4CEI A;  2VUM A;  2X0P A;  4FBS A;  2B63 A;  2LYI A;  3GTK A;  2A68 D;  4C6G A;  2JA5 A;  1HQM D;  1YNJ D;  3H0G A;  2EZC A;  2FIP A;  2VK9 A;  1TWH A;  1YNN D;  2MQA A;  4V2R A;  3GTL A;  1W27 A;  3GTO A;  1TWF A;  2Y0N A;  4C5R A;  2CW0 D;  2K3O A;  3LRD A;  4BAA A;  1I50 A;  4CEJ A;  2K3Q A;  2EZB A;  2HWG A;  2X0O A;  2YII A;  4CEH A;  4C2M A;  1TWC A;  1T6P A;  4BAB A;  3EZA A;  1SMY D;  2O5J D;  1WCM A;  2MX9 A;  2A6H D;  4C5U A;  1T6J A;  1EZA A;  2JA6 A;  1IW7 D;  2A69 D;  5IZ2 A;  2JA7 A;  3FKI A;  2F5J A;  2R92 A;  4QIW A;  2R93 A;  3LR2 A;  2X0Q A;  1TWA A;  2BE5 D;  1ZYR D;  1R9T A;  3LR6 A;  2HRO A;  2FIO A;  1SFO A;  1I6V D;  2E2H A;  3CQZ A;  4V2Q A;  2MP0 A;  2N1D B;  3GTG A;  3NZ4 A;  3U4Q A;  3U44 A;  2NVX A;  2LKM B;  2EZA A;  3LR8 A;  1ZYM A;  2N3E A;  2K3N A;  4C5S A;  3EZE A;  3GTP A;  1I3Q A;  1EZB A;  3GTQ A;  1Y1W A;  2AQL A;  2NVY A;  2E2I A; 
#chains in the Genus database with same CATH homology
 1Y1V A;  2LPI A;  2MX8 A;  3GTJ A;  2YU9 A;  1TWG A;  2LPJ A;  3GTM A;  1K83 A;  2A6E D;  2LTH A;  2R7Z A;  4CEI A;  2VUM A;  2X0P A;  4FBS A;  2B63 A;  2LYI A;  3GTK A;  2A68 D;  2JA5 A;  1HQM D;  1YNJ D;  3H0G A;  2FIP A;  2VK9 A;  1TWH A;  1YNN D;  2MQA A;  3GTL A;  3GTO A;  1TWF A;  2Y0N A;  2CW0 D;  2K3O A;  3LRD A;  1I50 A;  4CEJ A;  2K3Q A;  2X0O A;  4CEH A;  4C2M A;  1TWC A;  1SMY D;  2O5J D;  1WCM A;  2MX9 A;  2A6H D;  2JA6 A;  1IW7 D;  2A69 D;  5IZ2 A;  2JA7 A;  3FKI A;  2F5J A;  2R92 A;  4QIW A;  2R93 A;  3LR2 A;  2X0Q A;  1TWA A;  2BE5 D;  1ZYR D;  1R9T A;  2FIO A;  3LR6 A;  1SFO A;  1I6V D;  2E2H A;  3CQZ A;  2N1D B;  3GTG A;  3U4Q A;  3U44 A;  2NVX A;  2LKM B;  3LR8 A;  2N3E A;  2K3N A;  3GTP A;  1I3Q A;  3GTQ A;  1Y1W A;  2AQL A;  2NVY A;  2E2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...