2LPIA

Nmr structure of a monomeric mutant (a72r) of major ampullate spidroin 1 n-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 48
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lpiA01
3LRDA 2LTHA 5IZ2A 2K3QA 3LR8A 3LR2A 2N3EA 4FBSA 2LPIA 2MX9A 3LR6A 2MX8A 2LPJA
chains in the Genus database with same CATH superfamily
4CQ5A 1HQMD 1I3QA 3GTMA 3GTQA 2MX9A 2E2IA 4C6GA 2A6HD 1YNJD 2VUMA 2JA7A 2MX8A 1SFOA 3LRDA 1SMYD 2BE5D 2EZBA 2N1DB 1ZYRD 2FIPA 1Y1VA 3GTJA 2R7ZA 2VK9A 2X0OA 4BAAA 4V2RA 4V2QA 2HWGA 2O5JD 3CQZA 2LPJA 2JA6A 2A68D 2CW0D 3EZBA 1I50A 3GTGA 1IW7D 1TWFA 4C5SA 1TWGA 3U44A 2E2HA 2K3QA 3H0GA 2B63A 2F5JA 2YIIA 1TWAA 3GTOA 3LR8A 3LR6A 3GTPA 4QIWA 2MQAA 1Y2MA 4C2MA 1TWHA 2R93A 2LYIA 1I6VD 1T6PA 1ZYMA 1W27A 1EZAA 3LR2A 3NZ4A 2LKMB 4C5UA 5IZ2A 2K3NA 4CEJA 4C5RA 4CEIA 2AQLA 2N3EA 2EZAA 2X0PA 3GTKA 2LTHA 2X0QA 1T6JA 1K83A 1R9TA 2A69D 2LPIA 4BABA 2EZCA 2K3OA 3EZEA 1Y1WA 2HROA 2NVXA 2Y0NA 1WCMA 4FBSA 1YNND 3EZAA 3FKIA 2A6ED 1EZBA 2JA5A 2R92A 1TWCA 2YU9A 3GTLA 2FIOA 2MP0A 2NVYA 4CEHA 3U4QA
chains in the Genus database with same CATH topology
1HQMD 1I3QA 3GTMA 3GTQA 2MX9A 2E2IA 2A6HD 1YNJD 2VUMA 2JA7A 2MX8A 1SFOA 3LRDA 1SMYD 2BE5D 2N1DB 1ZYRD 2FIPA 1Y1VA 3GTJA 2R7ZA 2VK9A 2X0OA 2O5JD 3CQZA 2LPJA 2JA6A 2A68D 2CW0D 3GTGA 1I50A 1IW7D 1TWFA 2E2HA 1TWGA 3U44A 2K3QA 3H0GA 2B63A 2F5JA 1TWAA 3GTOA 3LR8A 3LR6A 3GTPA 4QIWA 2MQAA 4C2MA 1TWHA 2R93A 2LYIA 1I6VD 3LR2A 2LKMB 5IZ2A 2K3NA 4CEJA 4CEIA 2AQLA 2N3EA 2X0PA 3GTKA 2LTHA 2X0QA 1K83A 1R9TA 2A69D 2LPIA 2K3OA 1Y1WA 2NVXA 2Y0NA 1WCMA 4FBSA 1YNND 3FKIA 2A6ED 2JA5A 2R92A 1TWCA 2YU9A 3GTLA 2FIOA 2NVYA 4CEHA 3U4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LRD A;  2LTH A;  5IZ2 A;  2K3Q A;  3LR8 A;  3LR2 A;  2N3E A;  4FBS A;  2LPI A;  2MX9 A;  3LR6 A;  2MX8 A;  2LPJ A; 
#chains in the Genus database with same CATH topology
 4CQ5 A;  1HQM D;  1I3Q A;  3GTM A;  3GTQ A;  2MX9 A;  2E2I A;  4C6G A;  2A6H D;  1YNJ D;  2VUM A;  2JA7 A;  2MX8 A;  1SFO A;  3LRD A;  1SMY D;  2BE5 D;  2EZB A;  2N1D B;  1ZYR D;  2FIP A;  1Y1V A;  3GTJ A;  2R7Z A;  2VK9 A;  2X0O A;  4BAA A;  4V2R A;  4V2Q A;  2HWG A;  2O5J D;  3CQZ A;  2LPJ A;  2JA6 A;  2A68 D;  2CW0 D;  3EZB A;  1I50 A;  3GTG A;  1IW7 D;  1TWF A;  4C5S A;  1TWG A;  3U44 A;  2E2H A;  2K3Q A;  3H0G A;  2B63 A;  2F5J A;  2YII A;  1TWA A;  3GTO A;  3LR8 A;  3LR6 A;  3GTP A;  4QIW A;  2MQA A;  1Y2M A;  4C2M A;  1TWH A;  2R93 A;  2LYI A;  1I6V D;  1T6P A;  1ZYM A;  1W27 A;  1EZA A;  3LR2 A;  3NZ4 A;  2LKM B;  4C5U A;  5IZ2 A;  2K3N A;  4CEJ A;  4C5R A;  4CEI A;  2AQL A;  2N3E A;  2EZA A;  2X0P A;  3GTK A;  2LTH A;  2X0Q A;  1T6J A;  1K83 A;  1R9T A;  2A69 D;  2LPI A;  4BAB A;  2EZC A;  2K3O A;  3EZE A;  1Y1W A;  2HRO A;  2NVX A;  2Y0N A;  1WCM A;  4FBS A;  1YNN D;  3EZA A;  3FKI A;  2A6E D;  1EZB A;  2JA5 A;  2R92 A;  1TWC A;  2YU9 A;  3GTL A;  2FIO A;  2MP0 A;  2NVY A;  4CEH A;  3U4Q A; 
#chains in the Genus database with same CATH homology
 1HQM D;  1I3Q A;  3GTM A;  3GTQ A;  2MX9 A;  2E2I A;  2A6H D;  1YNJ D;  2VUM A;  2JA7 A;  2MX8 A;  1SFO A;  3LRD A;  1SMY D;  2BE5 D;  2N1D B;  1ZYR D;  2FIP A;  1Y1V A;  3GTJ A;  2R7Z A;  2VK9 A;  2X0O A;  2O5J D;  3CQZ A;  2LPJ A;  2JA6 A;  2A68 D;  2CW0 D;  3GTG A;  1I50 A;  1IW7 D;  1TWF A;  2E2H A;  1TWG A;  3U44 A;  2K3Q A;  3H0G A;  2B63 A;  2F5J A;  1TWA A;  3GTO A;  3LR8 A;  3LR6 A;  3GTP A;  4QIW A;  2MQA A;  4C2M A;  1TWH A;  2R93 A;  2LYI A;  1I6V D;  3LR2 A;  2LKM B;  5IZ2 A;  2K3N A;  4CEJ A;  4CEI A;  2AQL A;  2N3E A;  2X0P A;  3GTK A;  2LTH A;  2X0Q A;  1K83 A;  1R9T A;  2A69 D;  2LPI A;  2K3O A;  1Y1W A;  2NVX A;  2Y0N A;  1WCM A;  4FBS A;  1YNN D;  3FKI A;  2A6E D;  2JA5 A;  2R92 A;  1TWC A;  2YU9 A;  3GTL A;  2FIO A;  2NVY A;  4CEH A;  3U4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...