2LPIA

Nmr structure of a monomeric mutant (a72r) of major ampullate spidroin 1 n-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.
pubmed doi rcsb
source organism Euprosthenops australis
total genus 48
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lpiA01
2K3QA 3LR8A 2LPJA 3LR2A 3LR6A 2N3EA 3LRDA 2MX8A 5IZ2A 2LPIA 4FBSA 2MX9A 2LTHA
chains in the Genus database with same CATH superfamily
2X0QA 1SMYD 2O5JD 3LR6A 1TWCA 3EZAA 4FBSA 4BAAA 2MX9A 3EZEA 2A69D 1YNND 4CEIA 1R9TA 4V2RA 4C2MA 4CEJA 1IW7D 3GTOA 3GTGA 2FIOA 2LYIA 2E2IA 2LPIA 3GTMA 1TWGA 2YU9A 2MP0A 1YNJD 2X0OA 2K3NA 4C5RA 2HROA 2LPJA 2R92A 2AQLA 1I50A 1Y1VA 2R93A 2MQAA 2HWGA 2N1DB 3FKIA 2NVYA 3LR2A 2EZBA 3GTLA 2K3OA 2JA7A 2JA5A 1K83A 1TWHA 2NVXA 1HQMD 3U44A 3GTJA 1I6VD 2E2HA 1TWAA 2A6ED 2K3QA 1EZBA 2EZCA 2FIPA 2A6HD 4CEHA 2EZAA 1ZYRD 2F5JA 2A68D 2Y0NA 3GTPA 3EZBA 2MX8A 3GTKA 4QIWA 3LR8A 1TWFA 1T6PA 2N3EA 3CQZA 2YIIA 3NZ4A 4C5SA 3LRDA 4C6GA 1I3QA 2BE5D 1SFOA 3GTQA 2CW0D 2R7ZA 1WCMA 1ZYMA 2X0PA 4C5UA 2LTHA 2LKMB 1T6JA 1EZAA 1W27A 3U4QA 1Y1WA 4CQ5A 2VUMA 2JA6A 2VK9A 2B63A 4BABA 4V2QA 1Y2MA 5IZ2A 3H0GA
chains in the Genus database with same CATH topology
2X0QA 1SMYD 2O5JD 3LR6A 1TWCA 4FBSA 2MX9A 2A69D 1YNND 4CEIA 1R9TA 4C2MA 4CEJA 1IW7D 3GTOA 3GTGA 2FIOA 2LYIA 2E2IA 2LPIA 3GTMA 1TWGA 2YU9A 1YNJD 2X0OA 2K3NA 2LPJA 2R92A 2AQLA 1I50A 1Y1VA 2R93A 2MQAA 2N1DB 3FKIA 2NVYA 3LR2A 3GTLA 2K3OA 2JA7A 2JA5A 1K83A 1TWHA 2NVXA 1HQMD 3U44A 3GTJA 1I6VD 2E2HA 1TWAA 2A6ED 2K3QA 2FIPA 2A6HD 4CEHA 1ZYRD 2F5JA 2A68D 2Y0NA 3GTPA 3GTKA 2MX8A 4QIWA 3LR8A 1TWFA 2N3EA 3CQZA 3LRDA 1I3QA 2BE5D 1SFOA 3GTQA 2CW0D 2R7ZA 1WCMA 2X0PA 2LTHA 2LKMB 3U4QA 1Y1WA 2VUMA 2JA6A 2VK9A 2B63A 5IZ2A 3H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Q A;  3LR8 A;  2LPJ A;  3LR2 A;  3LR6 A;  2N3E A;  3LRD A;  2MX8 A;  5IZ2 A;  2LPI A;  4FBS A;  2MX9 A;  2LTH A; 
#chains in the Genus database with same CATH topology
 2X0Q A;  1SMY D;  2O5J D;  3LR6 A;  1TWC A;  3EZA A;  4FBS A;  4BAA A;  2MX9 A;  3EZE A;  2A69 D;  1YNN D;  4CEI A;  1R9T A;  4V2R A;  4C2M A;  4CEJ A;  1IW7 D;  3GTO A;  3GTG A;  2FIO A;  2LYI A;  2E2I A;  2LPI A;  3GTM A;  1TWG A;  2YU9 A;  2MP0 A;  1YNJ D;  2X0O A;  2K3N A;  4C5R A;  2HRO A;  2LPJ A;  2R92 A;  2AQL A;  1I50 A;  1Y1V A;  2R93 A;  2MQA A;  2HWG A;  2N1D B;  3FKI A;  2NVY A;  3LR2 A;  2EZB A;  3GTL A;  2K3O A;  2JA7 A;  2JA5 A;  1K83 A;  1TWH A;  2NVX A;  1HQM D;  3U44 A;  3GTJ A;  1I6V D;  2E2H A;  1TWA A;  2A6E D;  2K3Q A;  1EZB A;  2EZC A;  2FIP A;  2A6H D;  4CEH A;  2EZA A;  1ZYR D;  2F5J A;  2A68 D;  2Y0N A;  3GTP A;  3EZB A;  2MX8 A;  3GTK A;  4QIW A;  3LR8 A;  1TWF A;  1T6P A;  2N3E A;  3CQZ A;  2YII A;  3NZ4 A;  4C5S A;  3LRD A;  4C6G A;  1I3Q A;  2BE5 D;  1SFO A;  3GTQ A;  2CW0 D;  2R7Z A;  1WCM A;  1ZYM A;  2X0P A;  4C5U A;  2LTH A;  2LKM B;  1T6J A;  1EZA A;  1W27 A;  3U4Q A;  1Y1W A;  4CQ5 A;  2VUM A;  2JA6 A;  2VK9 A;  2B63 A;  4BAB A;  4V2Q A;  1Y2M A;  5IZ2 A;  3H0G A; 
#chains in the Genus database with same CATH homology
 2X0Q A;  1SMY D;  2O5J D;  3LR6 A;  1TWC A;  4FBS A;  2MX9 A;  2A69 D;  1YNN D;  4CEI A;  1R9T A;  4C2M A;  4CEJ A;  1IW7 D;  3GTO A;  3GTG A;  2FIO A;  2LYI A;  2E2I A;  2LPI A;  3GTM A;  1TWG A;  2YU9 A;  1YNJ D;  2X0O A;  2K3N A;  2LPJ A;  2R92 A;  2AQL A;  1I50 A;  1Y1V A;  2R93 A;  2MQA A;  2N1D B;  3FKI A;  2NVY A;  3LR2 A;  3GTL A;  2K3O A;  2JA7 A;  2JA5 A;  1K83 A;  1TWH A;  2NVX A;  1HQM D;  3U44 A;  3GTJ A;  1I6V D;  2E2H A;  1TWA A;  2A6E D;  2K3Q A;  2FIP A;  2A6H D;  4CEH A;  1ZYR D;  2F5J A;  2A68 D;  2Y0N A;  3GTP A;  3GTK A;  2MX8 A;  4QIW A;  3LR8 A;  1TWF A;  2N3E A;  3CQZ A;  3LRD A;  1I3Q A;  2BE5 D;  1SFO A;  3GTQ A;  2CW0 D;  2R7Z A;  1WCM A;  2X0P A;  2LTH A;  2LKM B;  3U4Q A;  1Y1W A;  2VUM A;  2JA6 A;  2VK9 A;  2B63 A;  5IZ2 A;  3H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...