2LPIA

Nmr structure of a monomeric mutant (a72r) of major ampullate spidroin 1 n-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
total genus 48
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lpiA01
4FBSA 2LPIA 2N3EA 3LR8A 3LR6A 2MX9A 3LR2A 2K3QA 3LRDA 5IZ2A 2MX8A 2LPJA 2LTHA
chains in the Genus database with same CATH superfamily
1I6VD 4C5UA 2YIIA 2NVXA 3LR6A 3GTQA 1SMYD 1HQMD 1T6PA 1T6JA 4CQ5A 3GTGA 2F5JA 2JA5A 3EZEA 3GTJA 2HWGA 3U4QA 1Y1VA 2LTHA 3EZAA 2MQAA 2VUMA 4CEJA 3FKIA 4CEIA 2A69D 2B63A 4FBSA 4V2RA 2R93A 2MX9A 2EZCA 1TWAA 2EZBA 2LKMB 2A6ED 2LPIA 3U44A 3LR8A 3GTLA 2O5JD 1TWHA 1I50A 2N3EA 3LR2A 2EZAA 1R9TA 2N1DB 4C2MA 4BAAA 1ZYMA 4BABA 2K3QA 1TWGA 2FIPA 3NZ4A 2A68D 2NVYA 2E2HA 2R7ZA 2LYIA 4V2QA 3GTKA 1YNJD 1K83A 1W27A 1EZAA 3LRDA 2FIOA 1WCMA 2JA7A 3CQZA 4C5RA 2HROA 1EZBA 2VK9A 3GTMA 2JA6A 3EZBA 2K3OA 1Y1WA 2X0OA 4QIWA 2X0PA 2YU9A 2BE5D 2AQLA 5IZ2A 1Y2MA 1TWCA 2X0QA 4CEHA 2E2IA 2A6HD 1ZYRD 2MP0A 1I3QA 1TWFA 3GTPA 2MX8A 2Y0NA 1YNND 2R92A 4C6GA 2CW0D 1IW7D 3GTOA 1SFOA 4C5SA 2K3NA 2LPJA 3H0GA
chains in the Genus database with same CATH topology
1I6VD 2NVXA 3LR6A 3GTQA 1SMYD 1HQMD 3GTGA 2F5JA 2JA5A 3GTJA 3U4QA 1Y1VA 2LTHA 2VUMA 2MQAA 4CEJA 3FKIA 4CEIA 2A69D 2B63A 4FBSA 2R93A 2MX9A 1TWAA 2LKMB 2A6ED 2LPIA 3U44A 3LR8A 3GTLA 2O5JD 1TWHA 1I50A 2N3EA 3LR2A 1R9TA 2N1DB 4C2MA 2K3QA 1TWGA 2FIPA 2A68D 2NVYA 2E2HA 2R7ZA 2LYIA 3GTKA 1YNJD 1K83A 3LRDA 2FIOA 1WCMA 2JA7A 3CQZA 2VK9A 3GTMA 2JA6A 2K3OA 1Y1WA 2X0OA 4QIWA 2X0PA 2YU9A 2BE5D 2AQLA 5IZ2A 1TWCA 2X0QA 4CEHA 2E2IA 2A6HD 1ZYRD 1I3QA 1TWFA 3GTPA 2MX8A 2Y0NA 1YNND 2R92A 2CW0D 1IW7D 3GTOA 1SFOA 2K3NA 2LPJA 3H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBS A;  2LPI A;  2N3E A;  3LR8 A;  3LR6 A;  2MX9 A;  3LR2 A;  2K3Q A;  3LRD A;  5IZ2 A;  2MX8 A;  2LPJ A;  2LTH A; 
#chains in the Genus database with same CATH topology
 1I6V D;  4C5U A;  2YII A;  2NVX A;  3LR6 A;  3GTQ A;  1SMY D;  1HQM D;  1T6P A;  1T6J A;  4CQ5 A;  3GTG A;  2F5J A;  2JA5 A;  3EZE A;  3GTJ A;  2HWG A;  3U4Q A;  1Y1V A;  2LTH A;  3EZA A;  2MQA A;  2VUM A;  4CEJ A;  3FKI A;  4CEI A;  2A69 D;  2B63 A;  4FBS A;  4V2R A;  2R93 A;  2MX9 A;  2EZC A;  1TWA A;  2EZB A;  2LKM B;  2A6E D;  2LPI A;  3U44 A;  3LR8 A;  3GTL A;  2O5J D;  1TWH A;  1I50 A;  2N3E A;  3LR2 A;  2EZA A;  1R9T A;  2N1D B;  4C2M A;  4BAA A;  1ZYM A;  4BAB A;  2K3Q A;  1TWG A;  2FIP A;  3NZ4 A;  2A68 D;  2NVY A;  2E2H A;  2R7Z A;  2LYI A;  4V2Q A;  3GTK A;  1YNJ D;  1K83 A;  1W27 A;  1EZA A;  3LRD A;  2FIO A;  1WCM A;  2JA7 A;  3CQZ A;  4C5R A;  2HRO A;  1EZB A;  2VK9 A;  3GTM A;  2JA6 A;  3EZB A;  2K3O A;  1Y1W A;  2X0O A;  4QIW A;  2X0P A;  2YU9 A;  2BE5 D;  2AQL A;  5IZ2 A;  1Y2M A;  1TWC A;  2X0Q A;  4CEH A;  2E2I A;  2A6H D;  1ZYR D;  2MP0 A;  1I3Q A;  1TWF A;  3GTP A;  2MX8 A;  2Y0N A;  1YNN D;  2R92 A;  4C6G A;  2CW0 D;  1IW7 D;  3GTO A;  1SFO A;  4C5S A;  2K3N A;  2LPJ A;  3H0G A; 
#chains in the Genus database with same CATH homology
 1I6V D;  2NVX A;  3LR6 A;  3GTQ A;  1SMY D;  1HQM D;  3GTG A;  2F5J A;  2JA5 A;  3GTJ A;  3U4Q A;  1Y1V A;  2LTH A;  2VUM A;  2MQA A;  4CEJ A;  3FKI A;  4CEI A;  2A69 D;  2B63 A;  4FBS A;  2R93 A;  2MX9 A;  1TWA A;  2LKM B;  2A6E D;  2LPI A;  3U44 A;  3LR8 A;  3GTL A;  2O5J D;  1TWH A;  1I50 A;  2N3E A;  3LR2 A;  1R9T A;  2N1D B;  4C2M A;  2K3Q A;  1TWG A;  2FIP A;  2A68 D;  2NVY A;  2E2H A;  2R7Z A;  2LYI A;  3GTK A;  1YNJ D;  1K83 A;  3LRD A;  2FIO A;  1WCM A;  2JA7 A;  3CQZ A;  2VK9 A;  3GTM A;  2JA6 A;  2K3O A;  1Y1W A;  2X0O A;  4QIW A;  2X0P A;  2YU9 A;  2BE5 D;  2AQL A;  5IZ2 A;  1TWC A;  2X0Q A;  4CEH A;  2E2I A;  2A6H D;  1ZYR D;  1I3Q A;  1TWF A;  3GTP A;  2MX8 A;  2Y0N A;  1YNN D;  2R92 A;  2CW0 D;  1IW7 D;  3GTO A;  1SFO A;  2K3N A;  2LPJ A;  3H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...