2LPIA

Nmr structure of a monomeric mutant (a72r) of major ampullate spidroin 1 n-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
137
structure length
137
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMRFASSMAEIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title pH-Dependent Dimerization of Spider Silk N-Terminal Domain Requires Relocation of a Wedged Tryptophan Side Chain.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 48
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2lpiA01
2N3EA 3LR2A 2K3QA 4FBSA 3LRDA 2MX8A 2MX9A 2LTHA 3LR6A 3LR8A 2LPJA 5IZ2A 2LPIA
chains in the Genus database with same CATH superfamily
4QIWA 2K3QA 2A6ED 3LR6A 3FKIA 2MQAA 4C5RA 1R9TA 2E2HA 2X0OA 3CQZA 1WCMA 1EZAA 2YU9A 4BABA 2EZCA 1IW7D 2B63A 4CEHA 1Y2MA 2MX9A 4C5UA 4CQ5A 3EZBA 2A68D 5IZ2A 2YIIA 4V2RA 1I50A 2EZAA 1W27A 3LR2A 2JA5A 1ZYMA 2FIPA 2AQLA 1I3QA 1TWAA 4C6GA 1T6JA 2LPJA 4C5SA 3GTGA 2N1DB 4CEIA 1T6PA 1I6VD 1TWHA 4V2QA 3EZAA 3NZ4A 1TWCA 4FBSA 3GTLA 2K3OA 2Y0NA 2X0QA 2MP0A 3U4QA 2R92A 2E2IA 2FIOA 2VK9A 3GTJA 2F5JA 2X0PA 1SFOA 3EZEA 2BE5D 3GTOA 2NVYA 3LRDA 3GTMA 2LKMB 2CW0D 3H0GA 1SMYD 3GTQA 3GTKA 2NVXA 1YNJD 1Y1VA 3U44A 2N3EA 2R7ZA 2LYIA 2MX8A 2HWGA 1ZYRD 2A69D 2VUMA 2K3NA 1Y1WA 2O5JD 4CEJA 1TWGA 4BAAA 1HQMD 4C2MA 1EZBA 1YNND 2JA7A 2EZBA 2R93A 1TWFA 2JA6A 1K83A 2A6HD 3GTPA 2LPIA 2HROA 2LTHA 3LR8A
chains in the Genus database with same CATH topology
4QIWA 2K3QA 2A6ED 3LR6A 3FKIA 2MQAA 1R9TA 2E2HA 2X0OA 3CQZA 1WCMA 2YU9A 1IW7D 2B63A 4CEHA 2MX9A 2A68D 5IZ2A 1I50A 3LR2A 2JA5A 2FIPA 2AQLA 1I3QA 1TWAA 2LPJA 3GTGA 2N1DB 4CEIA 1I6VD 1TWHA 1TWCA 4FBSA 3GTLA 2K3OA 2Y0NA 2X0QA 2R92A 3U4QA 2E2IA 2FIOA 2VK9A 3GTJA 2F5JA 2X0PA 1SFOA 2BE5D 3GTOA 2NVYA 3LRDA 3GTMA 2LKMB 2CW0D 3H0GA 1SMYD 3GTQA 3GTKA 2NVXA 1YNJD 3U44A 1Y1VA 2N3EA 2R7ZA 2LYIA 2MX8A 1ZYRD 2A69D 2VUMA 2K3NA 1Y1WA 2O5JD 4CEJA 1TWGA 4C2MA 1HQMD 1YNND 2JA7A 2R93A 1TWFA 2JA6A 1K83A 2A6HD 3GTPA 2LPIA 2LTHA 3LR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3E A;  3LR2 A;  2K3Q A;  4FBS A;  3LRD A;  2MX8 A;  2MX9 A;  2LTH A;  3LR6 A;  3LR8 A;  2LPJ A;  5IZ2 A;  2LPI A; 
#chains in the Genus database with same CATH topology
 4QIW A;  2K3Q A;  2A6E D;  3LR6 A;  3FKI A;  2MQA A;  4C5R A;  1R9T A;  2E2H A;  2X0O A;  3CQZ A;  1WCM A;  1EZA A;  2YU9 A;  4BAB A;  2EZC A;  1IW7 D;  2B63 A;  4CEH A;  1Y2M A;  2MX9 A;  4C5U A;  4CQ5 A;  3EZB A;  2A68 D;  5IZ2 A;  2YII A;  4V2R A;  1I50 A;  2EZA A;  1W27 A;  3LR2 A;  2JA5 A;  1ZYM A;  2FIP A;  2AQL A;  1I3Q A;  1TWA A;  4C6G A;  1T6J A;  2LPJ A;  4C5S A;  3GTG A;  2N1D B;  4CEI A;  1T6P A;  1I6V D;  1TWH A;  4V2Q A;  3EZA A;  3NZ4 A;  1TWC A;  4FBS A;  3GTL A;  2K3O A;  2Y0N A;  2X0Q A;  2MP0 A;  3U4Q A;  2R92 A;  2E2I A;  2FIO A;  2VK9 A;  3GTJ A;  2F5J A;  2X0P A;  1SFO A;  3EZE A;  2BE5 D;  3GTO A;  2NVY A;  3LRD A;  3GTM A;  2LKM B;  2CW0 D;  3H0G A;  1SMY D;  3GTQ A;  3GTK A;  2NVX A;  1YNJ D;  1Y1V A;  3U44 A;  2N3E A;  2R7Z A;  2LYI A;  2MX8 A;  2HWG A;  1ZYR D;  2A69 D;  2VUM A;  2K3N A;  1Y1W A;  2O5J D;  4CEJ A;  1TWG A;  4BAA A;  1HQM D;  4C2M A;  1EZB A;  1YNN D;  2JA7 A;  2EZB A;  2R93 A;  1TWF A;  2JA6 A;  1K83 A;  2A6H D;  3GTP A;  2LPI A;  2HRO A;  2LTH A;  3LR8 A; 
#chains in the Genus database with same CATH homology
 4QIW A;  2K3Q A;  2A6E D;  3LR6 A;  3FKI A;  2MQA A;  1R9T A;  2E2H A;  2X0O A;  3CQZ A;  1WCM A;  2YU9 A;  1IW7 D;  2B63 A;  4CEH A;  2MX9 A;  2A68 D;  5IZ2 A;  1I50 A;  3LR2 A;  2JA5 A;  2FIP A;  2AQL A;  1I3Q A;  1TWA A;  2LPJ A;  3GTG A;  2N1D B;  4CEI A;  1I6V D;  1TWH A;  1TWC A;  4FBS A;  3GTL A;  2K3O A;  2Y0N A;  2X0Q A;  2R92 A;  3U4Q A;  2E2I A;  2FIO A;  2VK9 A;  3GTJ A;  2F5J A;  2X0P A;  1SFO A;  2BE5 D;  3GTO A;  2NVY A;  3LRD A;  3GTM A;  2LKM B;  2CW0 D;  3H0G A;  1SMY D;  3GTQ A;  3GTK A;  2NVX A;  1YNJ D;  3U44 A;  1Y1V A;  2N3E A;  2R7Z A;  2LYI A;  2MX8 A;  1ZYR D;  2A69 D;  2VUM A;  2K3N A;  1Y1W A;  2O5J D;  4CEJ A;  1TWG A;  4C2M A;  1HQM D;  1YNN D;  2JA7 A;  2R93 A;  1TWF A;  2JA6 A;  1K83 A;  2A6H D;  3GTP A;  2LPI A;  2LTH A;  3LR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...