2K3QA

Solution structure of the n-terminal domain (tusp1-n) of the egg case silk from nephila antipodiana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
GSEQQDLDDLAQVILSAVTSNTDTSKSARAQALSTALASSLADLLISESSGSSYQTQISALTNILSDCFVTTTGSNNPAFVSRVQTLIAVLSQSSSNAISGATGGSAFAQSQAFQQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TuSp1
publication title Solution structure of eggcase silk protein and its implications for silk fiber formation
pubmed doi rcsb
source organism Nephila antipodiana
molecule tags Structural protein
total genus 34
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2k3qA00
3LR2A 2K3QA 3LR8A 2MX8A 2LPIA 4FBSA 2LTHA 2MX9A 2N3EA 3LR6A 2LPJA 5IZ2A 3LRDA
chains in the Genus database with same CATH superfamily
4QIWA 2AQLA 2LPIA 2JA6A 2E2HA 2LKMB 2X0OA 5IZ2A 1I3QA 3U44A 2MQAA 1TWAA 2JA5A 4CEIA 2FIPA 4FBSA 4C5RA 4C6GA 1W27A 4C5UA 2CW0D 4C5SA 2O5JD 1TWGA 2YU9A 4CQ5A 3EZEA 3EZAA 4V2RA 2LPJA 1EZAA 4BABA 2EZCA 1R9TA 1Y1VA 2HROA 3GTPA 3GTKA 1HQMD 2A6HD 2EZBA 1SMYD 1SFOA 3LRDA 2K3OA 2A69D 2VUMA 1Y1WA 1WCMA 1TWFA 1IW7D 3GTJA 1YNND 2F5JA 2VK9A 2NVXA 3LR2A 2A6ED 2X0QA 2YIIA 3U4QA 2R93A 2N1DB 2MX9A 1ZYRD 2LTHA 4V2QA 3GTGA 1I6VD 2BE5D 1ZYMA 2MP0A 4CEJA 2K3QA 2EZAA 2X0PA 3GTMA 2E2IA 1YNJD 3GTOA 1T6PA 2A68D 3LR6A 1EZBA 1K83A 3GTLA 2FIOA 3CQZA 3EZBA 2N3EA 2B63A 2HWGA 3GTQA 2R7ZA 4CEHA 2K3NA 2LYIA 2MX8A 1Y2MA 4BAAA 1TWHA 1I50A 3LR8A 4C2MA 1T6JA 2JA7A 3FKIA 3H0GA 3NZ4A 2NVYA 2Y0NA 2R92A 1TWCA
chains in the Genus database with same CATH topology
4QIWA 2AQLA 2LPIA 2JA6A 2E2HA 2LKMB 2X0OA 5IZ2A 1I3QA 3U44A 2MQAA 1TWAA 2JA5A 4CEIA 2FIPA 4FBSA 2CW0D 2O5JD 1TWGA 2YU9A 2LPJA 1R9TA 1Y1VA 3GTPA 3GTKA 1HQMD 2A6HD 1SMYD 1SFOA 3LRDA 2K3OA 2A69D 2VUMA 1Y1WA 1WCMA 1TWFA 1IW7D 3GTJA 1YNND 2F5JA 2VK9A 2NVXA 3LR2A 2A6ED 2X0QA 3U4QA 2R93A 2N1DB 2MX9A 1ZYRD 2LTHA 3GTGA 1I6VD 2BE5D 4CEJA 2K3QA 2X0PA 3GTMA 2E2IA 1YNJD 3GTOA 2A68D 3LR6A 1K83A 3GTLA 2FIOA 3CQZA 2N3EA 2B63A 2R7ZA 3GTQA 4CEHA 2K3NA 2LYIA 2MX8A 1TWHA 1I50A 3LR8A 4C2MA 2JA7A 3FKIA 3H0GA 2NVYA 2Y0NA 2R92A 1TWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR2 A;  2K3Q A;  3LR8 A;  2MX8 A;  2LPI A;  4FBS A;  2LTH A;  2MX9 A;  2N3E A;  3LR6 A;  2LPJ A;  5IZ2 A;  3LRD A; 
#chains in the Genus database with same CATH topology
 4QIW A;  2AQL A;  2LPI A;  2JA6 A;  2E2H A;  2LKM B;  2X0O A;  5IZ2 A;  1I3Q A;  3U44 A;  2MQA A;  1TWA A;  2JA5 A;  4CEI A;  2FIP A;  4FBS A;  4C5R A;  4C6G A;  1W27 A;  4C5U A;  2CW0 D;  4C5S A;  2O5J D;  1TWG A;  2YU9 A;  4CQ5 A;  3EZE A;  3EZA A;  4V2R A;  2LPJ A;  1EZA A;  4BAB A;  2EZC A;  1R9T A;  1Y1V A;  2HRO A;  3GTP A;  3GTK A;  1HQM D;  2A6H D;  2EZB A;  1SMY D;  1SFO A;  3LRD A;  2K3O A;  2A69 D;  2VUM A;  1Y1W A;  1WCM A;  1TWF A;  1IW7 D;  3GTJ A;  1YNN D;  2F5J A;  2VK9 A;  2NVX A;  3LR2 A;  2A6E D;  2X0Q A;  2YII A;  3U4Q A;  2R93 A;  2N1D B;  2MX9 A;  1ZYR D;  2LTH A;  4V2Q A;  3GTG A;  1I6V D;  2BE5 D;  1ZYM A;  2MP0 A;  4CEJ A;  2K3Q A;  2EZA A;  2X0P A;  3GTM A;  2E2I A;  1YNJ D;  3GTO A;  1T6P A;  2A68 D;  3LR6 A;  1EZB A;  1K83 A;  3GTL A;  2FIO A;  3CQZ A;  3EZB A;  2N3E A;  2B63 A;  2HWG A;  3GTQ A;  2R7Z A;  4CEH A;  2K3N A;  2LYI A;  2MX8 A;  1Y2M A;  4BAA A;  1TWH A;  1I50 A;  3LR8 A;  4C2M A;  1T6J A;  2JA7 A;  3FKI A;  3H0G A;  3NZ4 A;  2NVY A;  2Y0N A;  2R92 A;  1TWC A; 
#chains in the Genus database with same CATH homology
 4QIW A;  2AQL A;  2LPI A;  2JA6 A;  2E2H A;  2LKM B;  2X0O A;  5IZ2 A;  1I3Q A;  3U44 A;  2MQA A;  1TWA A;  2JA5 A;  4CEI A;  2FIP A;  4FBS A;  2CW0 D;  2O5J D;  1TWG A;  2YU9 A;  2LPJ A;  1R9T A;  1Y1V A;  3GTP A;  3GTK A;  1HQM D;  2A6H D;  1SMY D;  1SFO A;  3LRD A;  2K3O A;  2A69 D;  2VUM A;  1Y1W A;  1WCM A;  1TWF A;  1IW7 D;  3GTJ A;  1YNN D;  2F5J A;  2VK9 A;  2NVX A;  3LR2 A;  2A6E D;  2X0Q A;  3U4Q A;  2R93 A;  2N1D B;  2MX9 A;  1ZYR D;  2LTH A;  3GTG A;  1I6V D;  2BE5 D;  4CEJ A;  2K3Q A;  2X0P A;  3GTM A;  2E2I A;  1YNJ D;  3GTO A;  2A68 D;  3LR6 A;  1K83 A;  3GTL A;  2FIO A;  3CQZ A;  2N3E A;  2B63 A;  2R7Z A;  3GTQ A;  4CEH A;  2K3N A;  2LYI A;  2MX8 A;  1TWH A;  1I50 A;  3LR8 A;  4C2M A;  2JA7 A;  3FKI A;  3H0G A;  2NVY A;  2Y0N A;  2R92 A;  1TWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...