2K3QA

Solution structure of the n-terminal domain (tusp1-n) of the egg case silk from nephila antipodiana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
GSEQQDLDDLAQVILSAVTSNTDTSKSARAQALSTALASSLADLLISESSGSSYQTQISALTNILSDCFVTTTGSNNPAFVSRVQTLIAVLSQSSSNAISGATGGSAFAQSQAFQQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TuSp1
publication title Solution structure of eggcase silk protein and its implications for silk fiber formation
pubmed doi rcsb
source organism Nephila antipodiana
molecule tags Structural protein
total genus 34
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2k3qA00
4FBSA 2N3EA 2LTHA 2MX9A 2LPIA 2MX8A 3LR8A 3LRDA 3LR6A 5IZ2A 3LR2A 2LPJA 2K3QA
chains in the Genus database with same CATH superfamily
2A69D 2MX8A 1ZYRD 4FBSA 2FIOA 2A6HD 2CW0D 3H0GA 3LR8A 1WCMA 1HQMD 4C5SA 2LKMB 2R92A 2JA7A 1YNND 1Y1VA 2MX9A 3GTKA 1SMYD 1I6VD 2EZAA 4V2RA 3FKIA 4C5UA 4CEJA 1TWHA 3GTQA 1R9TA 2O5JD 4C2MA 4C6GA 3LRDA 4CQ5A 3GTJA 1EZBA 1Y2MA 2Y0NA 2LPIA 2NVXA 2LYIA 2E2HA 2YU9A 2NVYA 1TWFA 2X0QA 1IW7D 3CQZA 4V2QA 2JA6A 2VUMA 2JA5A 2FIPA 3GTGA 5IZ2A 2LPJA 3U4QA 2HROA 2VK9A 1SFOA 1ZYMA 3GTMA 2EZCA 4BAAA 1EZAA 2R93A 3U44A 2MQAA 1TWGA 4C5RA 2K3NA 2YIIA 1I50A 2F5JA 1W27A 2LTHA 4CEHA 2A68D 3LR6A 3GTPA 1T6JA 2EZBA 1YNJD 4QIWA 2X0OA 2N3EA 3GTOA 2B63A 3EZEA 1TWAA 4CEIA 1T6PA 3GTLA 3NZ4A 2MP0A 2HWGA 2AQLA 2K3OA 1K83A 3LR2A 2BE5D 1TWCA 1Y1WA 3EZBA 2A6ED 2R7ZA 3EZAA 1I3QA 2N1DB 2E2IA 4BABA 2X0PA 2K3QA
chains in the Genus database with same CATH topology
2A69D 2MX8A 1ZYRD 4FBSA 2FIOA 2A6HD 2CW0D 3H0GA 3LR8A 1WCMA 1HQMD 2LKMB 2R92A 2JA7A 1YNND 1Y1VA 2MX9A 3GTKA 1SMYD 1I6VD 3FKIA 4CEJA 1TWHA 3GTQA 1R9TA 2O5JD 4C2MA 3LRDA 3GTJA 2Y0NA 2LPIA 2NVXA 2LYIA 2E2HA 2YU9A 2NVYA 1TWFA 2X0QA 1IW7D 3CQZA 2JA6A 2VUMA 2JA5A 2FIPA 3GTGA 5IZ2A 2LPJA 3U4QA 2VK9A 1SFOA 3GTMA 2R93A 3U44A 2MQAA 1TWGA 2K3NA 1I50A 2F5JA 2LTHA 4CEHA 2A68D 3LR6A 3GTPA 1YNJD 4QIWA 2X0OA 2N3EA 3GTOA 2B63A 1TWAA 4CEIA 3GTLA 2AQLA 2K3OA 1K83A 3LR2A 2BE5D 1TWCA 1Y1WA 2A6ED 2R7ZA 1I3QA 2N1DB 2E2IA 2X0PA 2K3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBS A;  2N3E A;  2LTH A;  2MX9 A;  2LPI A;  2MX8 A;  3LR8 A;  3LRD A;  3LR6 A;  5IZ2 A;  3LR2 A;  2LPJ A;  2K3Q A; 
#chains in the Genus database with same CATH topology
 2A69 D;  2MX8 A;  1ZYR D;  4FBS A;  2FIO A;  2A6H D;  2CW0 D;  3H0G A;  3LR8 A;  1WCM A;  1HQM D;  4C5S A;  2LKM B;  2R92 A;  2JA7 A;  1YNN D;  1Y1V A;  2MX9 A;  3GTK A;  1SMY D;  1I6V D;  2EZA A;  4V2R A;  3FKI A;  4C5U A;  4CEJ A;  1TWH A;  3GTQ A;  1R9T A;  2O5J D;  4C2M A;  4C6G A;  3LRD A;  4CQ5 A;  3GTJ A;  1EZB A;  1Y2M A;  2Y0N A;  2LPI A;  2NVX A;  2LYI A;  2E2H A;  2YU9 A;  2NVY A;  1TWF A;  2X0Q A;  1IW7 D;  3CQZ A;  4V2Q A;  2JA6 A;  2VUM A;  2JA5 A;  2FIP A;  3GTG A;  5IZ2 A;  2LPJ A;  3U4Q A;  2HRO A;  2VK9 A;  1SFO A;  1ZYM A;  3GTM A;  2EZC A;  4BAA A;  1EZA A;  2R93 A;  3U44 A;  2MQA A;  1TWG A;  4C5R A;  2K3N A;  2YII A;  1I50 A;  2F5J A;  1W27 A;  2LTH A;  4CEH A;  2A68 D;  3LR6 A;  3GTP A;  1T6J A;  2EZB A;  1YNJ D;  4QIW A;  2X0O A;  2N3E A;  3GTO A;  2B63 A;  3EZE A;  1TWA A;  4CEI A;  1T6P A;  3GTL A;  3NZ4 A;  2MP0 A;  2HWG A;  2AQL A;  2K3O A;  1K83 A;  3LR2 A;  2BE5 D;  1TWC A;  1Y1W A;  3EZB A;  2A6E D;  2R7Z A;  3EZA A;  1I3Q A;  2N1D B;  2E2I A;  4BAB A;  2X0P A;  2K3Q A; 
#chains in the Genus database with same CATH homology
 2A69 D;  2MX8 A;  1ZYR D;  4FBS A;  2FIO A;  2A6H D;  2CW0 D;  3H0G A;  3LR8 A;  1WCM A;  1HQM D;  2LKM B;  2R92 A;  2JA7 A;  1YNN D;  1Y1V A;  2MX9 A;  3GTK A;  1SMY D;  1I6V D;  3FKI A;  4CEJ A;  1TWH A;  3GTQ A;  1R9T A;  2O5J D;  4C2M A;  3LRD A;  3GTJ A;  2Y0N A;  2LPI A;  2NVX A;  2LYI A;  2E2H A;  2YU9 A;  2NVY A;  1TWF A;  2X0Q A;  1IW7 D;  3CQZ A;  2JA6 A;  2VUM A;  2JA5 A;  2FIP A;  3GTG A;  5IZ2 A;  2LPJ A;  3U4Q A;  2VK9 A;  1SFO A;  3GTM A;  2R93 A;  3U44 A;  2MQA A;  1TWG A;  2K3N A;  1I50 A;  2F5J A;  2LTH A;  4CEH A;  2A68 D;  3LR6 A;  3GTP A;  1YNJ D;  4QIW A;  2X0O A;  2N3E A;  3GTO A;  2B63 A;  1TWA A;  4CEI A;  3GTL A;  2AQL A;  2K3O A;  1K83 A;  3LR2 A;  2BE5 D;  1TWC A;  1Y1W A;  2A6E D;  2R7Z A;  1I3Q A;  2N1D B;  2E2I A;  2X0P A;  2K3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...