3LR8A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAQIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 53
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr8A01
4FBSA 2N3EA 2LPJA 3LR2A 2MX8A 5IZ2A 2K3QA 2MX9A 3LRDA 2LPIA 3LR8A 2LTHA 3LR6A
chains in the Genus database with same CATH superfamily
2EZCA 2E2IA 3EZBA 1YNND 3GTQA 1TWHA 4C5RA 1Y1VA 2X0PA 3U4QA 1YNJD 2MX9A 2HWGA 3LR6A 4FBSA 2MP0A 4C6GA 2Y0NA 2YU9A 1ZYRD 2X0OA 3GTLA 3LR8A 4CQ5A 2YIIA 3GTMA 2E2HA 2LPJA 3GTPA 2A69D 2JA6A 3EZAA 2LYIA 2A6ED 4CEIA 2F5JA 2MQAA 2N1DB 1SMYD 3U44A 1HQMD 3LR2A 2B63A 3NZ4A 2JA7A 3GTKA 2EZBA 4C5UA 2CW0D 2LPIA 2LKMB 2LTHA 3LRDA 1TWCA 2NVXA 4C2MA 3EZEA 2AQLA 1TWGA 1TWAA 1K83A 2NVYA 2JA5A 2O5JD 1T6PA 1I50A 2X0QA 4BABA 2EZAA 5IZ2A 2A68D 2K3OA 1EZAA 4V2QA 4QIWA 2N3EA 1EZBA 2R93A 2FIPA 1I3QA 2A6HD 3H0GA 2K3QA 1SFOA 2R7ZA 1R9TA 4V2RA 3CQZA 1Y1WA 2MX8A 1Y2MA 1TWFA 2BE5D 3GTGA 1ZYMA 2VK9A 1T6JA 1WCMA 2FIOA 1I6VD 2R92A 3GTJA 4BAAA 3GTOA 2VUMA 4CEHA 3FKIA 2K3NA 4C5SA 4CEJA 1IW7D 2HROA 1W27A
chains in the Genus database with same CATH topology
2E2IA 3GTQA 1YNND 1TWHA 1Y1VA 2X0PA 3U4QA 1YNJD 2MX9A 3LR6A 4FBSA 2Y0NA 2YU9A 1ZYRD 2X0OA 3GTLA 3LR8A 3GTMA 2E2HA 2LPJA 3GTPA 2A69D 2JA6A 2LYIA 2A6ED 4CEIA 2F5JA 2MQAA 2N1DB 1SMYD 3U44A 1HQMD 3LR2A 2B63A 2JA7A 3GTKA 2CW0D 2LPIA 2LKMB 2LTHA 3LRDA 1TWCA 2NVXA 4C2MA 2AQLA 1TWGA 1TWAA 1K83A 2NVYA 2JA5A 2O5JD 1I50A 2X0QA 5IZ2A 2A68D 2K3OA 4QIWA 2N3EA 2R93A 2FIPA 1I3QA 2A6HD 3H0GA 2K3QA 1SFOA 2R7ZA 1R9TA 3CQZA 1Y1WA 2MX8A 1TWFA 2BE5D 3GTGA 2VK9A 1WCMA 2FIOA 1I6VD 2R92A 3GTJA 3GTOA 2VUMA 4CEHA 3FKIA 2K3NA 4CEJA 1IW7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBS A;  2N3E A;  2LPJ A;  3LR2 A;  2MX8 A;  5IZ2 A;  2K3Q A;  2MX9 A;  3LRD A;  2LPI A;  3LR8 A;  2LTH A;  3LR6 A; 
#chains in the Genus database with same CATH topology
 2EZC A;  2E2I A;  3EZB A;  1YNN D;  3GTQ A;  1TWH A;  4C5R A;  1Y1V A;  2X0P A;  3U4Q A;  1YNJ D;  2MX9 A;  2HWG A;  3LR6 A;  4FBS A;  2MP0 A;  4C6G A;  2Y0N A;  2YU9 A;  1ZYR D;  2X0O A;  3GTL A;  3LR8 A;  4CQ5 A;  2YII A;  3GTM A;  2E2H A;  2LPJ A;  3GTP A;  2A69 D;  2JA6 A;  3EZA A;  2LYI A;  2A6E D;  4CEI A;  2F5J A;  2MQA A;  2N1D B;  1SMY D;  3U44 A;  1HQM D;  3LR2 A;  2B63 A;  3NZ4 A;  2JA7 A;  3GTK A;  2EZB A;  4C5U A;  2CW0 D;  2LPI A;  2LKM B;  2LTH A;  3LRD A;  1TWC A;  2NVX A;  4C2M A;  3EZE A;  2AQL A;  1TWG A;  1TWA A;  1K83 A;  2NVY A;  2JA5 A;  2O5J D;  1T6P A;  1I50 A;  2X0Q A;  4BAB A;  2EZA A;  5IZ2 A;  2A68 D;  2K3O A;  1EZA A;  4V2Q A;  4QIW A;  2N3E A;  1EZB A;  2R93 A;  2FIP A;  1I3Q A;  2A6H D;  3H0G A;  2K3Q A;  1SFO A;  2R7Z A;  1R9T A;  4V2R A;  3CQZ A;  1Y1W A;  2MX8 A;  1Y2M A;  1TWF A;  2BE5 D;  3GTG A;  1ZYM A;  2VK9 A;  1T6J A;  1WCM A;  2FIO A;  1I6V D;  2R92 A;  3GTJ A;  4BAA A;  3GTO A;  2VUM A;  4CEH A;  3FKI A;  2K3N A;  4C5S A;  4CEJ A;  1IW7 D;  2HRO A;  1W27 A; 
#chains in the Genus database with same CATH homology
 2E2I A;  3GTQ A;  1YNN D;  1TWH A;  1Y1V A;  2X0P A;  3U4Q A;  1YNJ D;  2MX9 A;  3LR6 A;  4FBS A;  2Y0N A;  2YU9 A;  1ZYR D;  2X0O A;  3GTL A;  3LR8 A;  3GTM A;  2E2H A;  2LPJ A;  3GTP A;  2A69 D;  2JA6 A;  2LYI A;  2A6E D;  4CEI A;  2F5J A;  2MQA A;  2N1D B;  1SMY D;  3U44 A;  1HQM D;  3LR2 A;  2B63 A;  2JA7 A;  3GTK A;  2CW0 D;  2LPI A;  2LKM B;  2LTH A;  3LRD A;  1TWC A;  2NVX A;  4C2M A;  2AQL A;  1TWG A;  1TWA A;  1K83 A;  2NVY A;  2JA5 A;  2O5J D;  1I50 A;  2X0Q A;  5IZ2 A;  2A68 D;  2K3O A;  4QIW A;  2N3E A;  2R93 A;  2FIP A;  1I3Q A;  2A6H D;  3H0G A;  2K3Q A;  1SFO A;  2R7Z A;  1R9T A;  3CQZ A;  1Y1W A;  2MX8 A;  1TWF A;  2BE5 D;  3GTG A;  2VK9 A;  1WCM A;  2FIO A;  1I6V D;  2R92 A;  3GTJ A;  3GTO A;  2VUM A;  4CEH A;  3FKI A;  2K3N A;  4CEJ A;  1IW7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...