3LR8A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
b'GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAQIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
molecule tags Structural protein
source organism Euprosthenops australis
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
total genus 53
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr8A01
3LR8A 2LTHA 3LRDA 3LR6A 2MX9A 2LPIA 2N3EA 3LR2A 2MX8A 2LPJA 4FBSA 5IZ2A 2K3QA
chains in the Genus database with same CATH superfamily
3GTLA 2FIOA 1Y1VA 3H0GA 2YU9A 3EZBA 3GTOA 2EZBA 2NVXA 3U4QA 2MX8A 1SFOA 3EZAA 4CEIA 2NVYA 2LKMB 2FIPA 2HROA 4C5SA 4C5UA 3U44A 1K83A 2A6ED 2N1DB 2BE5D 1R9TA 5IZ2A 3LR2A 2X0PA 1W27A 3LR6A 3GTPA 2N3EA 2X0OA 2LYIA 4BAAA 1TWCA 1I50A 2F5JA 2A6HD 2EZCA 1TWHA 2AQLA 1HQMD 2YIIA 2HWGA 2LTHA 4CEHA 2A68D 1I6VD 4C6GA 2E2HA 4FBSA 2VK9A 4CQ5A 4QIWA 3CQZA 2A69D 4V2QA 4BABA 2VUMA 2JA6A 1T6JA 1Y2MA 2O5JD 2LPJA 2R93A 2MP0A 1T6PA 3GTGA 2JA7A 3LRDA 1YNJD 2MX9A 1IW7D 2R92A 1TWFA 2B63A 1TWGA 2E2IA 1WCMA 1YNND 3GTKA 1I3QA 2K3OA 4C5RA 1Y1WA 2X0QA 4V2RA 1ZYMA 1ZYRD 2K3NA 3GTJA 1EZBA 1SMYD 4C2MA 2EZAA 3EZEA 3LR8A 1TWAA 1EZAA 3NZ4A 2CW0D 2R7ZA 2Y0NA 2JA5A 3GTMA 3GTQA 2MQAA 3FKIA 4CEJA 2LPIA 2K3QA
chains in the Genus database with same CATH topology
3GTLA 2FIOA 1Y1VA 3H0GA 2YU9A 3GTOA 2NVXA 3U4QA 2MX8A 1SFOA 4CEIA 2NVYA 2LKMB 2FIPA 3U44A 1K83A 2A6ED 2N1DB 2BE5D 1R9TA 5IZ2A 3LR2A 2X0PA 3LR6A 3GTPA 2N3EA 2X0OA 2LYIA 1TWCA 1I50A 2F5JA 2A6HD 1TWHA 2AQLA 1HQMD 2LTHA 4CEHA 2A68D 1I6VD 2E2HA 4FBSA 2VK9A 4QIWA 3CQZA 2A69D 2VUMA 2JA6A 2O5JD 2LPJA 2R93A 3GTGA 2JA7A 3LRDA 1YNJD 2MX9A 1IW7D 2R92A 1TWFA 2B63A 1TWGA 2E2IA 1WCMA 1YNND 3GTKA 1I3QA 2K3OA 1Y1WA 2X0QA 1ZYRD 2K3NA 3GTJA 1SMYD 4C2MA 3LR8A 1TWAA 2CW0D 2R7ZA 2Y0NA 2JA5A 3GTMA 3GTQA 2MQAA 3FKIA 4CEJA 2LPIA 2K3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR8 A;  2LTH A;  3LRD A;  3LR6 A;  2MX9 A;  2LPI A;  2N3E A;  3LR2 A;  2MX8 A;  2LPJ A;  4FBS A;  5IZ2 A;  2K3Q A; 
#chains in the Genus database with same CATH topology
 3GTL A;  2FIO A;  1Y1V A;  3H0G A;  2YU9 A;  3EZB A;  3GTO A;  2EZB A;  2NVX A;  3U4Q A;  2MX8 A;  1SFO A;  3EZA A;  4CEI A;  2NVY A;  2LKM B;  2FIP A;  2HRO A;  4C5S A;  4C5U A;  3U44 A;  1K83 A;  2A6E D;  2N1D B;  2BE5 D;  1R9T A;  5IZ2 A;  3LR2 A;  2X0P A;  1W27 A;  3LR6 A;  3GTP A;  2N3E A;  2X0O A;  2LYI A;  4BAA A;  1TWC A;  1I50 A;  2F5J A;  2A6H D;  2EZC A;  1TWH A;  2AQL A;  1HQM D;  2YII A;  2HWG A;  2LTH A;  4CEH A;  2A68 D;  1I6V D;  4C6G A;  2E2H A;  4FBS A;  2VK9 A;  4CQ5 A;  4QIW A;  3CQZ A;  2A69 D;  4V2Q A;  4BAB A;  2VUM A;  2JA6 A;  1T6J A;  1Y2M A;  2O5J D;  2LPJ A;  2R93 A;  2MP0 A;  1T6P A;  3GTG A;  2JA7 A;  3LRD A;  1YNJ D;  2MX9 A;  1IW7 D;  2R92 A;  1TWF A;  2B63 A;  1TWG A;  2E2I A;  1WCM A;  1YNN D;  3GTK A;  1I3Q A;  2K3O A;  4C5R A;  1Y1W A;  2X0Q A;  4V2R A;  1ZYM A;  1ZYR D;  2K3N A;  3GTJ A;  1EZB A;  1SMY D;  4C2M A;  2EZA A;  3EZE A;  3LR8 A;  1TWA A;  1EZA A;  3NZ4 A;  2CW0 D;  2R7Z A;  2Y0N A;  2JA5 A;  3GTM A;  3GTQ A;  2MQA A;  3FKI A;  4CEJ A;  2LPI A;  2K3Q A; 
#chains in the Genus database with same CATH homology
 3GTL A;  2FIO A;  1Y1V A;  3H0G A;  2YU9 A;  3GTO A;  2NVX A;  3U4Q A;  2MX8 A;  1SFO A;  4CEI A;  2NVY A;  2LKM B;  2FIP A;  3U44 A;  1K83 A;  2A6E D;  2N1D B;  2BE5 D;  1R9T A;  5IZ2 A;  3LR2 A;  2X0P A;  3LR6 A;  3GTP A;  2N3E A;  2X0O A;  2LYI A;  1TWC A;  1I50 A;  2F5J A;  2A6H D;  1TWH A;  2AQL A;  1HQM D;  2LTH A;  4CEH A;  2A68 D;  1I6V D;  2E2H A;  4FBS A;  2VK9 A;  4QIW A;  3CQZ A;  2A69 D;  2VUM A;  2JA6 A;  2O5J D;  2LPJ A;  2R93 A;  3GTG A;  2JA7 A;  3LRD A;  1YNJ D;  2MX9 A;  1IW7 D;  2R92 A;  1TWF A;  2B63 A;  1TWG A;  2E2I A;  1WCM A;  1YNN D;  3GTK A;  1I3Q A;  2K3O A;  1Y1W A;  2X0Q A;  1ZYR D;  2K3N A;  3GTJ A;  1SMY D;  4C2M A;  3LR8 A;  1TWA A;  2CW0 D;  2R7Z A;  2Y0N A;  2JA5 A;  3GTM A;  3GTQ A;  2MQA A;  3FKI A;  4CEJ A;  2LPI A;  2K3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...