3LR8A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAQIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
total genus 53
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr8A01
2LPJA 3LR6A 5IZ2A 2MX9A 2MX8A 4FBSA 3LRDA 3LR2A 3LR8A 2K3QA 2LTHA 2N3EA 2LPIA
chains in the Genus database with same CATH superfamily
3EZEA 3U4QA 3GTPA 2X0QA 3FKIA 1YNJD 1TWCA 2AQLA 2JA5A 2BE5D 2O5JD 2K3OA 1I6VD 3GTGA 3GTQA 3NZ4A 2MX8A 2HWGA 2LTHA 4CQ5A 1K83A 3GTJA 4QIWA 3GTOA 4CEHA 4CEIA 3H0GA 3CQZA 2LYIA 4V2QA 2LPJA 3GTKA 5IZ2A 2A6HD 1ZYMA 2EZCA 2VK9A 3EZBA 1TWAA 2EZBA 3LR8A 2JA6A 4V2RA 3LR6A 1T6PA 2E2IA 2A6ED 2FIPA 4CEJA 4BAAA 3U44A 2YIIA 2JA7A 1SFOA 3GTMA 4C5SA 1TWHA 2LKMB 1Y1VA 1EZBA 2A69D 1W27A 2R93A 2X0PA 1T6JA 2B63A 2FIOA 1R9TA 4C6GA 2VUMA 2N3EA 2Y0NA 3GTLA 2R92A 2CW0D 2E2HA 2EZAA 2F5JA 2X0OA 2N1DB 1YNND 1ZYRD 1TWFA 3EZAA 3LRDA 2MP0A 2HROA 4C5UA 1SMYD 1Y2MA 1EZAA 1HQMD 1IW7D 2LPIA 2K3NA 2MX9A 4FBSA 2R7ZA 2NVXA 2NVYA 1TWGA 1I3QA 2MQAA 4C2MA 3LR2A 2K3QA 4BABA 1Y1WA 4C5RA 2A68D 2YU9A 1WCMA 1I50A
chains in the Genus database with same CATH topology
3U4QA 3GTPA 2X0QA 3FKIA 1YNJD 1TWCA 2AQLA 2JA5A 2BE5D 2O5JD 2K3OA 1I6VD 3GTGA 3GTQA 2MX8A 2LTHA 1K83A 3GTJA 4QIWA 3GTOA 4CEHA 4CEIA 3H0GA 3CQZA 2LYIA 2LPJA 3GTKA 5IZ2A 2A6HD 2VK9A 1TWAA 3LR8A 2JA6A 3LR6A 2E2IA 2A6ED 2FIPA 4CEJA 3U44A 2JA7A 1SFOA 3GTMA 1TWHA 2LKMB 1Y1VA 2A69D 2R93A 2X0PA 2B63A 2FIOA 1R9TA 2VUMA 2N3EA 2Y0NA 3GTLA 2R92A 2CW0D 2E2HA 2F5JA 2X0OA 2N1DB 1YNND 1ZYRD 1TWFA 3LRDA 1SMYD 1HQMD 1IW7D 2LPIA 2K3NA 2MX9A 4FBSA 2R7ZA 2NVXA 2NVYA 1TWGA 1I3QA 2MQAA 4C2MA 3LR2A 2K3QA 1Y1WA 2A68D 2YU9A 1WCMA 1I50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPJ A;  3LR6 A;  5IZ2 A;  2MX9 A;  2MX8 A;  4FBS A;  3LRD A;  3LR2 A;  3LR8 A;  2K3Q A;  2LTH A;  2N3E A;  2LPI A; 
#chains in the Genus database with same CATH topology
 3EZE A;  3U4Q A;  3GTP A;  2X0Q A;  3FKI A;  1YNJ D;  1TWC A;  2AQL A;  2JA5 A;  2BE5 D;  2O5J D;  2K3O A;  1I6V D;  3GTG A;  3GTQ A;  3NZ4 A;  2MX8 A;  2HWG A;  2LTH A;  4CQ5 A;  1K83 A;  3GTJ A;  4QIW A;  3GTO A;  4CEH A;  4CEI A;  3H0G A;  3CQZ A;  2LYI A;  4V2Q A;  2LPJ A;  3GTK A;  5IZ2 A;  2A6H D;  1ZYM A;  2EZC A;  2VK9 A;  3EZB A;  1TWA A;  2EZB A;  3LR8 A;  2JA6 A;  4V2R A;  3LR6 A;  1T6P A;  2E2I A;  2A6E D;  2FIP A;  4CEJ A;  4BAA A;  3U44 A;  2YII A;  2JA7 A;  1SFO A;  3GTM A;  4C5S A;  1TWH A;  2LKM B;  1Y1V A;  1EZB A;  2A69 D;  1W27 A;  2R93 A;  2X0P A;  1T6J A;  2B63 A;  2FIO A;  1R9T A;  4C6G A;  2VUM A;  2N3E A;  2Y0N A;  3GTL A;  2R92 A;  2CW0 D;  2E2H A;  2EZA A;  2F5J A;  2X0O A;  2N1D B;  1YNN D;  1ZYR D;  1TWF A;  3EZA A;  3LRD A;  2MP0 A;  2HRO A;  4C5U A;  1SMY D;  1Y2M A;  1EZA A;  1HQM D;  1IW7 D;  2LPI A;  2K3N A;  2MX9 A;  4FBS A;  2R7Z A;  2NVX A;  2NVY A;  1TWG A;  1I3Q A;  2MQA A;  4C2M A;  3LR2 A;  2K3Q A;  4BAB A;  1Y1W A;  4C5R A;  2A68 D;  2YU9 A;  1WCM A;  1I50 A; 
#chains in the Genus database with same CATH homology
 3U4Q A;  3GTP A;  2X0Q A;  3FKI A;  1YNJ D;  1TWC A;  2AQL A;  2JA5 A;  2BE5 D;  2O5J D;  2K3O A;  1I6V D;  3GTG A;  3GTQ A;  2MX8 A;  2LTH A;  1K83 A;  3GTJ A;  4QIW A;  3GTO A;  4CEH A;  4CEI A;  3H0G A;  3CQZ A;  2LYI A;  2LPJ A;  3GTK A;  5IZ2 A;  2A6H D;  2VK9 A;  1TWA A;  3LR8 A;  2JA6 A;  3LR6 A;  2E2I A;  2A6E D;  2FIP A;  4CEJ A;  3U44 A;  2JA7 A;  1SFO A;  3GTM A;  1TWH A;  2LKM B;  1Y1V A;  2A69 D;  2R93 A;  2X0P A;  2B63 A;  2FIO A;  1R9T A;  2VUM A;  2N3E A;  2Y0N A;  3GTL A;  2R92 A;  2CW0 D;  2E2H A;  2F5J A;  2X0O A;  2N1D B;  1YNN D;  1ZYR D;  1TWF A;  3LRD A;  1SMY D;  1HQM D;  1IW7 D;  2LPI A;  2K3N A;  2MX9 A;  4FBS A;  2R7Z A;  2NVX A;  2NVY A;  1TWG A;  1I3Q A;  2MQA A;  4C2M A;  3LR2 A;  2K3Q A;  1Y1W A;  2A68 D;  2YU9 A;  1WCM A;  1I50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...