3LR8A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAQIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major ampullate spidroin 1
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
total genus 53
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr8A01
3LR2A 2LTHA 2LPJA 2MX8A 3LRDA 2K3QA 2MX9A 4FBSA 3LR8A 2LPIA 2N3EA 5IZ2A 3LR6A
chains in the Genus database with same CATH superfamily
1WCMA 1Y1VA 3GTJA 1ZYRD 3LR6A 2X0PA 1TWHA 1I3QA 2JA5A 1IW7D 1W27A 1R9TA 3GTPA 3H0GA 2NVXA 3GTMA 4C2MA 4CEJA 2X0OA 2FIOA 2LPJA 1Y2MA 2R92A 2MP0A 1TWFA 2JA6A 2NVYA 1TWGA 3GTKA 1TWCA 3FKIA 1ZYMA 2LTHA 1HQMD 2LYIA 1EZAA 5IZ2A 2Y0NA 4BAAA 3U44A 3EZEA 3GTLA 3U4QA 3EZAA 2LPIA 4C6GA 2YIIA 1I6VD 2EZAA 1SMYD 2AQLA 1EZBA 4V2QA 4CQ5A 2B63A 2N1DB 2K3OA 2HWGA 3LR2A 2LKMB 3GTQA 2MQAA 4FBSA 2FIPA 2N3EA 4CEIA 2R93A 3GTGA 1T6JA 1I50A 4C5UA 2X0QA 2MX9A 2HROA 1SFOA 3EZBA 2VUMA 4V2RA 2YU9A 4CEHA 4BABA 1Y1WA 2MX8A 2E2HA 4QIWA 3GTOA 2E2IA 4C5SA 2EZBA 2K3QA 2A69D 2A6HD 2O5JD 3LR8A 4C5RA 3CQZA 2VK9A 2R7ZA 2JA7A 2CW0D 3LRDA 3NZ4A 2F5JA 2A68D 1T6PA 2EZCA 2A6ED 1YNND 2BE5D 1YNJD 2K3NA 1K83A 1TWAA
chains in the Genus database with same CATH topology
1WCMA 1Y1VA 3GTJA 1ZYRD 3LR6A 2X0PA 1TWHA 1I3QA 2JA5A 1IW7D 1R9TA 3GTPA 3H0GA 2NVXA 3GTMA 4C2MA 4CEJA 2X0OA 2FIOA 2LPJA 2R92A 1TWFA 2JA6A 2NVYA 1TWGA 3GTKA 1TWCA 3FKIA 2LTHA 1HQMD 2LYIA 5IZ2A 2Y0NA 3U44A 3GTLA 3U4QA 2LPIA 1I6VD 1SMYD 2AQLA 2B63A 2N1DB 2K3OA 3LR2A 2LKMB 3GTQA 2MQAA 4FBSA 2FIPA 2N3EA 4CEIA 2R93A 3GTGA 1I50A 2X0QA 2MX9A 1SFOA 2VUMA 2YU9A 4CEHA 1Y1WA 2MX8A 2E2HA 4QIWA 3GTOA 2E2IA 2K3QA 2A69D 2A6HD 2O5JD 3LR8A 3CQZA 2VK9A 2R7ZA 2JA7A 2CW0D 3LRDA 2F5JA 2A68D 2A6ED 1YNND 2BE5D 1YNJD 2K3NA 1K83A 1TWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LR2 A;  2LTH A;  2LPJ A;  2MX8 A;  3LRD A;  2K3Q A;  2MX9 A;  4FBS A;  3LR8 A;  2LPI A;  2N3E A;  5IZ2 A;  3LR6 A; 
#chains in the Genus database with same CATH topology
 1WCM A;  1Y1V A;  3GTJ A;  1ZYR D;  3LR6 A;  2X0P A;  1TWH A;  1I3Q A;  2JA5 A;  1IW7 D;  1W27 A;  1R9T A;  3GTP A;  3H0G A;  2NVX A;  3GTM A;  4C2M A;  4CEJ A;  2X0O A;  2FIO A;  2LPJ A;  1Y2M A;  2R92 A;  2MP0 A;  1TWF A;  2JA6 A;  2NVY A;  1TWG A;  3GTK A;  1TWC A;  3FKI A;  1ZYM A;  2LTH A;  1HQM D;  2LYI A;  1EZA A;  5IZ2 A;  2Y0N A;  4BAA A;  3U44 A;  3EZE A;  3GTL A;  3U4Q A;  3EZA A;  2LPI A;  4C6G A;  2YII A;  1I6V D;  2EZA A;  1SMY D;  2AQL A;  1EZB A;  4V2Q A;  4CQ5 A;  2B63 A;  2N1D B;  2K3O A;  2HWG A;  3LR2 A;  2LKM B;  3GTQ A;  2MQA A;  4FBS A;  2FIP A;  2N3E A;  4CEI A;  2R93 A;  3GTG A;  1T6J A;  1I50 A;  4C5U A;  2X0Q A;  2MX9 A;  2HRO A;  1SFO A;  3EZB A;  2VUM A;  4V2R A;  2YU9 A;  4CEH A;  4BAB A;  1Y1W A;  2MX8 A;  2E2H A;  4QIW A;  3GTO A;  2E2I A;  4C5S A;  2EZB A;  2K3Q A;  2A69 D;  2A6H D;  2O5J D;  3LR8 A;  4C5R A;  3CQZ A;  2VK9 A;  2R7Z A;  2JA7 A;  2CW0 D;  3LRD A;  3NZ4 A;  2F5J A;  2A68 D;  1T6P A;  2EZC A;  2A6E D;  1YNN D;  2BE5 D;  1YNJ D;  2K3N A;  1K83 A;  1TWA A; 
#chains in the Genus database with same CATH homology
 1WCM A;  1Y1V A;  3GTJ A;  1ZYR D;  3LR6 A;  2X0P A;  1TWH A;  1I3Q A;  2JA5 A;  1IW7 D;  1R9T A;  3GTP A;  3H0G A;  2NVX A;  3GTM A;  4C2M A;  4CEJ A;  2X0O A;  2FIO A;  2LPJ A;  2R92 A;  1TWF A;  2JA6 A;  2NVY A;  1TWG A;  3GTK A;  1TWC A;  3FKI A;  2LTH A;  1HQM D;  2LYI A;  5IZ2 A;  2Y0N A;  3U44 A;  3GTL A;  3U4Q A;  2LPI A;  1I6V D;  1SMY D;  2AQL A;  2B63 A;  2N1D B;  2K3O A;  3LR2 A;  2LKM B;  3GTQ A;  2MQA A;  4FBS A;  2FIP A;  2N3E A;  4CEI A;  2R93 A;  3GTG A;  1I50 A;  2X0Q A;  2MX9 A;  1SFO A;  2VUM A;  2YU9 A;  4CEH A;  1Y1W A;  2MX8 A;  2E2H A;  4QIW A;  3GTO A;  2E2I A;  2K3Q A;  2A69 D;  2A6H D;  2O5J D;  3LR8 A;  3CQZ A;  2VK9 A;  2R7Z A;  2JA7 A;  2CW0 D;  3LRD A;  2F5J A;  2A68 D;  2A6E D;  1YNN D;  2BE5 D;  1YNJ D;  2K3N A;  1K83 A;  1TWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...