3LR8A

Self-assembly of spider silk proteins is controlled by a ph-sensitive relay
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
GSGNSHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDMSTIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAQIAASEEGGGSLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-assembly of spider silk proteins is controlled by a pH-sensitive relay.
pubmed doi rcsb
source organism Euprosthenops australis
molecule tags Structural protein
molecule keywords Major ampullate spidroin 1
total genus 53
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16763 Spidroin_N Major ampullate spidroin 1, spider silk protein 1, N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.70 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 3lr8A01
2N3EA 2LPIA 3LR8A 2LPJA 2K3QA 4FBSA 2MX8A 3LR2A 5IZ2A 3LR6A 2LTHA 3LRDA 2MX9A
chains in the Genus database with same CATH superfamily
2JA5A 2A69D 1YNND 3U4QA 4C6GA 1R9TA 3GTLA 2O5JD 1EZBA 4CEJA 2X0PA 3CQZA 2YU9A 2MP0A 2NVXA 1Y1WA 2N1DB 2NVYA 2YIIA 4FBSA 3H0GA 2FIOA 1IW7D 4CQ5A 2BE5D 3GTOA 4C2MA 2FIPA 3LRDA 2HROA 2LPJA 2R93A 1K83A 2E2HA 3FKIA 2A6ED 2K3QA 2VUMA 2A6HD 1I6VD 2AQLA 2LYIA 2N3EA 2JA7A 1ZYMA 1HQMD 3EZAA 2X0QA 2MX9A 2Y0NA 2LKMB 1Y1VA 1YNJD 3LR6A 1SMYD 1EZAA 1I50A 3EZBA 2R92A 2MX8A 4V2QA 4QIWA 2JA6A 3GTPA 2A68D 3GTJA 3GTMA 1TWAA 2F5JA 1TWFA 3EZEA 2R7ZA 3LR2A 2K3NA 4C5SA 2E2IA 4C5UA 3NZ4A 4BAAA 4CEIA 3GTKA 1I3QA 1TWCA 4BABA 3LR8A 2X0OA 2MQAA 2HWGA 5IZ2A 1WCMA 1ZYRD 2VK9A 2LPIA 1Y2MA 2K3OA 1T6JA 3U44A 2EZCA 2LTHA 1TWHA 2EZAA 4C5RA 4CEHA 2CW0D 4V2RA 1SFOA 1T6PA 1W27A 1TWGA 3GTQA 2B63A 2EZBA 3GTGA
chains in the Genus database with same CATH topology
2JA5A 2A69D 1YNND 3U4QA 1R9TA 3GTLA 2O5JD 4CEJA 2X0PA 3CQZA 2YU9A 2NVXA 1Y1WA 2N1DB 2NVYA 4FBSA 3H0GA 2FIOA 1IW7D 2BE5D 3GTOA 4C2MA 2FIPA 3LRDA 2LPJA 2R93A 1K83A 2E2HA 3FKIA 2A6ED 2K3QA 2VUMA 2A6HD 1I6VD 2AQLA 2LYIA 2N3EA 2JA7A 1HQMD 2X0QA 2MX9A 2Y0NA 2LKMB 1Y1VA 1YNJD 3LR6A 1SMYD 1I50A 2R92A 2MX8A 4QIWA 2JA6A 3GTPA 2A68D 3GTJA 3GTMA 1TWAA 2F5JA 1TWFA 2R7ZA 3LR2A 2K3NA 2E2IA 4CEIA 3GTKA 1I3QA 1TWCA 3LR8A 2X0OA 2MQAA 5IZ2A 1WCMA 1ZYRD 2VK9A 2LPIA 2K3OA 3U44A 2LTHA 1TWHA 4CEHA 2CW0D 1SFOA 2B63A 1TWGA 3GTQA 3GTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3E A;  2LPI A;  3LR8 A;  2LPJ A;  2K3Q A;  4FBS A;  2MX8 A;  3LR2 A;  5IZ2 A;  3LR6 A;  2LTH A;  3LRD A;  2MX9 A; 
#chains in the Genus database with same CATH topology
 2JA5 A;  2A69 D;  1YNN D;  3U4Q A;  4C6G A;  1R9T A;  3GTL A;  2O5J D;  1EZB A;  4CEJ A;  2X0P A;  3CQZ A;  2YU9 A;  2MP0 A;  2NVX A;  1Y1W A;  2N1D B;  2NVY A;  2YII A;  4FBS A;  3H0G A;  2FIO A;  1IW7 D;  4CQ5 A;  2BE5 D;  3GTO A;  4C2M A;  2FIP A;  3LRD A;  2HRO A;  2LPJ A;  2R93 A;  1K83 A;  2E2H A;  3FKI A;  2A6E D;  2K3Q A;  2VUM A;  2A6H D;  1I6V D;  2AQL A;  2LYI A;  2N3E A;  2JA7 A;  1ZYM A;  1HQM D;  3EZA A;  2X0Q A;  2MX9 A;  2Y0N A;  2LKM B;  1Y1V A;  1YNJ D;  3LR6 A;  1SMY D;  1EZA A;  1I50 A;  3EZB A;  2R92 A;  2MX8 A;  4V2Q A;  4QIW A;  2JA6 A;  3GTP A;  2A68 D;  3GTJ A;  3GTM A;  1TWA A;  2F5J A;  1TWF A;  3EZE A;  2R7Z A;  3LR2 A;  2K3N A;  4C5S A;  2E2I A;  4C5U A;  3NZ4 A;  4BAA A;  4CEI A;  3GTK A;  1I3Q A;  1TWC A;  4BAB A;  3LR8 A;  2X0O A;  2MQA A;  2HWG A;  5IZ2 A;  1WCM A;  1ZYR D;  2VK9 A;  2LPI A;  1Y2M A;  2K3O A;  1T6J A;  3U44 A;  2EZC A;  2LTH A;  1TWH A;  2EZA A;  4C5R A;  4CEH A;  2CW0 D;  4V2R A;  1SFO A;  1T6P A;  1W27 A;  1TWG A;  3GTQ A;  2B63 A;  2EZB A;  3GTG A; 
#chains in the Genus database with same CATH homology
 2JA5 A;  2A69 D;  1YNN D;  3U4Q A;  1R9T A;  3GTL A;  2O5J D;  4CEJ A;  2X0P A;  3CQZ A;  2YU9 A;  2NVX A;  1Y1W A;  2N1D B;  2NVY A;  4FBS A;  3H0G A;  2FIO A;  1IW7 D;  2BE5 D;  3GTO A;  4C2M A;  2FIP A;  3LRD A;  2LPJ A;  2R93 A;  1K83 A;  2E2H A;  3FKI A;  2A6E D;  2K3Q A;  2VUM A;  2A6H D;  1I6V D;  2AQL A;  2LYI A;  2N3E A;  2JA7 A;  1HQM D;  2X0Q A;  2MX9 A;  2Y0N A;  2LKM B;  1Y1V A;  1YNJ D;  3LR6 A;  1SMY D;  1I50 A;  2R92 A;  2MX8 A;  4QIW A;  2JA6 A;  3GTP A;  2A68 D;  3GTJ A;  3GTM A;  1TWA A;  2F5J A;  1TWF A;  2R7Z A;  3LR2 A;  2K3N A;  2E2I A;  4CEI A;  3GTK A;  1I3Q A;  1TWC A;  3LR8 A;  2X0O A;  2MQA A;  5IZ2 A;  1WCM A;  1ZYR D;  2VK9 A;  2LPI A;  2K3O A;  3U44 A;  2LTH A;  1TWH A;  4CEH A;  2CW0 D;  1SFO A;  2B63 A;  1TWG A;  3GTQ A;  3GTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...