2FIPA

Phage phi29 transcription regulator p4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
115
structure length
115
Chain Sequence
PKTQRGIYHNLKESEYVASNTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKRGFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Late genes activator
publication title The structure of phage phi29 transcription regulator p4-DNA complex reveals an N-hook motif for DNA
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transcription
total genus 38
structure length 115
sequence length 115
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.274.40 Mainly Alpha Orthogonal Bundle Enzyme I; Chain A, domain 2 Enzyme I; Chain A, domain 2 2fipA00
2FIPA 2FIOA
chains in the Genus database with same CATH superfamily
2R92A 1TWAA 2VUMA 2LYIA 3GTMA 3H0GA 4BAAA 3U4QA 2LPJA 2LTHA 2AQLA 2MX9A 2EZAA 2HROA 3FKIA 3U44A 1W27A 4C5UA 3GTJA 3EZEA 4CQ5A 2K3QA 2JA5A 1TWCA 2F5JA 3EZAA 1Y2MA 2EZCA 1Y1WA 3NZ4A 1IW7D 5IZ2A 4CEJA 1I50A 2LKMB 3GTQA 2E2HA 2E2IA 1TWHA 2A6ED 4C5SA 2FIPA 2O5JD 1ZYMA 4C2MA 2K3OA 1I3QA 1K83A 2VK9A 2YU9A 1ZYRD 2N3EA 3GTKA 1YNND 1Y1VA 2FIOA 3LRDA 1SFOA 2JA7A 4C5RA 4CEHA 2NVXA 2MX8A 2YIIA 1T6PA 3GTLA 1T6JA 1SMYD 2CW0D 1TWFA 4C6GA 3EZBA 1EZAA 2HWGA 2X0PA 2X0QA 3LR6A 2JA6A 2BE5D 2R7ZA 2A69D 2EZBA 2MQAA 1R9TA 4QIWA 4V2QA 3LR2A 4FBSA 3GTPA 2R93A 3GTOA 2A68D 1TWGA 2MP0A 3GTGA 2Y0NA 2LPIA 4V2RA 1WCMA 2A6HD 2NVYA 2K3NA 3CQZA 2N1DB 4BABA 1EZBA 2X0OA 1I6VD 1HQMD 1YNJD 2B63A 4CEIA 3LR8A
chains in the Genus database with same CATH topology
2R92A 1TWAA 2VUMA 2LYIA 3GTMA 3H0GA 3U4QA 2LPJA 2LTHA 2AQLA 2MX9A 3FKIA 3U44A 3GTJA 2K3QA 2JA5A 1TWCA 2F5JA 1Y1WA 1IW7D 5IZ2A 4CEJA 1I50A 2LKMB 3GTQA 2E2HA 2E2IA 1TWHA 2A6ED 2FIPA 2O5JD 4C2MA 2K3OA 1I3QA 1K83A 2VK9A 2YU9A 1ZYRD 2N3EA 3GTKA 1YNND 1Y1VA 2FIOA 3LRDA 1SFOA 2JA7A 4CEHA 2NVXA 2MX8A 3GTLA 1SMYD 2CW0D 1TWFA 2X0PA 2X0QA 3LR6A 2JA6A 2BE5D 2R7ZA 2A69D 2MQAA 1R9TA 4QIWA 3LR2A 4FBSA 3GTPA 2R93A 3GTOA 2A68D 1TWGA 3GTGA 2Y0NA 2LPIA 1WCMA 2A6HD 2NVYA 2K3NA 3CQZA 2N1DB 2X0OA 1I6VD 1HQMD 1YNJD 2B63A 4CEIA 3LR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIP A;  2FIO A; 
#chains in the Genus database with same CATH topology
 2R92 A;  1TWA A;  2VUM A;  2LYI A;  3GTM A;  3H0G A;  4BAA A;  3U4Q A;  2LPJ A;  2LTH A;  2AQL A;  2MX9 A;  2EZA A;  2HRO A;  3FKI A;  3U44 A;  1W27 A;  4C5U A;  3GTJ A;  3EZE A;  4CQ5 A;  2K3Q A;  2JA5 A;  1TWC A;  2F5J A;  3EZA A;  1Y2M A;  2EZC A;  1Y1W A;  3NZ4 A;  1IW7 D;  5IZ2 A;  4CEJ A;  1I50 A;  2LKM B;  3GTQ A;  2E2H A;  2E2I A;  1TWH A;  2A6E D;  4C5S A;  2FIP A;  2O5J D;  1ZYM A;  4C2M A;  2K3O A;  1I3Q A;  1K83 A;  2VK9 A;  2YU9 A;  1ZYR D;  2N3E A;  3GTK A;  1YNN D;  1Y1V A;  2FIO A;  3LRD A;  1SFO A;  2JA7 A;  4C5R A;  4CEH A;  2NVX A;  2MX8 A;  2YII A;  1T6P A;  3GTL A;  1T6J A;  1SMY D;  2CW0 D;  1TWF A;  4C6G A;  3EZB A;  1EZA A;  2HWG A;  2X0P A;  2X0Q A;  3LR6 A;  2JA6 A;  2BE5 D;  2R7Z A;  2A69 D;  2EZB A;  2MQA A;  1R9T A;  4QIW A;  4V2Q A;  3LR2 A;  4FBS A;  3GTP A;  2R93 A;  3GTO A;  2A68 D;  1TWG A;  2MP0 A;  3GTG A;  2Y0N A;  2LPI A;  4V2R A;  1WCM A;  2A6H D;  2NVY A;  2K3N A;  3CQZ A;  2N1D B;  4BAB A;  1EZB A;  2X0O A;  1I6V D;  1HQM D;  1YNJ D;  2B63 A;  4CEI A;  3LR8 A; 
#chains in the Genus database with same CATH homology
 2R92 A;  1TWA A;  2VUM A;  2LYI A;  3GTM A;  3H0G A;  3U4Q A;  2LPJ A;  2LTH A;  2AQL A;  2MX9 A;  3FKI A;  3U44 A;  3GTJ A;  2K3Q A;  2JA5 A;  1TWC A;  2F5J A;  1Y1W A;  1IW7 D;  5IZ2 A;  4CEJ A;  1I50 A;  2LKM B;  3GTQ A;  2E2H A;  2E2I A;  1TWH A;  2A6E D;  2FIP A;  2O5J D;  4C2M A;  2K3O A;  1I3Q A;  1K83 A;  2VK9 A;  2YU9 A;  1ZYR D;  2N3E A;  3GTK A;  1YNN D;  1Y1V A;  2FIO A;  3LRD A;  1SFO A;  2JA7 A;  4CEH A;  2NVX A;  2MX8 A;  3GTL A;  1SMY D;  2CW0 D;  1TWF A;  2X0P A;  2X0Q A;  3LR6 A;  2JA6 A;  2BE5 D;  2R7Z A;  2A69 D;  2MQA A;  1R9T A;  4QIW A;  3LR2 A;  4FBS A;  3GTP A;  2R93 A;  3GTO A;  2A68 D;  1TWG A;  3GTG A;  2Y0N A;  2LPI A;  1WCM A;  2A6H D;  2NVY A;  2K3N A;  3CQZ A;  2N1D B;  2X0O A;  1I6V D;  1HQM D;  1YNJ D;  2B63 A;  4CEI A;  3LR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...